F482018

General Info

Members Datasets Scaffolds Average Seq Length
815 288 1630 128

Family's Representative Sequence

Representative Sequence 3300031711|Ga0265314_10262607|Ga0265314_102626072
Length 156
Sequence MHGLSRYNPNRFAVRLLPDATDPDDTERLIMTKDAARLVLVVEDDVSVRRPLVKFLEMHGFAVVTAETSDEGLDQLRKNRVVAAVVDLRLRRGSGRDVVTSVPADVPVIIFSGVPSESAELERLRPRTRLIEKPYSLVLLVETLEEMLAESSAPNA

Samples

Sample ID Description Type Environment
1 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
176 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
177 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
178 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
179 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
180 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
181 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
182 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
183 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
184 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
185 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
186 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
187 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
189 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
190 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
191 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
192 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
193 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
194 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
200 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
201 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
209 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
210 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
214 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
215 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
216 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
217 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
222 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
223 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
224 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
225 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
226 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
227 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
228 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
229 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
230 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
231 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
234 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
235 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
236 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
237 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
238 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
239 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
240 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
241 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
242 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
243 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
244 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
245 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
246 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
258 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
259 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
260 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
267 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
268 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
269 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
270 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
271 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
272 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
273 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
274 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
281 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
282 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
283 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
284 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
285 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
286 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
287 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
288 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.12
Nodule 0
Rhizoplane 5.28
Rhizosphere 94.6
Stem 0
Stem Tuber 0
Unclassified 19.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265314_10262607 3300031711 Bacteria 985
2 Ga0065715_10443799 3300005293 Bacteria 832
3 Ga0065707_10768756 3300005295 Bacteria 592
4 Ga0070658_10012592 3300005327 Bacteria 6785
5 Ga0070683_102245138 3300005329 Unclassified 524
6 Ga0070690_100701936 3300005330 Bacteria 777
7 Ga0070670_100463438 3300005331 Bacteria 1124
8 Ga0070677_10136872 3300005333 Bacteria 1125
9 Ga0070677_10223646 3300005333 Bacteria 921
10 Ga0070677_10314871 3300005333 Archaea 800
11 Ga0068869_100082933 3300005334 Bacteria 2397
12 Ga0068869_100447990 3300005334 Bacteria 1070
13 Ga0068869_100460686 3300005334 Bacteria 1055
14 Ga0068869_100722886 3300005334 Bacteria 851
15 Ga0070666_10869830 3300005335 Bacteria 666
16 Ga0068868_100037394 3300005338 Bacteria 3763
17 Ga0068868_100119930 3300005338 Bacteria 2145
18 Ga0068868_100170374 3300005338 Bacteria 1802
19 Ga0068868_100419711 3300005338 Bacteria 1158
20 Ga0070660_100064261 3300005339 Bacteria 2855
21 Ga0070689_100094020 3300005340 Unclassified 2367
22 Ga0070689_100967094 3300005340 Bacteria 756
23 Ga0070687_100224423 3300005343 Bacteria 1153
24 Ga0070687_100506445 3300005343 Bacteria 814
25 Ga0070661_100211698 3300005344 Bacteria 1484
26 Ga0070661_100564304 3300005344 Bacteria 917
27 Ga0070692_10593538 3300005345 Bacteria 732
28 Ga0070668_100350158 3300005347 Bacteria 1250
29 Ga0070669_100046718 3300005353 Bacteria 3157
30 Ga0070669_100047404 3300005353 Unclassified 3135
31 Ga0070669_100093200 3300005353 Bacteria 2262
32 Ga0070669_100205521 3300005353 Unclassified 1551
33 Ga0070675_100004928 3300005354 Bacteria 10178
34 Ga0070675_100083888 3300005354 Bacteria 2660
35 Ga0070675_100357175 3300005354 Bacteria 1297
36 Ga0070675_100394357 3300005354 Bacteria 1234
37 Ga0070675_100769245 3300005354 Unclassified 879
38 Ga0070671_100044941 3300005355 Bacteria 3670
39 Ga0070671_100361176 3300005355 Bacteria 1240
40 Ga0070671_100365478 3300005355 Bacteria 1232
41 Ga0070674_100072587 3300005356 Unclassified 2437
42 Ga0070674_100121193 3300005356 Bacteria 1936
43 Ga0070674_100139155 3300005356 Bacteria 1820
44 Ga0070674_100183991 3300005356 Bacteria 1602
45 Ga0070674_100490309 3300005356 Bacteria 1021
46 Ga0070674_100575658 3300005356 Bacteria 948
47 Ga0070673_100063214 3300005364 Bacteria 2945
48 Ga0070673_100098118 3300005364 Unclassified 2407
49 Ga0070673_100167660 3300005364 Unclassified 1872
50 Ga0070673_100305577 3300005364 Bacteria 1401
51 Ga0070673_100811122 3300005364 Unclassified 864
52 Ga0070673_101028703 3300005364 Unclassified 768
53 Ga0070688_100134780 3300005365 Unclassified 1671
54 Ga0070688_100313434 3300005365 Bacteria 1138
55 Ga0070667_100009819 3300005367 Bacteria 7934
56 Ga0070667_100318647 3300005367 Bacteria 1403
57 Ga0070709_10080261 3300005434 Bacteria 2127
58 Ga0070709_10245755 3300005434 Bacteria 1287
59 Ga0070714_100044820 3300005435 Bacteria 3745
60 Ga0070705_100483740 3300005440 Unclassified 936
61 Ga0070705_101144018 3300005440 Bacteria 639
62 Ga0070700_100122822 3300005441 Bacteria 1742
63 Ga0070700_100856071 3300005441 Bacteria 737
64 Ga0070694_100062300 3300005444 Bacteria 2548
65 Ga0070694_100096741 3300005444 Bacteria 2081
66 Ga0070694_100705236 3300005444 Bacteria 821
67 Ga0070708_100164533 3300005445 Bacteria 2069
68 Ga0070708_100554904 3300005445 Bacteria 1083
69 Ga0070708_100771718 3300005445 Bacteria 904
70 Ga0070708_101925576 3300005445 Unclassified 548
71 Ga0070678_100612660 3300005456 Bacteria 973
72 Ga0070678_101175206 3300005456 Bacteria 711
73 Ga0070678_101499574 3300005456 Bacteria 631
74 Ga0070678_101779224 3300005456 Bacteria 581
75 Ga0070662_100344256 3300005457 Bacteria 1220
76 Ga0070662_100723809 3300005457 Bacteria 843
77 Ga0070662_101188238 3300005457 Bacteria 655
78 Ga0070662_101194822 3300005457 Bacteria 654
79 Ga0070681_10474497 3300005458 Bacteria 1163
80 Ga0070681_11423507 3300005458 Bacteria 617
81 Ga0070681_11774500 3300005458 Unclassified 544
82 Ga0068867_100046159 3300005459 Bacteria 3199
83 Ga0068867_100382326 3300005459 Bacteria 1183
84 Ga0068867_100758830 3300005459 Bacteria 861
85 Ga0068867_101181283 3300005459 Bacteria 702
86 Ga0070685_10109186 3300005466 Bacteria 1701
87 Ga0070706_100208008 3300005467 Bacteria 1827
88 Ga0070706_100475305 3300005467 Bacteria 1163
89 Ga0070706_101588395 3300005467 Viruses 597
90 Ga0070706_101865449 3300005467 Bacteria 546
91 Ga0070707_100036870 3300005468 Bacteria 4666
92 Ga0070707_100061815 3300005468 Bacteria 3593
93 Ga0070707_100263363 3300005468 Bacteria 1677
94 Ga0070707_100421753 3300005468 Unclassified 1295
95 Ga0070707_100723988 3300005468 Bacteria 958
96 Ga0070698_100014460 3300005471 Bacteria 8337
97 Ga0070698_100246029 3300005471 Bacteria 1721
98 Ga0070698_101082948 3300005471 Archaea 750
99 Ga0070698_101720080 3300005471 Bacteria 580
100 Ga0070699_100004418 3300005518 Bacteria 12429
101 Ga0070699_100127022 3300005518 Bacteria 2246
102 Ga0070699_100559274 3300005518 Bacteria 1041
103 Ga0070699_101457645 3300005518 Bacteria 628
104 Ga0070684_101378596 3300005535 Unclassified 664
105 Ga0070697_100030072 3300005536 Bacteria 4360
106 Ga0070697_100137743 3300005536 Bacteria 2051
107 Ga0070697_100384029 3300005536 Unclassified 1217
108 Ga0070697_100415161 3300005536 Bacteria 1169
109 Ga0070697_100464079 3300005536 Bacteria 1104
110 Ga0070672_100018842 3300005543 Bacteria 4998
111 Ga0070672_100111115 3300005543 Bacteria 2234
112 Ga0070672_100385756 3300005543 Bacteria 1199
113 Ga0070672_100628876 3300005543 Bacteria 936
114 Ga0070672_100916554 3300005543 Bacteria 774
115 Ga0070686_100477557 3300005544 Bacteria 963
116 Ga0070686_101120361 3300005544 Bacteria 651
117 Ga0070695_100035574 3300005545 Bacteria 3129
118 Ga0070695_100242718 3300005545 Bacteria 1307
119 Ga0070696_100054449 3300005546 Bacteria 2788
120 Ga0070696_100334602 3300005546 Bacteria 1169
121 Ga0070696_100368348 3300005546 Bacteria 1117
122 Ga0070696_100555178 3300005546 Bacteria 921
123 Ga0070693_100299339 3300005547 Bacteria 1084
124 Ga0070665_100007922 3300005548 Bacteria 10770
125 Ga0070665_100020938 3300005548 Bacteria 6572
126 Ga0070665_100044139 3300005548 Bacteria 4477
127 Ga0070665_100473760 3300005548 Bacteria 1263
128 Ga0070704_100031805 3300005549 Bacteria 3553
129 Ga0070704_100130483 3300005549 Unclassified 1947
130 Ga0070704_100206782 3300005549 Unclassified 1588
131 Ga0070704_100662055 3300005549 Bacteria 923
132 Ga0070704_100701266 3300005549 Bacteria 898
133 Ga0070704_100988370 3300005549 Bacteria 761
134 Ga0068855_100141000 3300005563 Bacteria 2748
135 Ga0070664_100403298 3300005564 Bacteria 1251
136 Ga0068854_100917123 3300005578 Bacteria 771
137 Ga0068856_100679517 3300005614 Unclassified 1050
138 Ga0070702_100473531 3300005615 Unclassified 914
139 Ga0068852_101250882 3300005616 Bacteria 764
140 Ga0068852_102033183 3300005616 Unclassified 597
141 Ga0068859_100007252 3300005617 Bacteria 11245
142 Ga0068859_100256114 3300005617 Bacteria 1841
143 Ga0068859_100341004 3300005617 Unclassified 1593
144 Ga0068859_100388259 3300005617 Unclassified 1492
145 Ga0068859_100641225 3300005617 Bacteria 1154
146 Ga0068859_101014369 3300005617 Bacteria 912
147 Ga0068859_101412808 3300005617 Unclassified 768
148 Ga0068859_101892345 3300005617 Bacteria 659
149 Ga0068859_101920156 3300005617 Bacteria 654
150 Ga0068859_102661461 3300005617 Bacteria 550
151 Ga0068864_100008563 3300005618 Bacteria 8442
152 Ga0068864_100220254 3300005618 Bacteria 1751
153 Ga0068864_102226010 3300005618 Archaea 555
154 Ga0068866_10094100 3300005718 Bacteria 1639
155 Ga0068866_10223482 3300005718 Bacteria 1137
156 Ga0068866_10232523 3300005718 Bacteria 1119
157 Ga0068866_10322634 3300005718 Bacteria 972
158 Ga0068866_10344498 3300005718 Bacteria 945
159 Ga0068866_11003586 3300005718 Bacteria 593
160 Ga0068861_100014808 3300005719 Bacteria 5481
161 Ga0068861_100375462 3300005719 Bacteria 1254
162 Ga0068861_100656303 3300005719 Bacteria 970
163 Ga0068861_100752572 3300005719 Bacteria 910
164 Ga0068870_10927106 3300005840 Bacteria 617
165 Ga0068863_100011271 3300005841 Bacteria 8659
166 Ga0068863_100767668 3300005841 Bacteria 960
167 Ga0068863_101486205 3300005841 Bacteria 686
168 Ga0068858_100116716 3300005842 Archaea 2494
169 Ga0068858_100127832 3300005842 Bacteria 2381
170 Ga0068858_100245466 3300005842 Bacteria 1700
171 Ga0068858_100466665 3300005842 Bacteria 1217
172 Ga0068858_100797066 3300005842 Bacteria 922
173 Ga0068858_102085652 3300005842 Bacteria 561
174 Ga0068860_100049142 3300005843 Bacteria 4019
175 Ga0068860_100076396 3300005843 Bacteria 3186
176 Ga0068860_100154553 3300005843 Bacteria 2211
177 Ga0068860_100402509 3300005843 Bacteria 1354
178 Ga0068860_100581434 3300005843 Bacteria 1124
179 Ga0068860_100807238 3300005843 Bacteria 952
180 Ga0068860_101234856 3300005843 Unclassified 768
181 Ga0068862_100043489 3300005844 Bacteria 3830
182 Ga0068862_100130187 3300005844 Unclassified 2225
183 Ga0068862_100372530 3300005844 Bacteria 1330
184 Ga0068862_100571967 3300005844 Bacteria 1081
185 Ga0081455_10033163 3300005937 Bacteria 4644
186 Ga0081455_10095237 3300005937 Bacteria 2403
187 Ga0081539_10012200 3300005985 Bacteria 6668
188 Ga0070717_10367399 3300006028 Bacteria 1289
189 Ga0070717_10482438 3300006028 Bacteria 1119
190 Ga0070717_10972207 3300006028 Unclassified 773
191 Ga0075432_10143502 3300006058 Bacteria 913
192 Ga0075432_10265698 3300006058 Bacteria 701
193 Ga0070715_10248955 3300006163 Unclassified 928
194 Ga0070716_100911557 3300006173 Unclassified 689
195 Ga0097621_100006112 3300006237 Bacteria 8524
196 Ga0097621_100009489 3300006237 Bacteria 7064
197 Ga0097621_100012698 3300006237 Bacteria 6257
198 Ga0097621_100023804 3300006237 Unclassified 4772
199 Ga0097621_100027466 3300006237 Bacteria 4476
200 Ga0068871_100002793 3300006358 Bacteria 11934
201 Ga0068871_100003046 3300006358 Bacteria 11499
202 Ga0068871_100007740 3300006358 Bacteria 7693
203 Ga0068871_100012348 3300006358 Bacteria 6293
204 Ga0068871_100438342 3300006358 Bacteria 1169
205 Ga0068871_100506652 3300006358 Bacteria 1089
206 Ga0068871_100561590 3300006358 Bacteria 1035
207 Ga0075428_100117748 3300006844 Bacteria 2894
208 Ga0075428_100148388 3300006844 Bacteria 2548
209 Ga0075428_100455326 3300006844 Bacteria 1370
210 Ga0075431_100092801 3300006847 Bacteria 3116
211 Ga0075431_100369325 3300006847 Archaea 1440
212 Ga0075433_10024699 3300006852 Bacteria 5075
213 Ga0075433_10078981 3300006852 Bacteria 2899
214 Ga0075433_10098176 3300006852 Bacteria 2593
215 Ga0075433_10108884 3300006852 Bacteria 2458
216 Ga0075433_10148238 3300006852 Bacteria 2086
217 Ga0075433_10490583 3300006852 Bacteria 1082
218 Ga0075434_100000776 3300006871 Bacteria 25295
219 Ga0075434_100102251 3300006871 Bacteria 2873
220 Ga0075434_100133145 3300006871 Bacteria 2505
221 Ga0075434_100500448 3300006871 Bacteria 1236
222 Ga0075434_100529729 3300006871 Bacteria 1198
223 Ga0075434_100568177 3300006871 Bacteria 1153
224 Ga0075434_101288614 3300006871 Unclassified 742
225 Ga0075429_100433410 3300006880 Bacteria 1152
226 Ga0075429_100551931 3300006880 Bacteria 1010
227 Ga0075429_100575771 3300006880 Bacteria 987
228 Ga0068865_100005193 3300006881 Bacteria 7874
229 Ga0068865_100153959 3300006881 Bacteria 1747
230 Ga0068865_100399449 3300006881 Bacteria 1125
231 Ga0075436_100001718 3300006914 Bacteria 14994
232 Ga0075436_100035222 3300006914 Bacteria 3453
233 Ga0075436_100068074 3300006914 Bacteria 2460
234 Ga0075436_100082118 3300006914 Bacteria 2235
235 Ga0075436_100186902 3300006914 Bacteria 1465
236 Ga0075436_100386884 3300006914 Unclassified 1012
237 Ga0075436_100923072 3300006914 Unclassified 653
238 Ga0097620_100007252 3300006931 Bacteria 11245
239 Ga0097620_100256122 3300006931 Bacteria 1841
240 Ga0097620_100340988 3300006931 Unclassified 1593
241 Ga0097620_100388233 3300006931 Unclassified 1492
242 Ga0097620_100641198 3300006931 Bacteria 1154
243 Ga0097620_101014319 3300006931 Bacteria 912
244 Ga0097620_101171163 3300006931 Unclassified 846
245 Ga0097620_101412800 3300006931 Unclassified 768
246 Ga0097620_101892456 3300006931 Bacteria 659
247 Ga0097620_101919824 3300006931 Bacteria 654
248 Ga0097620_102659845 3300006931 Bacteria 550
249 Ga0075435_100000189 3300007076 Bacteria 36888
250 Ga0075435_100004108 3300007076 Bacteria 9977
251 Ga0075435_100021273 3300007076 Bacteria 4986
252 Ga0075435_100025175 3300007076 Bacteria 4629
253 Ga0075435_100069738 3300007076 Bacteria 2867
254 Ga0075435_100242264 3300007076 Bacteria 1534
255 Ga0075435_100260423 3300007076 Bacteria 1478
256 Ga0075435_100315623 3300007076 Bacteria 1337
257 Ga0075435_102060320 3300007076 Unclassified 501
258 Ga0105251_10337275 3300009011 Bacteria 687
259 Ga0105240_10007971 3300009093 Bacteria 15273
260 Ga0105240_10040742 3300009093 Bacteria 5937
261 Ga0105240_10162808 3300009093 Bacteria 2648
262 Ga0105240_10612425 3300009093 Bacteria 1198
263 Ga0105240_11429199 3300009093 Unclassified 727
264 Ga0111539_10000001 3300009094 Bacteria 1035431
265 Ga0111539_10001163 3300009094 Bacteria 34801
266 Ga0111539_10041743 3300009094 Bacteria 5513
267 Ga0111539_10877699 3300009094 Unclassified 1043
268 Ga0111539_11553529 3300009094 Bacteria 767
269 Ga0111539_12621075 3300009094 Unclassified 584
270 Ga0105245_10277601 3300009098 Bacteria 1637
271 Ga0105245_10295177 3300009098 Bacteria 1589
272 Ga0105245_10360859 3300009098 Bacteria 1442
273 Ga0105245_10597083 3300009098 Bacteria 1130
274 Ga0105245_10970075 3300009098 Bacteria 894
275 Ga0105245_11323948 3300009098 Bacteria 769
276 Ga0105245_11327211 3300009098 Bacteria 769
277 Ga0105245_12112189 3300009098 Unclassified 617
278 Ga0105247_10035108 3300009101 Archaea 3055
279 Ga0105247_10060281 3300009101 Bacteria 2351
280 Ga0114129_10000304 3300009147 Bacteria 57173
281 Ga0114129_10001441 3300009147 Bacteria 32078
282 Ga0114129_10008836 3300009147 Bacteria 14376
283 Ga0114129_10014923 3300009147 Bacteria 11068
284 Ga0114129_10021549 3300009147 Bacteria 9148
285 Ga0114129_10032236 3300009147 Bacteria 7406
286 Ga0114129_10054047 3300009147 Bacteria 5632
287 Ga0114129_10163513 3300009147 Bacteria 3039
288 Ga0114129_10200874 3300009147 Bacteria 2700
289 Ga0114129_10296085 3300009147 Bacteria 2158
290 Ga0114129_10594551 3300009147 Bacteria 1434
291 Ga0114129_10893496 3300009147 Bacteria 1126
292 Ga0114129_10952269 3300009147 Bacteria 1084
293 Ga0114129_12478354 3300009147 Unclassified 620
294 Ga0114129_12964982 3300009147 Unclassified 559
295 Ga0114129_13016541 3300009147 Bacteria 553
296 Ga0105243_10146032 3300009148 Bacteria 2023
297 Ga0105243_10296654 3300009148 Bacteria 1463
298 Ga0105243_10388504 3300009148 Unclassified 1293
299 Ga0105243_10465088 3300009148 Bacteria 1190
300 Ga0105241_10115966 3300009174 Bacteria 2150
301 Ga0105242_10007403 3300009176 Bacteria 8452
302 Ga0105242_10009179 3300009176 Bacteria 7591
303 Ga0105242_10089248 3300009176 Bacteria 2591
304 Ga0105242_10565662 3300009176 Bacteria 1092
305 Ga0105242_10585879 3300009176 Bacteria 1075
306 Ga0105242_10640830 3300009176 Bacteria 1032
307 Ga0105242_10893161 3300009176 Bacteria 888
308 Ga0105242_10905622 3300009176 Unclassified 882
309 Ga0105242_11398436 3300009176 Unclassified 727
310 Ga0105248_10040761 3300009177 Bacteria 5205
311 Ga0105248_10048968 3300009177 Bacteria 4740
312 Ga0105248_10069671 3300009177 Bacteria 3949
313 Ga0105248_10080366 3300009177 Bacteria 3664
314 Ga0105248_10099960 3300009177 Bacteria 3268
315 Ga0105248_10302070 3300009177 Bacteria 1802
316 Ga0105248_11244520 3300009177 Unclassified 842
317 Ga0105248_11357468 3300009177 Bacteria 804
318 Ga0105248_12134615 3300009177 Bacteria 637
319 Ga0105248_12260191 3300009177 Bacteria 619
320 Ga0105237_10199846 3300009545 Bacteria 1998
321 Ga0105238_10508750 3300009551 Bacteria 1206
322 Ga0105238_11551387 3300009551 Bacteria 692
323 Ga0105249_10058904 3300009553 Bacteria 3522
324 Ga0105249_10843395 3300009553 Bacteria 982
325 Ga0105249_10892409 3300009553 Bacteria 956
326 Ga0105249_12157448 3300009553 Unclassified 630
327 Ga0105239_10760707 3300010375 Bacteria 1109
328 Ga0105246_10322115 3300011119 Bacteria 1256
329 Ga0105246_10384715 3300011119 Bacteria 1160
330 Ga0105246_11232811 3300011119 Archaea 690
331 Ga0157328_1018368 3300012478 Unclassified 567
332 Ga0157370_11042514 3300013104 Bacteria 740
333 Ga0157374_10040325 3300013296 Bacteria 4299
334 Ga0157374_10257291 3300013296 Unclassified 1719
335 Ga0157374_10619609 3300013296 Bacteria 1093
336 Ga0157374_11185322 3300013296 Bacteria 785
337 Ga0157378_10090322 3300013297 Bacteria 2783
338 Ga0157378_10131912 3300013297 Bacteria 2314
339 Ga0157378_11735819 3300013297 Bacteria 672
340 Ga0157378_13024023 3300013297 Bacteria 522
341 Ga0163162_10049261 3300013306 Bacteria 4222
342 Ga0163162_10155039 3300013306 Bacteria 2410
343 Ga0163162_10999959 3300013306 Bacteria 945
344 Ga0163162_11154335 3300013306 Bacteria 878
345 Ga0163162_11573505 3300013306 Bacteria 749
346 Ga0163162_12545413 3300013306 Bacteria 589
347 Ga0163162_13473214 3300013306 Bacteria 502
348 Ga0157372_11208997 3300013307 Unclassified 873
349 Ga0157375_10032644 3300013308 Bacteria 4939
350 Ga0157375_10142643 3300013308 Unclassified 2523
351 Ga0157375_10756113 3300013308 Bacteria 1123
352 Ga0157375_10797951 3300013308 Bacteria 1093
353 Ga0157375_11076476 3300013308 Bacteria 940
354 Ga0157375_11447046 3300013308 Bacteria 810
355 Ga0163163_10178821 3300014325 Bacteria 2168
356 Ga0163163_10523579 3300014325 Bacteria 1248
357 Ga0157380_10143390 3300014326 Unclassified 2055
358 Ga0157380_10507128 3300014326 Bacteria 1173
359 Ga0157380_10686266 3300014326 Unclassified 1027
360 Ga0157380_10715163 3300014326 Bacteria 1008
361 Ga0157380_11308939 3300014326 Bacteria 772
362 Ga0157380_11343240 3300014326 Bacteria 763
363 Ga0157377_10034898 3300014745 Bacteria 2754
364 Ga0157377_10365622 3300014745 Bacteria 972
365 Ga0157377_10724071 3300014745 Bacteria 725
366 Ga0157379_10010988 3300014968 Bacteria 7895
367 Ga0157379_10025920 3300014968 Bacteria 5213
368 Ga0157379_10962878 3300014968 Bacteria 812
369 Ga0157379_11184895 3300014968 Unclassified 734
370 Ga0157379_11296613 3300014968 Bacteria 703
371 Ga0157379_11793903 3300014968 Unclassified 603
372 Ga0157376_10012899 3300014969 Bacteria 6218
373 Ga0157376_10086880 3300014969 Unclassified 2697
374 Ga0157376_10111594 3300014969 Bacteria 2408
375 Ga0157376_10424767 3300014969 Bacteria 1291
376 Ga0157376_10525221 3300014969 Bacteria 1167
377 Ga0157376_10600664 3300014969 Bacteria 1095
378 Ga0157376_10733139 3300014969 Unclassified 996
379 Ga0163161_10221081 3300017792 Bacteria 1466
380 Ga0163161_11436934 3300017792 Bacteria 603
381 Ga0207656_10204214 3300025321 Unclassified 955
382 Ga0207682_10173766 3300025893 Bacteria 981
383 Ga0207642_10177406 3300025899 Bacteria 1158
384 Ga0207642_10258513 3300025899 Bacteria 992
385 Ga0207642_10370264 3300025899 Bacteria 850
386 Ga0207642_10422692 3300025899 Unclassified 802
387 Ga0207642_10581084 3300025899 Bacteria 695
388 Ga0207710_10036542 3300025900 Bacteria 2166
389 Ga0207710_10178965 3300025900 Unclassified 1040
390 Ga0207688_10264745 3300025901 Bacteria 1044
391 Ga0207688_10839974 3300025901 Bacteria 582
392 Ga0207680_10101420 3300025903 Bacteria 1850
393 Ga0207680_10159962 3300025903 Bacteria 1509
394 Ga0207680_10183012 3300025903 Bacteria 1418
395 Ga0207680_10386207 3300025903 Bacteria 988
396 Ga0207685_10592085 3300025905 Bacteria 594
397 Ga0207699_10059499 3300025906 Bacteria 2290
398 Ga0207699_10504311 3300025906 Bacteria 874
399 Ga0207645_10067485 3300025907 Bacteria 2286
400 Ga0207645_10256823 3300025907 Bacteria 1157
401 Ga0207705_10088924 3300025909 Bacteria 2260
402 Ga0207684_10283973 3300025910 Bacteria 1427
403 Ga0207684_10369012 3300025910 Bacteria 1235
404 Ga0207684_10433462 3300025910 Bacteria 1129
405 Ga0207707_10080438 3300025912 Bacteria 2846
406 Ga0207707_10391360 3300025912 Bacteria 1194
407 Ga0207695_10062269 3300025913 Bacteria 3852
408 Ga0207695_10063368 3300025913 Bacteria 3812
409 Ga0207695_10570565 3300025913 Bacteria 1013
410 Ga0207671_10168089 3300025914 Bacteria 1701
411 Ga0207660_10142932 3300025917 Bacteria 1831
412 Ga0207660_11246153 3300025917 Unclassified 605
413 Ga0207662_10057610 3300025918 Bacteria 2322
414 Ga0207662_10158413 3300025918 Bacteria 1445
415 Ga0207657_10006081 3300025919 Bacteria 12554
416 Ga0207657_10601530 3300025919 Bacteria 858
417 Ga0207652_10048088 3300025921 Bacteria 3645
418 Ga0207652_10400588 3300025921 Bacteria 1238
419 Ga0207646_10333229 3300025922 Bacteria 1371
420 Ga0207646_10432425 3300025922 Unclassified 1188
421 Ga0207646_10511335 3300025922 Bacteria 1082
422 Ga0207646_10711523 3300025922 Bacteria 898
423 Ga0207646_11314866 3300025922 Bacteria 631
424 Ga0207681_10089928 3300025923 Unclassified 2190
425 Ga0207681_10345390 3300025923 Bacteria 1190
426 Ga0207681_10939831 3300025923 Bacteria 725
427 Ga0207681_11129313 3300025923 Unclassified 658
428 Ga0207681_11641385 3300025923 Unclassified 538
429 Ga0207694_10220033 3300025924 Bacteria 1548
430 Ga0207650_10297249 3300025925 Bacteria 1318
431 Ga0207650_10765489 3300025925 Bacteria 817
432 Ga0207659_10000637 3300025926 Bacteria 20834
433 Ga0207659_10165352 3300025926 Bacteria 1741
434 Ga0207659_10300931 3300025926 Bacteria 1317
435 Ga0207659_10396980 3300025926 Bacteria 1153
436 Ga0207687_10088125 3300025927 Bacteria 2257
437 Ga0207687_10745116 3300025927 Bacteria 833
438 Ga0207687_10812495 3300025927 Bacteria 798
439 Ga0207700_11530832 3300025928 Unclassified 591
440 Ga0207664_10182318 3300025929 Bacteria 1803
441 Ga0207644_10006773 3300025931 Bacteria 7466
442 Ga0207644_10467038 3300025931 Bacteria 1038
443 Ga0207706_10077394 3300025933 Bacteria 2925
444 Ga0207706_10170600 3300025933 Bacteria 1912
445 Ga0207706_10294293 3300025933 Bacteria 1415
446 Ga0207706_10477703 3300025933 Bacteria 1077
447 Ga0207706_10654566 3300025933 Bacteria 899
448 Ga0207706_10790302 3300025933 Bacteria 807
449 Ga0207686_10057789 3300025934 Bacteria 2443
450 Ga0207686_10087097 3300025934 Bacteria 2053
451 Ga0207686_10489239 3300025934 Bacteria 953
452 Ga0207686_10739682 3300025934 Bacteria 784
453 Ga0207709_10071590 3300025935 Archaea 2202
454 Ga0207709_10391646 3300025935 Bacteria 1060
455 Ga0207670_10576900 3300025936 Unclassified 921
456 Ga0207670_10750858 3300025936 Bacteria 810
457 Ga0207669_10099901 3300025937 Bacteria 1915
458 Ga0207669_10138763 3300025937 Bacteria 1684
459 Ga0207669_10237005 3300025937 Bacteria 1350
460 Ga0207669_10290965 3300025937 Bacteria 1237
461 Ga0207669_10565564 3300025937 Bacteria 919
462 Ga0207669_10924318 3300025937 Unclassified 730
463 Ga0207669_11052373 3300025937 Bacteria 685
464 Ga0207704_10075233 3300025938 Bacteria 2158
465 Ga0207704_10578764 3300025938 Bacteria 916
466 Ga0207704_10717944 3300025938 Unclassified 829
467 Ga0207704_11130190 3300025938 Bacteria 666
468 Ga0207691_10019546 3300025940 Bacteria 6408
469 Ga0207691_10025756 3300025940 Bacteria 5520
470 Ga0207691_10424004 3300025940 Bacteria 1133
471 Ga0207691_10460108 3300025940 Bacteria 1082
472 Ga0207691_10523565 3300025940 Bacteria 1006
473 Ga0207691_10773407 3300025940 Bacteria 808
474 Ga0207711_10026730 3300025941 Bacteria 4845
475 Ga0207711_10032038 3300025941 Bacteria 4442
476 Ga0207711_10045130 3300025941 Bacteria 3766
477 Ga0207711_10094262 3300025941 Bacteria 2638
478 Ga0207711_10128602 3300025941 Bacteria 2268
479 Ga0207711_10286243 3300025941 Bacteria 1518
480 Ga0207711_10684874 3300025941 Bacteria 956
481 Ga0207689_10230024 3300025942 Bacteria 1532
482 Ga0207689_10383580 3300025942 Bacteria 1170
483 Ga0207689_10552672 3300025942 Unclassified 967
484 Ga0207689_10653785 3300025942 Bacteria 886
485 Ga0207661_10972814 3300025944 Bacteria 782
486 Ga0207679_10071806 3300025945 Bacteria 2612
487 Ga0207679_10212907 3300025945 Bacteria 1622
488 Ga0207679_10976976 3300025945 Bacteria 776
489 Ga0207667_10336673 3300025949 Bacteria 1540
490 Ga0207651_10056250 3300025960 Bacteria 2706
491 Ga0207651_10260993 3300025960 Bacteria 1422
492 Ga0207651_10399417 3300025960 Bacteria 1169
493 Ga0207651_10785291 3300025960 Bacteria 843
494 Ga0207651_10921709 3300025960 Bacteria 779
495 Ga0207651_11486750 3300025960 Bacteria 610
496 Ga0207651_11536133 3300025960 Bacteria 600
497 Ga0207712_10415008 3300025961 Bacteria 1134
498 Ga0207712_10554786 3300025961 Bacteria 989
499 Ga0207712_10710531 3300025961 Bacteria 878
500 Ga0207712_12073488 3300025961 Unclassified 509
501 Ga0207668_10241805 3300025972 Bacteria 1461
502 Ga0207668_10657224 3300025972 Bacteria 918
503 Ga0207668_10695391 3300025972 Bacteria 893
504 Ga0207640_10032202 3300025981 Bacteria 3249
505 Ga0207640_10310768 3300025981 Bacteria 1251
506 Ga0207640_11470412 3300025981 Bacteria 612
507 Ga0207658_10047007 3300025986 Bacteria 3156
508 Ga0207658_10047326 3300025986 Bacteria 3147
509 Ga0207677_10026731 3300026023 Bacteria 3624
510 Ga0207677_10139859 3300026023 Bacteria 1852
511 Ga0207677_10309145 3300026023 Bacteria 1309
512 Ga0207677_10391125 3300026023 Bacteria 1176
513 Ga0207677_10672825 3300026023 Bacteria 916
514 Ga0207677_11517129 3300026023 Bacteria 619
515 Ga0207703_10080790 3300026035 Archaea 2708
516 Ga0207703_10213043 3300026035 Bacteria 1723
517 Ga0207703_10650301 3300026035 Unclassified 1000
518 Ga0207703_10733969 3300026035 Bacteria 940
519 Ga0207703_10805945 3300026035 Bacteria 897
520 Ga0207703_10993421 3300026035 Bacteria 805
521 Ga0207703_12215109 3300026035 Unclassified 525
522 Ga0207639_10313539 3300026041 Unclassified 1390
523 Ga0207708_10014526 3300026075 Bacteria 5893
524 Ga0207708_10912844 3300026075 Unclassified 760
525 Ga0207702_10604977 3300026078 Unclassified 1076
526 Ga0207641_10001439 3300026088 Bacteria 23394
527 Ga0207641_10860684 3300026088 Bacteria 899
528 Ga0207641_12058910 3300026088 Bacteria 572
529 Ga0207648_10044459 3300026089 Bacteria 3896
530 Ga0207648_10045180 3300026089 Bacteria 3864
531 Ga0207648_10267230 3300026089 Bacteria 1527
532 Ga0207648_10303051 3300026089 Bacteria 1433
533 Ga0207648_11849341 3300026089 Bacteria 565
534 Ga0207676_10064447 3300026095 Bacteria 2914
535 Ga0207676_10181317 3300026095 Bacteria 1844
536 Ga0207675_100048362 3300026118 Bacteria 3970
537 Ga0207675_100275600 3300026118 Bacteria 1633
538 Ga0207675_100387325 3300026118 Bacteria 1375
539 Ga0207675_100621867 3300026118 Bacteria 1084
540 Ga0207675_102098936 3300026118 Unclassified 582
541 Ga0207675_102204307 3300026118 Bacteria 566
542 Ga0207683_10106566 3300026121 Bacteria 2506
543 Ga0207683_10138777 3300026121 Bacteria 2189
544 Ga0207683_10500067 3300026121 Bacteria 1123
545 Ga0207683_10713573 3300026121 Bacteria 930
546 Ga0207683_11105561 3300026121 Bacteria 735
547 Ga0207683_11393168 3300026121 Bacteria 648
548 Ga0207698_10911727 3300026142 Bacteria 886
549 Ga0207698_11602920 3300026142 Unclassified 666
550 Ga0207428_10000002 3300027907 Bacteria 854851
551 Ga0207428_10037252 3300027907 Bacteria 3958
552 Ga0207428_10917606 3300027907 Bacteria 618
553 Ga0268266_10019305 3300028379 Bacteria 5806
554 Ga0268266_10118962 3300028379 Bacteria 2349
555 Ga0268266_10701308 3300028379 Bacteria 975
556 Ga0268265_10112247 3300028380 Unclassified 2228
557 Ga0268265_10168612 3300028380 Bacteria 1868
558 Ga0268265_10187836 3300028380 Bacteria 1782
559 Ga0268265_10460791 3300028380 Bacteria 1189
560 Ga0268265_10978488 3300028380 Bacteria 835
561 Ga0268265_11596331 3300028380 Unclassified 657
562 Ga0268264_10153392 3300028381 Bacteria 2068
563 Ga0268264_10339737 3300028381 Bacteria 1426
564 Ga0268264_10429873 3300028381 Bacteria 1275
565 Ga0268264_10697811 3300028381 Bacteria 1008
566 Ga0268264_10762872 3300028381 Bacteria 964
567 Ga0268264_11069935 3300028381 Bacteria 814
568 Ga0268264_11256535 3300028381 Bacteria 750
569 Ga0268264_11544979 3300028381 Bacteria 674
570 Ga0268264_11567202 3300028381 Unclassified 669
571 Ga0265330_10183302 3300031235 Bacteria 887
572 Ga0307408_101282512 3300031548 Bacteria 686
573 Ga0307408_101326310 3300031548 Bacteria 675
574 Ga0307408_101910592 3300031548 Unclassified 569
575 Ga0307406_11396297 3300031901 Bacteria 614
576 Ga0307407_11321949 3300031903 Bacteria 566
577 Ga0307412_10794267 3300031911 Bacteria 821
578 Ga0307412_11676121 3300031911 Bacteria 582
579 Ga0307409_100402933 3300031995 Bacteria 1307
580 Ga0307416_100438744 3300032002 Unclassified 1355
581 Ga0373930_0000245 3300034816 Bacteria 6897
582 Ga0373948_0028959 3300034817 Bacteria 1105
583 Ga0373950_0002004 3300034818 Bacteria 2752
584 Ga0373959_0000405 3300034820 Bacteria 8377
585 Ga0373938_0005187 3300034957 Bacteria 2207
586 Ga0373928_0002313 3300035084 Bacteria 3703
587 Ga0373929_0014335 3300035085 Unclassified 1530
588 Ga0373929_0088576 3300035085 Unclassified 764
589 Ga0373934_0287715 3300035086 Bacteria 681
590 Ga0373940_0021100 3300035088 Bacteria 1661
591 Ga0373949_0003515 3300035090 Bacteria 3710
592 Ga0373951_0000437 3300035091 Bacteria 12172
593 Ga0373952_0019680 3300035092 Bacteria 1408
594 Ga0373923_0293796 3300035111 Unclassified 768
595 Ga0373932_0014002 3300035112 Unclassified 2008
596 Ga0373932_0142400 3300035112 Unclassified 816
597 Ga0373932_0438474 3300035112 Unclassified 511
598 Ga0373939_0001301 3300035114 Bacteria 6061
599 Ga0373941_0013444 3300035115 Bacteria 2164
600 Ga0373941_0015421 3300035115 Bacteria 2060
601 Ga0373941_0144295 3300035115 Unclassified 868
602 Ga0373945_0044414 3300035116 Bacteria 1616
603 Ga0373953_0126978 3300035117 Bacteria 1086
604 Ga0373956_0166493 3300035119 Unclassified 1040
605 Ga0373957_0339783 3300035120 Unclassified 640
606 Ga0373960_0004257 3300035121 Bacteria 3268
607 Ga0373943_0342927 3300035170 Unclassified 855
608 Ga0373943_0486564 3300035170 Bacteria 720
609 Ga0373946_0179247 3300035171 Bacteria 1005
610 Ga0373955_0044020 3300035172 Archaea 2403
611 Ga0373955_0096801 3300035172 Bacteria 1689
612 Ga0373955_0106148 3300035172 Unclassified 1619
613 Ga0373942_0018432 3300035207 Unclassified 1732
614 Ga0373942_0048593 3300035207 Unclassified 1182
615 Ga0373961_0005744 3300035241 Bacteria 2977
616 Ga0373962_0036497 3300035242 Unclassified 1368
617 Ga0373931_0076384 3300035691 Bacteria 1840
618 Ga0373935_0993189 3300035692 Bacteria 623
619 Ga0373935_1091961 3300035692 Bacteria 594
620 Ga0373933_0182731 3300035724 Bacteria 1338
621 Ga0373933_0437136 3300035724 Bacteria 855
622 Ga0373947_0088685 3300035725 Unclassified 1926
623 Ga0373937_0151733 3300036401 Unclassified 2171
624 Ga0373937_0472667 3300036401 Bacteria 1191
625 Ga0373937_0562246 3300036401 Bacteria 1083
626 Ga0373937_0629949 3300036401 Bacteria 1018
627 Ga0373937_0762680 3300036401 Bacteria 915
628 Ga0373937_0801211 3300036401 Unclassified 890
629 Ga0373925_1365082 3300037068 Bacteria 581
630 Ga0373925_1685848 3300037068 Unclassified 518
631 Ga0395898_1248308 3300037466 Bacteria 673
632 Ga0439435_0182494 3300042436 Unclassified 686
633 Ga0466963_0203622 3300044694 Bacteria 1384
634 Ga0466963_0580345 3300044694 Bacteria 792
635 Ga0451576_0042753 3300045051 Bacteria 4784
636 Ga0451576_0289395 3300045051 Bacteria 1713
637 Ga0451576_0562465 3300045051 Bacteria 1198
638 Ga0466967_0304786 3300045976 Bacteria 1533
639 Ga0466967_0312203 3300045976 Bacteria 1515
640 Ga0466967_1257198 3300045976 Unclassified 737
641 Ga0495592_0770343 3300046454 Unclassified 574
642 Ga0495603_0147776 3300046455 Bacteria 1366
643 Ga0495629_0255721 3300046459 Bacteria 1204
644 Ga0495629_0482684 3300046459 Bacteria 837
645 Ga0495651_0191693 3300046462 Bacteria 1438
646 Ga0495651_0330708 3300046462 Archaea 1013
647 Ga0495653_0146527 3300046463 Bacteria 1654
648 Ga0495653_0630818 3300046463 Bacteria 656
649 Ga0495580_0213366 3300046472 Unclassified 1328
650 Ga0495639_0128359 3300046475 Bacteria 1213
651 Ga0495594_0254331 3300046499 Bacteria 1001
652 Ga0495594_0784483 3300046499 Unclassified 537
653 Ga0495628_0071470 3300046516 Archaea 2705
654 Ga0495630_0251315 3300046517 Archaea 1351
655 Ga0495630_1398987 3300046517 Bacteria 526
656 Ga0495644_0355806 3300046523 Unclassified 577
657 Ga0495642_0260238 3300046528 Bacteria 759
658 Ga0495640_0213548 3300046533 Bacteria 1219
659 Ga0495586_0128973 3300046535 Archaea 1416
660 Ga0495587_0195115 3300046536 Bacteria 1146
661 Ga0495645_0056749 3300046543 Bacteria 2843
662 Ga0495633_0148457 3300046558 Unclassified 1083
663 Ga0495633_0280466 3300046558 Bacteria 758
664 Ga0495656_0248450 3300046615 Bacteria 898
665 Ga0495656_0688845 3300046615 Bacteria 550
666 Ga0495634_0335269 3300046642 Bacteria 908
667 Ga0495635_0438884 3300046663 Bacteria 864
668 Ga0495599_0140783 3300046678 Bacteria 1497
669 Ga0495599_0216914 3300046678 Unclassified 1172
670 Ga0495646_0499508 3300046680 Unclassified 625
671 Ga0495647_0044598 3300046681 Bacteria 1701
672 Ga0495647_0206657 3300046681 Unclassified 863
673 Ga0495647_0284674 3300046681 Bacteria 742
674 Ga0495658_0040389 3300046683 Unclassified 2594
675 Ga0495658_0096197 3300046683 Unclassified 1761
676 Ga0495658_0163528 3300046683 Bacteria 1374
677 Ga0495658_0275711 3300046683 Bacteria 1061
678 Ga0495658_0486185 3300046683 Bacteria 789
679 Ga0495669_0007102 3300046684 Bacteria 4691
680 Ga0495669_0074307 3300046684 Bacteria 1554
681 Ga0495669_0177199 3300046684 Unclassified 1015
682 Ga0495613_0394148 3300046689 Bacteria 945
683 Ga0495670_0315638 3300046691 Unclassified 839
684 Ga0495600_0078259 3300046809 Bacteria 2160
685 Ga0495581_0500155 3300047315 Unclassified 707
686 Ga0495604_0874802 3300047317 Unclassified 563
687 Ga0495674_0975457 3300047319 Bacteria 651
688 Ga0495672_0413162 3300047320 Bacteria 615
689 Ga0495680_0864358 3300047322 Bacteria 587
690 Ga0495684_0921757 3300047471 Unclassified 561
691 Ga0496101_0006384 3300048904 Bacteria 7587
692 Ga0496101_0655154 3300048904 Bacteria 830
693 Ga0496101_1102776 3300048904 Unclassified 623
694 Ga0496102_0071174 3300048905 Bacteria 3193
695 Ga0496102_0486300 3300048905 Bacteria 1156
696 Ga0496102_1857583 3300048905 Bacteria 519
697 Ga0496104_0111424 3300048907 Bacteria 2624
698 Ga0496104_0154789 3300048907 Bacteria 2200
699 Ga0496104_0193126 3300048907 Bacteria 1948
700 Ga0496104_0241441 3300048907 Bacteria 1719
701 Ga0496105_0114560 3300048908 Bacteria 2224
702 Ga0496105_0202098 3300048908 Bacteria 1622
703 Ga0496105_0562400 3300048908 Bacteria 889
704 Ga0496105_0748066 3300048908 Bacteria 747
705 Ga0496105_1346145 3300048908 Unclassified 519
706 Ga0496106_0320006 3300048909 Bacteria 1245
707 Ga0496106_0954131 3300048909 Unclassified 676
708 Ga0496106_0984749 3300048909 Unclassified 664
709 Ga0496107_0228327 3300048910 Bacteria 1385
710 Ga0496107_0495879 3300048910 Bacteria 906
711 Ga0496107_0576562 3300048910 Bacteria 832
712 Ga0496107_1280440 3300048910 Unclassified 525
713 Ga0496108_0023039 3300048911 Bacteria 5123
714 Ga0496108_0788156 3300048911 Bacteria 820
715 Ga0496108_1451490 3300048911 Bacteria 572
716 Ga0496108_1513853 3300048911 Unclassified 558
717 Ga0496109_0106622 3300048912 Bacteria 2603
718 Ga0496109_0412495 3300048912 Bacteria 1276
719 Ga0496109_1514171 3300048912 Bacteria 606
720 Ga0496110_0799479 3300048913 Bacteria 847
721 Ga0496110_1782646 3300048913 Bacteria 526
722 Ga0496112_0050925 3300048915 Bacteria 4061
723 Ga0496112_0118215 3300048915 Bacteria 2621
724 Ga0496112_0974937 3300048915 Bacteria 768
725 Ga0496112_1084914 3300048915 Bacteria 719
726 Ga0496112_1728411 3300048915 Unclassified 538
727 Ga0496112_1832169 3300048915 Unclassified 519
728 Ga0496113_0032383 3300048916 Bacteria 3800
729 Ga0496113_1497134 3300048916 Unclassified 521
730 Ga0496114_0000233 3300048917 Bacteria 40546
731 Ga0496114_0339497 3300048917 Bacteria 1328
732 Ga0496114_1707900 3300048917 Unclassified 518
733 Ga0496115_0039023 3300048918 Unclassified 3771
734 Ga0501033_1001729 3300049570 Unclassified 558
735 Ga0501036_0113960 3300049572 Unclassified 2285
736 Ga0501038_1261748 3300049574 Unclassified 535
737 Ga0501040_0109559 3300049576 Bacteria 1931
738 Ga0501041_0804657 3300049577 Unclassified 603
739 Ga0501048_0357454 3300049582 Unclassified 1042
740 Ga0501072_0765996 3300049588 Bacteria 757
741 Ga0501072_1081175 3300049588 Unclassified 624
742 Ga0501073_0325887 3300049589 Bacteria 1060
743 Ga0501074_0158801 3300049590 Unclassified 1615
744 Ga0501075_0048565 3300049591 Bacteria 3189
745 Ga0501076_1312294 3300049592 Unclassified 595
746 Ga0501076_1448133 3300049592 Bacteria 564
747 Ga0501077_0729247 3300049593 Bacteria 637
748 Ga0501081_0838868 3300049743 Unclassified 692
749 Ga0501083_1153495 3300049744 Bacteria 504
750 Ga0501045_0050177 3300049824 Bacteria 3044
751 nmdc:mga05p37_12782_c1 3300050507 Bacteria 10033
752 nmdc:mga05p37_159826_c1 3300050507 Bacteria 2752
753 nmdc:mga05p37_209765_c1 3300050507 Bacteria 2355
754 nmdc:mga05p37_4258_c1 3300050507 Bacteria 16719
755 nmdc:mga05p37_4313_c1 3300050507 Bacteria 16614
756 nmdc:mga05p37_65425_c1 3300050507 Unclassified 4473
757 nmdc:mga05p37_795253_c1 3300050507 Bacteria 1036
758 nmdc:mga05p37_884224_c1 3300050507 Bacteria 966
759 nmdc:mga09592_374685_c1 3300050508 Bacteria 1231
760 nmdc:mga09592_475115_c1 3300050508 Bacteria 1077
761 nmdc:mga09592_88186_c1 3300050508 Bacteria 2649
762 nmdc:mga06r32_294603_c1 3300050510 Bacteria 1609
763 nmdc:mga06r32_80473_c1 3300050510 Bacteria 3170
764 nmdc:mga08y16_1265735_c1 3300050511 Bacteria 706
765 nmdc:mga08y16_197841_c1 3300050511 Bacteria 2083
766 nmdc:mga08y16_201982_c1 3300050511 Bacteria 2060
767 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
768 nmdc:mga08y16_457449_c1 3300050511 Unclassified 1301
769 nmdc:mga08y16_791116_c1 3300050511 Bacteria 942
770 nmdc:mga0n895_1049307_c1 3300050512 Bacteria 794
771 nmdc:mga0n895_1060144_c1 3300050512 Bacteria 789
772 nmdc:mga0n895_121_c1 3300050512 Bacteria 46448
773 nmdc:mga0n895_14813_c1 3300050512 Bacteria 7095
774 nmdc:mga0n895_218051_c1 3300050512 Bacteria 1937
775 nmdc:mga0n895_240784_c1 3300050512 Bacteria 1836
776 nmdc:mga0n895_26137_c1 3300050512 Bacteria 5525
777 nmdc:mga0n895_426174_c1 3300050512 Bacteria 1341
778 nmdc:mga0n895_438852_c1 3300050512 Bacteria 1319
779 nmdc:mga0n895_48914_c1 3300050512 Bacteria 4141
780 nmdc:mga0n895_514927_c1 3300050512 Bacteria 1204
781 nmdc:mga0n895_77005_c1 3300050512 Bacteria 3317
782 nmdc:mga0rr50_107_c1 3300050513 Bacteria 46254
783 nmdc:mga0rr50_130263_c1 3300050513 Unclassified 2013
784 nmdc:mga0rr50_18927_c1 3300050513 Bacteria 4638
785 nmdc:mga0rr50_32117_c1 3300050513 Bacteria 3737
786 nmdc:mga0rr50_46055_c1 3300050513 Unclassified 3210
787 nmdc:mga0rr50_673_c1 3300050513 Bacteria 18292
788 nmdc:mga0rr50_809806_c1 3300050513 Unclassified 799
789 nmdc:mga08x19_20121_c1 3300050514 Bacteria 4108
790 nmdc:mga08x19_285618_c1 3300050514 Unclassified 1144
791 nmdc:mga08x19_351166_c1 3300050514 Bacteria 1030
792 nmdc:mga08x19_89438_c1 3300050514 Bacteria 2031
793 nmdc:mga08x19_967_c1 3300050514 Bacteria 17964
794 nmdc:mga0a205_1142858_c1 3300050515 Bacteria 626
795 nmdc:mga0a205_1277055_c1 3300050515 Bacteria 582
796 nmdc:mga0a205_131616_c1 3300050515 Bacteria 2402
797 nmdc:mga0a205_139466_c1 3300050515 Bacteria 2325
798 nmdc:mga0a205_196771_c1 3300050515 Unclassified 1907
799 nmdc:mga0a205_35834_c1 3300050515 Bacteria 4766
800 nmdc:mga0a205_528173_c1 3300050515 Unclassified 1036
801 nmdc:mga0a205_599235_c1 3300050515 Bacteria 955
802 nmdc:mga0a205_94698_c1 3300050515 Bacteria 2885
803 Ga0495601_0146171 3300053077 Bacteria 1543
804 Ga0495601_0240595 3300053077 Unclassified 1182
805 Ga0495595_0010931 3300053084 Bacteria 3788
806 Ga0495595_0115286 3300053084 Unclassified 1306
807 Ga0495595_0739682 3300053084 Unclassified 504
808 Ga0495619_0278926 3300053085 Bacteria 1158
809 Ga0495619_0300223 3300053085 Bacteria 1112
810 Ga0495619_0489034 3300053085 Bacteria 847
811 Ga0495619_0522967 3300053085 Unclassified 815
812 Ga0495619_0744230 3300053085 Bacteria 665
813 Ga0500658_0445202 3300053134 Bacteria 590
814 Ga0501082_0611277 3300060353 Unclassified 954
815 Ga0530510_0413395 3300061734 Unclassified 1018
816 Ga0265314_10262607
817 Ga0065715_10443799
818 Ga0065707_10768756
819 Ga0070658_10012592
820 Ga0070683_102245138
821 Ga0070690_100701936
822 Ga0070670_100463438
823 Ga0070677_10136872
824 Ga0070677_10223646
825 Ga0070677_10314871
826 Ga0068869_100082933
827 Ga0068869_100447990
828 Ga0068869_100460686
829 Ga0068869_100722886
830 Ga0070666_10869830
831 Ga0068868_100037394
832 Ga0068868_100119930
833 Ga0068868_100170374
834 Ga0068868_100419711
835 Ga0070660_100064261
836 Ga0070689_100094020
837 Ga0070689_100967094
838 Ga0070687_100224423
839 Ga0070687_100506445
840 Ga0070661_100211698
841 Ga0070661_100564304
842 Ga0070692_10593538
843 Ga0070668_100350158
844 Ga0070669_100046718
845 Ga0070669_100047404
846 Ga0070669_100093200
847 Ga0070669_100205521
848 Ga0070675_100004928
849 Ga0070675_100083888
850 Ga0070675_100357175
851 Ga0070675_100394357
852 Ga0070675_100769245
853 Ga0070671_100044941
854 Ga0070671_100361176
855 Ga0070671_100365478
856 Ga0070674_100072587
857 Ga0070674_100121193
858 Ga0070674_100139155
859 Ga0070674_100183991
860 Ga0070674_100490309
861 Ga0070674_100575658
862 Ga0070673_100063214
863 Ga0070673_100098118
864 Ga0070673_100167660
865 Ga0070673_100305577
866 Ga0070673_100811122
867 Ga0070673_101028703
868 Ga0070688_100134780
869 Ga0070688_100313434
870 Ga0070667_100009819
871 Ga0070667_100318647
872 Ga0070709_10080261
873 Ga0070709_10245755
874 Ga0070714_100044820
875 Ga0070705_100483740
876 Ga0070705_101144018
877 Ga0070700_100122822
878 Ga0070700_100856071
879 Ga0070694_100062300
880 Ga0070694_100096741
881 Ga0070694_100705236
882 Ga0070708_100164533
883 Ga0070708_100554904
884 Ga0070708_100771718
885 Ga0070708_101925576
886 Ga0070678_100612660
887 Ga0070678_101175206
888 Ga0070678_101499574
889 Ga0070678_101779224
890 Ga0070662_100344256
891 Ga0070662_100723809
892 Ga0070662_101188238
893 Ga0070662_101194822
894 Ga0070681_10474497
895 Ga0070681_11423507
896 Ga0070681_11774500
897 Ga0068867_100046159
898 Ga0068867_100382326
899 Ga0068867_100758830
900 Ga0068867_101181283
901 Ga0070685_10109186
902 Ga0070706_100208008
903 Ga0070706_100475305
904 Ga0070706_101588395
905 Ga0070706_101865449
906 Ga0070707_100036870
907 Ga0070707_100061815
908 Ga0070707_100263363
909 Ga0070707_100421753
910 Ga0070707_100723988
911 Ga0070698_100014460
912 Ga0070698_100246029
913 Ga0070698_101082948
914 Ga0070698_101720080
915 Ga0070699_100004418
916 Ga0070699_100127022
917 Ga0070699_100559274
918 Ga0070699_101457645
919 Ga0070684_101378596
920 Ga0070697_100030072
921 Ga0070697_100137743
922 Ga0070697_100384029
923 Ga0070697_100415161
924 Ga0070697_100464079
925 Ga0070672_100018842
926 Ga0070672_100111115
927 Ga0070672_100385756
928 Ga0070672_100628876
929 Ga0070672_100916554
930 Ga0070686_100477557
931 Ga0070686_101120361
932 Ga0070695_100035574
933 Ga0070695_100242718
934 Ga0070696_100054449
935 Ga0070696_100334602
936 Ga0070696_100368348
937 Ga0070696_100555178
938 Ga0070693_100299339
939 Ga0070665_100007922
940 Ga0070665_100020938
941 Ga0070665_100044139
942 Ga0070665_100473760
943 Ga0070704_100031805
944 Ga0070704_100130483
945 Ga0070704_100206782
946 Ga0070704_100662055
947 Ga0070704_100701266
948 Ga0070704_100988370
949 Ga0068855_100141000
950 Ga0070664_100403298
951 Ga0068854_100917123
952 Ga0068856_100679517
953 Ga0070702_100473531
954 Ga0068852_101250882
955 Ga0068852_102033183
956 Ga0068859_100007252
957 Ga0068859_100256114
958 Ga0068859_100341004
959 Ga0068859_100388259
960 Ga0068859_100641225
961 Ga0068859_101014369
962 Ga0068859_101412808
963 Ga0068859_101892345
964 Ga0068859_101920156
965 Ga0068859_102661461
966 Ga0068864_100008563
967 Ga0068864_100220254
968 Ga0068864_102226010
969 Ga0068866_10094100
970 Ga0068866_10223482
971 Ga0068866_10232523
972 Ga0068866_10322634
973 Ga0068866_10344498
974 Ga0068866_11003586
975 Ga0068861_100014808
976 Ga0068861_100375462
977 Ga0068861_100656303
978 Ga0068861_100752572
979 Ga0068870_10927106
980 Ga0068863_100011271
981 Ga0068863_100767668
982 Ga0068863_101486205
983 Ga0068858_100116716
984 Ga0068858_100127832
985 Ga0068858_100245466
986 Ga0068858_100466665
987 Ga0068858_100797066
988 Ga0068858_102085652
989 Ga0068860_100049142
990 Ga0068860_100076396
991 Ga0068860_100154553
992 Ga0068860_100402509
993 Ga0068860_100581434
994 Ga0068860_100807238
995 Ga0068860_101234856
996 Ga0068862_100043489
997 Ga0068862_100130187
998 Ga0068862_100372530
999 Ga0068862_100571967
1000 Ga0081455_10033163
1001 Ga0081455_10095237
1002 Ga0081539_10012200
1003 Ga0070717_10367399
1004 Ga0070717_10482438
1005 Ga0070717_10972207
1006 Ga0075432_10143502
1007 Ga0075432_10265698
1008 Ga0070715_10248955
1009 Ga0070716_100911557
1010 Ga0097621_100006112
1011 Ga0097621_100009489
1012 Ga0097621_100012698
1013 Ga0097621_100023804
1014 Ga0097621_100027466
1015 Ga0068871_100002793
1016 Ga0068871_100003046
1017 Ga0068871_100007740
1018 Ga0068871_100012348
1019 Ga0068871_100438342
1020 Ga0068871_100506652
1021 Ga0068871_100561590
1022 Ga0075428_100117748
1023 Ga0075428_100148388
1024 Ga0075428_100455326
1025 Ga0075431_100092801
1026 Ga0075431_100369325
1027 Ga0075433_10024699
1028 Ga0075433_10078981
1029 Ga0075433_10098176
1030 Ga0075433_10108884
1031 Ga0075433_10148238
1032 Ga0075433_10490583
1033 Ga0075434_100000776
1034 Ga0075434_100102251
1035 Ga0075434_100133145
1036 Ga0075434_100500448
1037 Ga0075434_100529729
1038 Ga0075434_100568177
1039 Ga0075434_101288614
1040 Ga0075429_100433410
1041 Ga0075429_100551931
1042 Ga0075429_100575771
1043 Ga0068865_100005193
1044 Ga0068865_100153959
1045 Ga0068865_100399449
1046 Ga0075436_100001718
1047 Ga0075436_100035222
1048 Ga0075436_100068074
1049 Ga0075436_100082118
1050 Ga0075436_100186902
1051 Ga0075436_100386884
1052 Ga0075436_100923072
1053 Ga0097620_100007252
1054 Ga0097620_100256122
1055 Ga0097620_100340988
1056 Ga0097620_100388233
1057 Ga0097620_100641198
1058 Ga0097620_101014319
1059 Ga0097620_101171163
1060 Ga0097620_101412800
1061 Ga0097620_101892456
1062 Ga0097620_101919824
1063 Ga0097620_102659845
1064 Ga0075435_100000189
1065 Ga0075435_100004108
1066 Ga0075435_100021273
1067 Ga0075435_100025175
1068 Ga0075435_100069738
1069 Ga0075435_100242264
1070 Ga0075435_100260423
1071 Ga0075435_100315623
1072 Ga0075435_102060320
1073 Ga0105251_10337275
1074 Ga0105240_10007971
1075 Ga0105240_10040742
1076 Ga0105240_10162808
1077 Ga0105240_10612425
1078 Ga0105240_11429199
1079 Ga0111539_10000001
1080 Ga0111539_10001163
1081 Ga0111539_10041743
1082 Ga0111539_10877699
1083 Ga0111539_11553529
1084 Ga0111539_12621075
1085 Ga0105245_10277601
1086 Ga0105245_10295177
1087 Ga0105245_10360859
1088 Ga0105245_10597083
1089 Ga0105245_10970075
1090 Ga0105245_11323948
1091 Ga0105245_11327211
1092 Ga0105245_12112189
1093 Ga0105247_10035108
1094 Ga0105247_10060281
1095 Ga0114129_10000304
1096 Ga0114129_10001441
1097 Ga0114129_10008836
1098 Ga0114129_10014923
1099 Ga0114129_10021549
1100 Ga0114129_10032236
1101 Ga0114129_10054047
1102 Ga0114129_10163513
1103 Ga0114129_10200874
1104 Ga0114129_10296085
1105 Ga0114129_10594551
1106 Ga0114129_10893496
1107 Ga0114129_10952269
1108 Ga0114129_12478354
1109 Ga0114129_12964982
1110 Ga0114129_13016541
1111 Ga0105243_10146032
1112 Ga0105243_10296654
1113 Ga0105243_10388504
1114 Ga0105243_10465088
1115 Ga0105241_10115966
1116 Ga0105242_10007403
1117 Ga0105242_10009179
1118 Ga0105242_10089248
1119 Ga0105242_10565662
1120 Ga0105242_10585879
1121 Ga0105242_10640830
1122 Ga0105242_10893161
1123 Ga0105242_10905622
1124 Ga0105242_11398436
1125 Ga0105248_10040761
1126 Ga0105248_10048968
1127 Ga0105248_10069671
1128 Ga0105248_10080366
1129 Ga0105248_10099960
1130 Ga0105248_10302070
1131 Ga0105248_11244520
1132 Ga0105248_11357468
1133 Ga0105248_12134615
1134 Ga0105248_12260191
1135 Ga0105237_10199846
1136 Ga0105238_10508750
1137 Ga0105238_11551387
1138 Ga0105249_10058904
1139 Ga0105249_10843395
1140 Ga0105249_10892409
1141 Ga0105249_12157448
1142 Ga0105239_10760707
1143 Ga0105246_10322115
1144 Ga0105246_10384715
1145 Ga0105246_11232811
1146 Ga0157328_1018368
1147 Ga0157370_11042514
1148 Ga0157374_10040325
1149 Ga0157374_10257291
1150 Ga0157374_10619609
1151 Ga0157374_11185322
1152 Ga0157378_10090322
1153 Ga0157378_10131912
1154 Ga0157378_11735819
1155 Ga0157378_13024023
1156 Ga0163162_10049261
1157 Ga0163162_10155039
1158 Ga0163162_10999959
1159 Ga0163162_11154335
1160 Ga0163162_11573505
1161 Ga0163162_12545413
1162 Ga0163162_13473214
1163 Ga0157372_11208997
1164 Ga0157375_10032644
1165 Ga0157375_10142643
1166 Ga0157375_10756113
1167 Ga0157375_10797951
1168 Ga0157375_11076476
1169 Ga0157375_11447046
1170 Ga0163163_10178821
1171 Ga0163163_10523579
1172 Ga0157380_10143390
1173 Ga0157380_10507128
1174 Ga0157380_10686266
1175 Ga0157380_10715163
1176 Ga0157380_11308939
1177 Ga0157380_11343240
1178 Ga0157377_10034898
1179 Ga0157377_10365622
1180 Ga0157377_10724071
1181 Ga0157379_10010988
1182 Ga0157379_10025920
1183 Ga0157379_10962878
1184 Ga0157379_11184895
1185 Ga0157379_11296613
1186 Ga0157379_11793903
1187 Ga0157376_10012899
1188 Ga0157376_10086880
1189 Ga0157376_10111594
1190 Ga0157376_10424767
1191 Ga0157376_10525221
1192 Ga0157376_10600664
1193 Ga0157376_10733139
1194 Ga0163161_10221081
1195 Ga0163161_11436934
1196 Ga0207656_10204214
1197 Ga0207682_10173766
1198 Ga0207642_10177406
1199 Ga0207642_10258513
1200 Ga0207642_10370264
1201 Ga0207642_10422692
1202 Ga0207642_10581084
1203 Ga0207710_10036542
1204 Ga0207710_10178965
1205 Ga0207688_10264745
1206 Ga0207688_10839974
1207 Ga0207680_10101420
1208 Ga0207680_10159962
1209 Ga0207680_10183012
1210 Ga0207680_10386207
1211 Ga0207685_10592085
1212 Ga0207699_10059499
1213 Ga0207699_10504311
1214 Ga0207645_10067485
1215 Ga0207645_10256823
1216 Ga0207705_10088924
1217 Ga0207684_10283973
1218 Ga0207684_10369012
1219 Ga0207684_10433462
1220 Ga0207707_10080438
1221 Ga0207707_10391360
1222 Ga0207695_10062269
1223 Ga0207695_10063368
1224 Ga0207695_10570565
1225 Ga0207671_10168089
1226 Ga0207660_10142932
1227 Ga0207660_11246153
1228 Ga0207662_10057610
1229 Ga0207662_10158413
1230 Ga0207657_10006081
1231 Ga0207657_10601530
1232 Ga0207652_10048088
1233 Ga0207652_10400588
1234 Ga0207646_10333229
1235 Ga0207646_10432425
1236 Ga0207646_10511335
1237 Ga0207646_10711523
1238 Ga0207646_11314866
1239 Ga0207681_10089928
1240 Ga0207681_10345390
1241 Ga0207681_10939831
1242 Ga0207681_11129313
1243 Ga0207681_11641385
1244 Ga0207694_10220033
1245 Ga0207650_10297249
1246 Ga0207650_10765489
1247 Ga0207659_10000637
1248 Ga0207659_10165352
1249 Ga0207659_10300931
1250 Ga0207659_10396980
1251 Ga0207687_10088125
1252 Ga0207687_10745116
1253 Ga0207687_10812495
1254 Ga0207700_11530832
1255 Ga0207664_10182318
1256 Ga0207644_10006773
1257 Ga0207644_10467038
1258 Ga0207706_10077394
1259 Ga0207706_10170600
1260 Ga0207706_10294293
1261 Ga0207706_10477703
1262 Ga0207706_10654566
1263 Ga0207706_10790302
1264 Ga0207686_10057789
1265 Ga0207686_10087097
1266 Ga0207686_10489239
1267 Ga0207686_10739682
1268 Ga0207709_10071590
1269 Ga0207709_10391646
1270 Ga0207670_10576900
1271 Ga0207670_10750858
1272 Ga0207669_10099901
1273 Ga0207669_10138763
1274 Ga0207669_10237005
1275 Ga0207669_10290965
1276 Ga0207669_10565564
1277 Ga0207669_10924318
1278 Ga0207669_11052373
1279 Ga0207704_10075233
1280 Ga0207704_10578764
1281 Ga0207704_10717944
1282 Ga0207704_11130190
1283 Ga0207691_10019546
1284 Ga0207691_10025756
1285 Ga0207691_10424004
1286 Ga0207691_10460108
1287 Ga0207691_10523565
1288 Ga0207691_10773407
1289 Ga0207711_10026730
1290 Ga0207711_10032038
1291 Ga0207711_10045130
1292 Ga0207711_10094262
1293 Ga0207711_10128602
1294 Ga0207711_10286243
1295 Ga0207711_10684874
1296 Ga0207689_10230024
1297 Ga0207689_10383580
1298 Ga0207689_10552672
1299 Ga0207689_10653785
1300 Ga0207661_10972814
1301 Ga0207679_10071806
1302 Ga0207679_10212907
1303 Ga0207679_10976976
1304 Ga0207667_10336673
1305 Ga0207651_10056250
1306 Ga0207651_10260993
1307 Ga0207651_10399417
1308 Ga0207651_10785291
1309 Ga0207651_10921709
1310 Ga0207651_11486750
1311 Ga0207651_11536133
1312 Ga0207712_10415008
1313 Ga0207712_10554786
1314 Ga0207712_10710531
1315 Ga0207712_12073488
1316 Ga0207668_10241805
1317 Ga0207668_10657224
1318 Ga0207668_10695391
1319 Ga0207640_10032202
1320 Ga0207640_10310768
1321 Ga0207640_11470412
1322 Ga0207658_10047007
1323 Ga0207658_10047326
1324 Ga0207677_10026731
1325 Ga0207677_10139859
1326 Ga0207677_10309145
1327 Ga0207677_10391125
1328 Ga0207677_10672825
1329 Ga0207677_11517129
1330 Ga0207703_10080790
1331 Ga0207703_10213043
1332 Ga0207703_10650301
1333 Ga0207703_10733969
1334 Ga0207703_10805945
1335 Ga0207703_10993421
1336 Ga0207703_12215109
1337 Ga0207639_10313539
1338 Ga0207708_10014526
1339 Ga0207708_10912844
1340 Ga0207702_10604977
1341 Ga0207641_10001439
1342 Ga0207641_10860684
1343 Ga0207641_12058910
1344 Ga0207648_10044459
1345 Ga0207648_10045180
1346 Ga0207648_10267230
1347 Ga0207648_10303051
1348 Ga0207648_11849341
1349 Ga0207676_10064447
1350 Ga0207676_10181317
1351 Ga0207675_100048362
1352 Ga0207675_100275600
1353 Ga0207675_100387325
1354 Ga0207675_100621867
1355 Ga0207675_102098936
1356 Ga0207675_102204307
1357 Ga0207683_10106566
1358 Ga0207683_10138777
1359 Ga0207683_10500067
1360 Ga0207683_10713573
1361 Ga0207683_11105561
1362 Ga0207683_11393168
1363 Ga0207698_10911727
1364 Ga0207698_11602920
1365 Ga0207428_10000002
1366 Ga0207428_10037252
1367 Ga0207428_10917606
1368 Ga0268266_10019305
1369 Ga0268266_10118962
1370 Ga0268266_10701308
1371 Ga0268265_10112247
1372 Ga0268265_10168612
1373 Ga0268265_10187836
1374 Ga0268265_10460791
1375 Ga0268265_10978488
1376 Ga0268265_11596331
1377 Ga0268264_10153392
1378 Ga0268264_10339737
1379 Ga0268264_10429873
1380 Ga0268264_10697811
1381 Ga0268264_10762872
1382 Ga0268264_11069935
1383 Ga0268264_11256535
1384 Ga0268264_11544979
1385 Ga0268264_11567202
1386 Ga0265330_10183302
1387 Ga0307408_101282512
1388 Ga0307408_101326310
1389 Ga0307408_101910592
1390 Ga0307406_11396297
1391 Ga0307407_11321949
1392 Ga0307412_10794267
1393 Ga0307412_11676121
1394 Ga0307409_100402933
1395 Ga0307416_100438744
1396 Ga0373930_0000245
1397 Ga0373948_0028959
1398 Ga0373950_0002004
1399 Ga0373959_0000405
1400 Ga0373938_0005187
1401 Ga0373928_0002313
1402 Ga0373929_0014335
1403 Ga0373929_0088576
1404 Ga0373934_0287715
1405 Ga0373940_0021100
1406 Ga0373949_0003515
1407 Ga0373951_0000437
1408 Ga0373952_0019680
1409 Ga0373923_0293796
1410 Ga0373932_0014002
1411 Ga0373932_0142400
1412 Ga0373932_0438474
1413 Ga0373939_0001301
1414 Ga0373941_0013444
1415 Ga0373941_0015421
1416 Ga0373941_0144295
1417 Ga0373945_0044414
1418 Ga0373953_0126978
1419 Ga0373956_0166493
1420 Ga0373957_0339783
1421 Ga0373960_0004257
1422 Ga0373943_0342927
1423 Ga0373943_0486564
1424 Ga0373946_0179247
1425 Ga0373955_0044020
1426 Ga0373955_0096801
1427 Ga0373955_0106148
1428 Ga0373942_0018432
1429 Ga0373942_0048593
1430 Ga0373961_0005744
1431 Ga0373962_0036497
1432 Ga0373931_0076384
1433 Ga0373935_0993189
1434 Ga0373935_1091961
1435 Ga0373933_0182731
1436 Ga0373933_0437136
1437 Ga0373947_0088685
1438 Ga0373937_0151733
1439 Ga0373937_0472667
1440 Ga0373937_0562246
1441 Ga0373937_0629949
1442 Ga0373937_0762680
1443 Ga0373937_0801211
1444 Ga0373925_1365082
1445 Ga0373925_1685848
1446 Ga0395898_1248308
1447 Ga0439435_0182494
1448 Ga0466963_0203622
1449 Ga0466963_0580345
1450 Ga0451576_0042753
1451 Ga0451576_0289395
1452 Ga0451576_0562465
1453 Ga0466967_0304786
1454 Ga0466967_0312203
1455 Ga0466967_1257198
1456 Ga0495592_0770343
1457 Ga0495603_0147776
1458 Ga0495629_0255721
1459 Ga0495629_0482684
1460 Ga0495651_0191693
1461 Ga0495651_0330708
1462 Ga0495653_0146527
1463 Ga0495653_0630818
1464 Ga0495580_0213366
1465 Ga0495639_0128359
1466 Ga0495594_0254331
1467 Ga0495594_0784483
1468 Ga0495628_0071470
1469 Ga0495630_0251315
1470 Ga0495630_1398987
1471 Ga0495644_0355806
1472 Ga0495642_0260238
1473 Ga0495640_0213548
1474 Ga0495586_0128973
1475 Ga0495587_0195115
1476 Ga0495645_0056749
1477 Ga0495633_0148457
1478 Ga0495633_0280466
1479 Ga0495656_0248450
1480 Ga0495656_0688845
1481 Ga0495634_0335269
1482 Ga0495635_0438884
1483 Ga0495599_0140783
1484 Ga0495599_0216914
1485 Ga0495646_0499508
1486 Ga0495647_0044598
1487 Ga0495647_0206657
1488 Ga0495647_0284674
1489 Ga0495658_0040389
1490 Ga0495658_0096197
1491 Ga0495658_0163528
1492 Ga0495658_0275711
1493 Ga0495658_0486185
1494 Ga0495669_0007102
1495 Ga0495669_0074307
1496 Ga0495669_0177199
1497 Ga0495613_0394148
1498 Ga0495670_0315638
1499 Ga0495600_0078259
1500 Ga0495581_0500155
1501 Ga0495604_0874802
1502 Ga0495674_0975457
1503 Ga0495672_0413162
1504 Ga0495680_0864358
1505 Ga0495684_0921757
1506 Ga0496101_0006384
1507 Ga0496101_0655154
1508 Ga0496101_1102776
1509 Ga0496102_0071174
1510 Ga0496102_0486300
1511 Ga0496102_1857583
1512 Ga0496104_0111424
1513 Ga0496104_0154789
1514 Ga0496104_0193126
1515 Ga0496104_0241441
1516 Ga0496105_0114560
1517 Ga0496105_0202098
1518 Ga0496105_0562400
1519 Ga0496105_0748066
1520 Ga0496105_1346145
1521 Ga0496106_0320006
1522 Ga0496106_0954131
1523 Ga0496106_0984749
1524 Ga0496107_0228327
1525 Ga0496107_0495879
1526 Ga0496107_0576562
1527 Ga0496107_1280440
1528 Ga0496108_0023039
1529 Ga0496108_0788156
1530 Ga0496108_1451490
1531 Ga0496108_1513853
1532 Ga0496109_0106622
1533 Ga0496109_0412495
1534 Ga0496109_1514171
1535 Ga0496110_0799479
1536 Ga0496110_1782646
1537 Ga0496112_0050925
1538 Ga0496112_0118215
1539 Ga0496112_0974937
1540 Ga0496112_1084914
1541 Ga0496112_1728411
1542 Ga0496112_1832169
1543 Ga0496113_0032383
1544 Ga0496113_1497134
1545 Ga0496114_0000233
1546 Ga0496114_0339497
1547 Ga0496114_1707900
1548 Ga0496115_0039023
1549 Ga0501033_1001729
1550 Ga0501036_0113960
1551 Ga0501038_1261748
1552 Ga0501040_0109559
1553 Ga0501041_0804657
1554 Ga0501048_0357454
1555 Ga0501072_0765996
1556 Ga0501072_1081175
1557 Ga0501073_0325887
1558 Ga0501074_0158801
1559 Ga0501075_0048565
1560 Ga0501076_1312294
1561 Ga0501076_1448133
1562 Ga0501077_0729247
1563 Ga0501081_0838868
1564 Ga0501083_1153495
1565 Ga0501045_0050177
1566 nmdc:mga05p37_12782_c1
1567 nmdc:mga05p37_159826_c1
1568 nmdc:mga05p37_209765_c1
1569 nmdc:mga05p37_4258_c1
1570 nmdc:mga05p37_4313_c1
1571 nmdc:mga05p37_65425_c1
1572 nmdc:mga05p37_795253_c1
1573 nmdc:mga05p37_884224_c1
1574 nmdc:mga09592_374685_c1
1575 nmdc:mga09592_475115_c1
1576 nmdc:mga09592_88186_c1
1577 nmdc:mga06r32_294603_c1
1578 nmdc:mga06r32_80473_c1
1579 nmdc:mga08y16_1265735_c1
1580 nmdc:mga08y16_197841_c1
1581 nmdc:mga08y16_201982_c1
1582 nmdc:mga08y16_3_c1
1583 nmdc:mga08y16_457449_c1
1584 nmdc:mga08y16_791116_c1
1585 nmdc:mga0n895_1049307_c1
1586 nmdc:mga0n895_1060144_c1
1587 nmdc:mga0n895_121_c1
1588 nmdc:mga0n895_14813_c1
1589 nmdc:mga0n895_218051_c1
1590 nmdc:mga0n895_240784_c1
1591 nmdc:mga0n895_26137_c1
1592 nmdc:mga0n895_426174_c1
1593 nmdc:mga0n895_438852_c1
1594 nmdc:mga0n895_48914_c1
1595 nmdc:mga0n895_514927_c1
1596 nmdc:mga0n895_77005_c1
1597 nmdc:mga0rr50_107_c1
1598 nmdc:mga0rr50_130263_c1
1599 nmdc:mga0rr50_18927_c1
1600 nmdc:mga0rr50_32117_c1
1601 nmdc:mga0rr50_46055_c1
1602 nmdc:mga0rr50_673_c1
1603 nmdc:mga0rr50_809806_c1
1604 nmdc:mga08x19_20121_c1
1605 nmdc:mga08x19_285618_c1
1606 nmdc:mga08x19_351166_c1
1607 nmdc:mga08x19_89438_c1
1608 nmdc:mga08x19_967_c1
1609 nmdc:mga0a205_1142858_c1
1610 nmdc:mga0a205_1277055_c1
1611 nmdc:mga0a205_131616_c1
1612 nmdc:mga0a205_139466_c1
1613 nmdc:mga0a205_196771_c1
1614 nmdc:mga0a205_35834_c1
1615 nmdc:mga0a205_528173_c1
1616 nmdc:mga0a205_599235_c1
1617 nmdc:mga0a205_94698_c1
1618 Ga0495601_0146171
1619 Ga0495601_0240595
1620 Ga0495595_0010931
1621 Ga0495595_0115286
1622 Ga0495595_0739682
1623 Ga0495619_0278926
1624 Ga0495619_0300223
1625 Ga0495619_0489034
1626 Ga0495619_0522967
1627 Ga0495619_0744230
1628 Ga0500658_0445202
1629 Ga0501082_0611277
1630 Ga0530510_0413395

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

39

145

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3crn-assembly1.cif.gz_B crystal structure of response regulator receiver domain protein (chey-like) from methanospirillum hungatei jf-1 0.9015 5 125
1zy2-assembly1.cif.gz_A crystal structure of the phosphorylated receiver domain of the transcription regulator ntrc1 from aquifex aeolicus 0.8981 8 124
3dgf-assembly1.cif.gz_C structure of a histidine kinase-response regulator complex reveals insights into two-component signaling and a novel cis-autophosphorylation mechanism 0.8926 6 118
6rh1-assembly1.cif.gz_C revisiting ph-gated conformational switch. complex hk853-rr468 d53a ph 7 0.891 6 118
2rdm-assembly1.cif.gz_A crystal structure of response regulator receiver protein from sinorhizobium medicae wsm419 0.8866 5 121
ID Description Score Start End Superfamily
af_I1NCE1_621_722_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9289 6 70 3.40.50.2300
af_Q2G2G2_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9189 8 70 3.40.50.2300
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9043 8 83 3.40.50.2300
af_P30843_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9037 8 83 3.40.50.2300
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8991 5 83 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1F2VT48-F1-model_v4 Response regulatory domain-containing protein 0.9847 9 124 GO:0000160
AF-A0A2V8GDY5-F1-model_v4 Response regulator 0.9751 10 118 GO:0000160
AF-A0A3N5NGM7-F1-model_v4 Response regulator 0.9499 1 121 GO:0000160
AF-A0A2V8BL56-F1-model_v4 Response regulatory domain-containing protein 0.9458 16 128 GO:0000160
AF-A0A2V8BL56-F1-model_v4 Response regulatory domain-containing protein 0.9375 16 128 GO:0000160

Map