F481988

General Info

Members Datasets Scaffolds Average Seq Length
814 268 811 305

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1165568|Ga0436365_1165568_1483_2562
Length 342
Sequence VTQEELQGQLRVETRGNELQRQSDAETPARSPAAAQVPALPWRERLASDRLWLVGVWVVLLTAPLWIGAVGGYTALATRVVVLGLAAMSINFLLGFTGFMSFGHAAFFGLGAYGAGLSLKLLAPSTPLALLVRRRGVYFAMVTIAFGQVFYYIAYRWNSLTGGDDGLRGFSRQPLHLGPVNLDILNDATLFYFFILFCFALATGLMGFLLRSPFGRSLLAIRENERRARFLGIPIELHVWISFTLSCFFMSFAGALYALLNNFADPSNLHYVMSGNLVIMAVLGGIRAFWGPLLGAAVFVVLQDYLSSITTNWMSFVGLLFVLVVLFFPRGLLGFLQPRSAG

Samples

Sample ID Description Type Environment
1 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
2 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
3 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
97 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
144 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
145 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
148 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
149 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
150 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
151 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
152 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
153 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
154 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
157 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
158 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
159 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
160 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
163 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
164 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
165 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
166 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
175 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
186 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
187 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
188 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
189 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
190 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
196 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
199 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
200 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
201 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
202 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
203 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
204 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
205 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
206 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
214 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
215 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
218 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
219 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
222 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
225 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
226 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
227 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
228 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
229 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
230 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
231 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
232 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
235 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
236 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
239 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
240 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
257 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
261 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
262 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
263 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
264 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
265 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
266 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
267 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
268 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 7.86
Rhizosphere 86.61
Stem 0
Stem Tuber 0
Unclassified 5.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10001212 3300005327 Bacteria 22108
2 Ga0070658_10016692 3300005327 Bacteria 5877
3 Ga0070683_100095544 3300005329 Bacteria 2795
4 Ga0070683_100147953 3300005329 Bacteria 2226
5 Ga0070690_100003720 3300005330 Bacteria 8399
6 Ga0070670_100011727 3300005331 Bacteria 7497
7 Ga0068869_100002056 3300005334 Bacteria 12095
8 Ga0068869_100141338 3300005334 Bacteria 1859
9 Ga0070666_10220353 3300005335 Bacteria 1338
10 Ga0070680_100005766 3300005336 Bacteria 9397
11 Ga0070680_100007540 3300005336 Bacteria 8295
12 Ga0070680_100010316 3300005336 Bacteria 7203
13 Ga0070680_100038587 3300005336 Bacteria 3862
14 Ga0070680_100079888 3300005336 Bacteria 2696
15 Ga0070680_100095507 3300005336 Bacteria 2464
16 Ga0070680_100099517 3300005336 Bacteria 2413
17 Ga0070680_100236239 3300005336 Bacteria 1544
18 Ga0070680_100321717 3300005336 Bacteria 1313
19 Ga0068868_100399502 3300005338 Bacteria 1186
20 Ga0070660_100034632 3300005339 Bacteria 3817
21 Ga0070660_100047315 3300005339 Bacteria 3300
22 Ga0070660_100083968 3300005339 Bacteria 2503
23 Ga0070660_100102218 3300005339 Bacteria 2272
24 Ga0070689_100006977 3300005340 Bacteria 7867
25 Ga0070689_100013029 3300005340 Bacteria 6007
26 Ga0070691_10006751 3300005341 Bacteria 5253
27 Ga0070661_100004970 3300005344 Bacteria 9155
28 Ga0070661_100028320 3300005344 Bacteria 4040
29 Ga0070692_10004009 3300005345 Bacteria 6084
30 Ga0070671_100006289 3300005355 Bacteria 9466
31 Ga0070671_100042208 3300005355 Bacteria 3791
32 Ga0070659_100017494 3300005366 Bacteria 5398
33 Ga0070659_100106441 3300005366 Bacteria 2261
34 Ga0070709_10047420 3300005434 Bacteria 2676
35 Ga0070714_100002138 3300005435 Bacteria 14524
36 Ga0070714_100070223 3300005435 Bacteria 3027
37 Ga0070714_100269732 3300005435 Bacteria 1578
38 Ga0070714_100271799 3300005435 Bacteria 1572
39 Ga0070713_100000065 3300005436 Bacteria 66969
40 Ga0070713_100009299 3300005436 Bacteria 7026
41 Ga0070713_100162467 3300005436 Bacteria 1994
42 Ga0070713_100263103 3300005436 Bacteria 1577
43 Ga0070713_100400126 3300005436 Bacteria 1282
44 Ga0070710_10014721 3300005437 Bacteria 3942
45 Ga0070701_10065347 3300005438 Bacteria 1930
46 Ga0070711_100019808 3300005439 Bacteria 4324
47 Ga0070711_100045350 3300005439 Bacteria 2990
48 Ga0070705_100003606 3300005440 Bacteria 7582
49 Ga0070705_100182098 3300005440 Bacteria 1424
50 Ga0070700_100001467 3300005441 Bacteria 11730
51 Ga0070694_100011614 3300005444 Bacteria 5453
52 Ga0070694_100033461 3300005444 Bacteria 3382
53 Ga0070708_100161092 3300005445 Bacteria 2091
54 Ga0070708_100189092 3300005445 Bacteria 1926
55 Ga0070708_100533424 3300005445 Bacteria 1107
56 Ga0070663_100013409 3300005455 Bacteria 5226
57 Ga0070681_10003586 3300005458 Bacteria 14558
58 Ga0070681_10011984 3300005458 Bacteria 8595
59 Ga0070681_10028904 3300005458 Bacteria 5570
60 Ga0070681_10092187 3300005458 Bacteria 2979
61 Ga0070681_10104231 3300005458 Bacteria 2779
62 Ga0070681_10168535 3300005458 Bacteria 2112
63 Ga0070681_10199476 3300005458 Bacteria 1919
64 Ga0068867_100004140 3300005459 Bacteria 10190
65 Ga0070706_100059063 3300005467 Bacteria 3539
66 Ga0070706_100164818 3300005467 Bacteria 2070
67 Ga0070706_100222207 3300005467 Bacteria 1763
68 Ga0070707_100068680 3300005468 Bacteria 3411
69 Ga0070707_100177400 3300005468 Bacteria 2077
70 Ga0070707_100459500 3300005468 Bacteria 1234
71 Ga0070698_100112606 3300005471 Bacteria 2686
72 Ga0070698_100139696 3300005471 Bacteria 2374
73 Ga0070699_100013662 3300005518 Bacteria 6986
74 Ga0070699_100016626 3300005518 Bacteria 6315
75 Ga0070699_100075570 3300005518 Bacteria 2932
76 Ga0070679_100003590 3300005530 Bacteria 14189
77 Ga0070679_100021876 3300005530 Bacteria 6246
78 Ga0070679_100030659 3300005530 Bacteria 5311
79 Ga0070679_100031365 3300005530 Bacteria 5249
80 Ga0070679_100086992 3300005530 Bacteria 3112
81 Ga0070684_100076578 3300005535 Bacteria 2953
82 Ga0070697_100002755 3300005536 Bacteria 13535
83 Ga0070697_100024702 3300005536 Bacteria 4786
84 Ga0070697_100039824 3300005536 Bacteria 3801
85 Ga0070697_100051116 3300005536 Bacteria 3357
86 Ga0070697_100093960 3300005536 Bacteria 2484
87 Ga0070697_100279858 3300005536 Bacteria 1431
88 Ga0068853_100006310 3300005539 Bacteria 9408
89 Ga0068853_100054551 3300005539 Bacteria 3445
90 Ga0068853_100078646 3300005539 Bacteria 2883
91 Ga0070686_100006725 3300005544 Bacteria 6398
92 Ga0070695_100000795 3300005545 Bacteria 16980
93 Ga0070695_100018760 3300005545 Bacteria 4203
94 Ga0070696_100069654 3300005546 Bacteria 2472
95 Ga0070693_100010668 3300005547 Bacteria 4607
96 Ga0070693_100015556 3300005547 Bacteria 3919
97 Ga0070693_100032201 3300005547 Bacteria 2881
98 Ga0070693_100033785 3300005547 Bacteria 2826
99 Ga0070665_100211366 3300005548 Bacteria 1941
100 Ga0070704_100030514 3300005549 Bacteria 3613
101 Ga0068855_100007073 3300005563 Bacteria 13610
102 Ga0068855_100017840 3300005563 Bacteria 8530
103 Ga0068855_100021639 3300005563 Bacteria 7714
104 Ga0068855_100107338 3300005563 Unclassified 3208
105 Ga0068855_100749509 3300005563 Bacteria 1041
106 Ga0070664_100026248 3300005564 Bacteria 4830
107 Ga0070664_100385973 3300005564 Bacteria 1279
108 Ga0070664_100453319 3300005564 Bacteria 1178
109 Ga0068857_100023092 3300005577 Bacteria 5471
110 Ga0068857_100055709 3300005577 Bacteria 3508
111 Ga0068857_100438020 3300005577 Bacteria 1221
112 Ga0068854_100009175 3300005578 Bacteria 6380
113 Ga0068854_100048773 3300005578 Bacteria 3022
114 Ga0068854_100125656 3300005578 Bacteria 1953
115 Ga0068856_100000476 3300005614 Bacteria 44310
116 Ga0068856_100017680 3300005614 Bacteria 6912
117 Ga0068856_100028035 3300005614 Bacteria 5495
118 Ga0068852_100114443 3300005616 Bacteria 2458
119 Ga0068852_100224561 3300005616 Bacteria 1788
120 Ga0068852_100249846 3300005616 Bacteria 1699
121 Ga0068859_100040199 3300005617 Bacteria 4695
122 Ga0068866_10002101 3300005718 Bacteria 8288
123 Ga0068851_10021741 3300005834 Bacteria 3116
124 Ga0068863_100371758 3300005841 Bacteria 1395
125 Ga0068858_100033258 3300005842 Bacteria 4787
126 Ga0068862_100110905 3300005844 Bacteria 2408
127 Ga0081455_10001982 3300005937 Bacteria 24463
128 Ga0070715_10080801 3300006163 Bacteria 1475
129 Ga0070716_100107027 3300006173 Bacteria 1726
130 Ga0070712_100000052 3300006175 Bacteria 62524
131 Ga0070712_100017096 3300006175 Bacteria 4690
132 Ga0070712_100021427 3300006175 Bacteria 4244
133 Ga0070712_100032063 3300006175 Bacteria 3546
134 Ga0097621_100014579 3300006237 Bacteria 5888
135 Ga0097621_100312542 3300006237 Bacteria 1390
136 Ga0068871_100011570 3300006358 Bacteria 6474
137 Ga0075434_100014102 3300006871 Bacteria 7632
138 Ga0075434_100212903 3300006871 Bacteria 1952
139 Ga0068865_100004018 3300006881 Bacteria 8836
140 Ga0075436_100000339 3300006914 Bacteria 29854
141 Ga0075436_100015236 3300006914 Bacteria 5265
142 Ga0075436_100016744 3300006914 Bacteria 5017
143 Ga0075436_100038128 3300006914 Bacteria 3318
144 Ga0075436_100049211 3300006914 Bacteria 2908
145 Ga0075436_100151508 3300006914 Bacteria 1632
146 Ga0097620_100040199 3300006931 Bacteria 4695
147 Ga0075435_100012722 3300007076 Bacteria 6235
148 Ga0105240_10003221 3300009093 Bacteria 25561
149 Ga0105240_10026154 3300009093 Bacteria 7658
150 Ga0105240_10107237 3300009093 Bacteria 3387
151 Ga0105240_10178313 3300009093 Bacteria 2510
152 Ga0105240_10268135 3300009093 Bacteria 1967
153 Ga0105245_10006477 3300009098 Bacteria 10296
154 Ga0105245_10043724 3300009098 Bacteria 3996
155 Ga0105245_10053683 3300009098 Bacteria 3617
156 Ga0105245_10151080 3300009098 Bacteria 2196
157 Ga0105243_10037056 3300009148 Bacteria 3787
158 Ga0105241_10053973 3300009174 Bacteria 3075
159 Ga0105242_10006151 3300009176 Bacteria 9251
160 Ga0105248_10027250 3300009177 Bacteria 6359
161 Ga0105248_10075361 3300009177 Bacteria 3792
162 Ga0105248_10461693 3300009177 Bacteria 1431
163 Ga0105237_10028324 3300009545 Bacteria 5707
164 Ga0105237_10174010 3300009545 Bacteria 2153
165 Ga0105237_10261905 3300009545 Bacteria 1732
166 Ga0105238_10003206 3300009551 Bacteria 16334
167 Ga0105238_10042262 3300009551 Bacteria 4616
168 Ga0105238_10071809 3300009551 Bacteria 3459
169 Ga0105238_10108711 3300009551 Bacteria 2754
170 Ga0105238_10263085 3300009551 Bacteria 1705
171 Ga0105239_10070408 3300010375 Bacteria 3842
172 Ga0105246_10010340 3300011119 Bacteria 5770
173 Ga0105246_10181670 3300011119 Bacteria 1620
174 Ga0157373_10047557 3300013100 Bacteria 3060
175 Ga0157373_10195093 3300013100 Bacteria 1427
176 Ga0157371_10032724 3300013102 Bacteria 3740
177 Ga0157370_10004982 3300013104 Bacteria 15030
178 Ga0157370_10013304 3300013104 Bacteria 8477
179 Ga0157370_10018409 3300013104 Bacteria 7027
180 Ga0157369_10020808 3300013105 Bacteria 7332
181 Ga0157369_10023064 3300013105 Bacteria 6936
182 Ga0157369_10100691 3300013105 Bacteria 3080
183 Ga0157369_10135780 3300013105 Bacteria 2604
184 Ga0157369_10165724 3300013105 Bacteria 2331
185 Ga0157369_10488664 3300013105 Bacteria 1274
186 Ga0157374_10015897 3300013296 Bacteria 6611
187 Ga0157374_10029820 3300013296 Bacteria 4947
188 Ga0157378_10002093 3300013297 Bacteria 17823
189 Ga0157378_10010637 3300013297 Bacteria 8040
190 Ga0163162_10323210 3300013306 Bacteria 1675
191 Ga0157372_10167721 3300013307 Bacteria 2539
192 Ga0157372_10176623 3300013307 Bacteria 2472
193 Ga0157372_10352028 3300013307 Bacteria 1716
194 Ga0157375_10017330 3300013308 Bacteria 6498
195 Ga0163163_10006821 3300014325 Bacteria 10017
196 Ga0163163_10014359 3300014325 Bacteria 7281
197 Ga0163163_10084903 3300014325 Bacteria 3173
198 Ga0163163_10162745 3300014325 Bacteria 2277
199 Ga0182008_10089019 3300014497 Bacteria 1521
200 Ga0157377_10104914 3300014745 Bacteria 1690
201 Ga0157379_10193985 3300014968 Bacteria 1835
202 Ga0157379_10270221 3300014968 Bacteria 1546
203 Ga0157376_10007767 3300014969 Bacteria 7689
204 Ga0213874_10005567 3300021377 Bacteria 2942
205 Ga0213876_10002788 3300021384 Bacteria 10179
206 Ga0213876_10040212 3300021384 Bacteria 2469
207 Ga0213876_10072442 3300021384 Bacteria 1820
208 Ga0213876_10085795 3300021384 Bacteria 1666
209 Ga0213875_10002629 3300021388 Bacteria 10642
210 Ga0213875_10005169 3300021388 Bacteria 7057
211 Ga0213875_10009158 3300021388 Bacteria 5026
212 Ga0213875_10110401 3300021388 Bacteria 1284
213 Ga0213871_10046988 3300021441 Bacteria 1173
214 Ga0228598_1000253 3300024227 Bacteria 10348
215 Ga0207692_10033935 3300025898 Bacteria 2467
216 Ga0207642_10031820 3300025899 Bacteria 2214
217 Ga0207680_10142553 3300025903 Bacteria 1590
218 Ga0207647_10150732 3300025904 Bacteria 1359
219 Ga0207685_10088304 3300025905 Bacteria 1299
220 Ga0207643_10018881 3300025908 Bacteria 3777
221 Ga0207684_10056482 3300025910 Bacteria 3330
222 Ga0207684_10341995 3300025910 Bacteria 1288
223 Ga0207654_10004049 3300025911 Bacteria 7380
224 Ga0207707_10007324 3300025912 Bacteria 9612
225 Ga0207707_10009475 3300025912 Bacteria 8444
226 Ga0207707_10021345 3300025912 Bacteria 5661
227 Ga0207707_10072597 3300025912 Bacteria 3000
228 Ga0207695_10028695 3300025913 Bacteria 6161
229 Ga0207695_10031367 3300025913 Bacteria 5829
230 Ga0207695_10069421 3300025913 Bacteria 3605
231 Ga0207695_10199900 3300025913 Bacteria 1913
232 Ga0207671_10017472 3300025914 Bacteria 5528
233 Ga0207693_10000915 3300025915 Bacteria 26473
234 Ga0207693_10004667 3300025915 Bacteria 11545
235 Ga0207693_10007700 3300025915 Bacteria 8842
236 Ga0207693_10015221 3300025915 Bacteria 6173
237 Ga0207693_10158375 3300025915 Bacteria 1781
238 Ga0207693_10229152 3300025915 Bacteria 1459
239 Ga0207693_10252385 3300025915 Bacteria 1384
240 Ga0207663_10127639 3300025916 Bacteria 1752
241 Ga0207663_10286588 3300025916 Bacteria 1225
242 Ga0207660_10006764 3300025917 Bacteria 7423
243 Ga0207660_10047433 3300025917 Bacteria 3037
244 Ga0207660_10066105 3300025917 Bacteria 2615
245 Ga0207660_10080858 3300025917 Bacteria 2387
246 Ga0207660_10091367 3300025917 Bacteria 2258
247 Ga0207660_10154327 3300025917 Bacteria 1766
248 Ga0207657_10005116 3300025919 Bacteria 13739
249 Ga0207657_10033396 3300025919 Bacteria 4639
250 Ga0207657_10039615 3300025919 Bacteria 4185
251 Ga0207657_10086551 3300025919 Bacteria 2622
252 Ga0207652_10005325 3300025921 Bacteria 10432
253 Ga0207652_10062790 3300025921 Bacteria 3211
254 Ga0207652_10114506 3300025921 Bacteria 2395
255 Ga0207646_10235966 3300025922 Bacteria 1652
256 Ga0207694_10021667 3300025924 Bacteria 4870
257 Ga0207694_10034292 3300025924 Bacteria 3891
258 Ga0207694_10066194 3300025924 Bacteria 2818
259 Ga0207694_10114885 3300025924 Bacteria 2144
260 Ga0207650_10005625 3300025925 Bacteria 8560
261 Ga0207659_10120276 3300025926 Bacteria 2012
262 Ga0207687_10006743 3300025927 Bacteria 7567
263 Ga0207687_10052797 3300025927 Bacteria 2838
264 Ga0207700_10000046 3300025928 Bacteria 87971
265 Ga0207700_10002466 3300025928 Bacteria 10612
266 Ga0207700_10004080 3300025928 Bacteria 8561
267 Ga0207700_10044479 3300025928 Bacteria 3270
268 Ga0207700_10186926 3300025928 Bacteria 1738
269 Ga0207664_10010006 3300025929 Bacteria 6683
270 Ga0207664_10057611 3300025929 Bacteria 3089
271 Ga0207664_10126435 3300025929 Bacteria 2147
272 Ga0207644_10001557 3300025931 Bacteria 14800
273 Ga0207644_10005689 3300025931 Bacteria 8115
274 Ga0207690_10005073 3300025932 Bacteria 7777
275 Ga0207690_10097558 3300025932 Bacteria 2092
276 Ga0207690_10222899 3300025932 Bacteria 1444
277 Ga0207706_10149903 3300025933 Bacteria 2051
278 Ga0207686_10006534 3300025934 Bacteria 6279
279 Ga0207709_10013178 3300025935 Bacteria 4561
280 Ga0207670_10010015 3300025936 Bacteria 5439
281 Ga0207670_10013168 3300025936 Bacteria 4868
282 Ga0207670_10395535 3300025936 Bacteria 1104
283 Ga0207704_10009822 3300025938 Bacteria 4635
284 Ga0207665_10010681 3300025939 Bacteria 6031
285 Ga0207665_10052097 3300025939 Bacteria 2757
286 Ga0207665_10187583 3300025939 Bacteria 1501
287 Ga0207665_10324947 3300025939 Bacteria 1155
288 Ga0207711_10048325 3300025941 Bacteria 3640
289 Ga0207711_10211250 3300025941 Bacteria 1772
290 Ga0207689_10000455 3300025942 Bacteria 38509
291 Ga0207689_10022758 3300025942 Bacteria 5264
292 Ga0207661_10004929 3300025944 Bacteria 9358
293 Ga0207661_10007889 3300025944 Bacteria 7587
294 Ga0207661_10273255 3300025944 Bacteria 1508
295 Ga0207661_10473189 3300025944 Bacteria 1143
296 Ga0207679_10069056 3300025945 Bacteria 2657
297 Ga0207679_10387238 3300025945 Bacteria 1227
298 Ga0207667_10037490 3300025949 Bacteria 5181
299 Ga0207667_10042794 3300025949 Bacteria 4812
300 Ga0207667_10137207 3300025949 Bacteria 2518
301 Ga0207667_10174121 3300025949 Bacteria 2211
302 Ga0207667_10174756 3300025949 Bacteria 2207
303 Ga0207667_10257280 3300025949 Unclassified 1785
304 Ga0207703_10006428 3300026035 Bacteria 9392
305 Ga0207703_10310881 3300026035 Bacteria 1440
306 Ga0207639_10066332 3300026041 Bacteria 2805
307 Ga0207639_10206147 3300026041 Bacteria 1689
308 Ga0207678_10011125 3300026067 Bacteria 7905
309 Ga0207678_10079624 3300026067 Bacteria 2805
310 Ga0207708_10000339 3300026075 Bacteria 36860
311 Ga0207702_10000514 3300026078 Bacteria 43618
312 Ga0207702_10142522 3300026078 Bacteria 2170
313 Ga0207702_10166117 3300026078 Bacteria 2019
314 Ga0207702_10426829 3300026078 Bacteria 1283
315 Ga0207702_10527407 3300026078 Bacteria 1153
316 Ga0207702_10573768 3300026078 Bacteria 1105
317 Ga0207641_10370614 3300026088 Bacteria 1369
318 Ga0207648_10001197 3300026089 Bacteria 29072
319 Ga0207674_10027845 3300026116 Bacteria 5971
320 Ga0207674_10028168 3300026116 Bacteria 5934
321 Ga0207674_10166840 3300026116 Bacteria 2156
322 Ga0207698_10034168 3300026142 Bacteria 3704
323 Ga0207698_10062472 3300026142 Bacteria 2909
324 Ga0207698_10117825 3300026142 Bacteria 2241
325 Ga0207698_10249347 3300026142 Bacteria 1623
326 Ga0265337_1000530 3300028556 Bacteria 20270
327 Ga0265334_10065421 3300028573 Bacteria 1363
328 Ga0265318_10029464 3300028577 Bacteria 2140
329 Ga0265338_10026507 3300028800 Bacteria 5842
330 Ga0265332_10004884 3300031238 Bacteria 6233
331 Ga0265332_10011382 3300031238 Bacteria 3954
332 Ga0265340_10014281 3300031247 Bacteria 4153
333 Ga0265340_10023667 3300031247 Bacteria 3130
334 Ga0265339_10004408 3300031249 Bacteria 9606
335 Ga0265331_10007186 3300031250 Bacteria 6470
336 Ga0265331_10017067 3300031250 Bacteria 3795
337 Ga0265327_10002824 3300031251 Bacteria 17539
338 Ga0265316_10054901 3300031344 Bacteria 3118
339 Ga0265316_10323492 3300031344 Bacteria 1120
340 Ga0265313_10037122 3300031595 Bacteria 2439
341 Ga0307508_10008446 3300031616 Bacteria 9512
342 Ga0265314_10002422 3300031711 Bacteria 19127
343 Ga0265314_10027306 3300031711 Bacteria 4275
344 Ga0265314_10089609 3300031711 Bacteria 2006
345 Ga0265314_10141342 3300031711 Bacteria 1488
346 Ga0265342_10000146 3300031712 Bacteria 80151
347 Ga0265342_10018437 3300031712 Bacteria 4520
348 Ga0265342_10029041 3300031712 Bacteria 3437
349 Ga0373929_0005888 3300035085 Bacteria 2214
350 Ga0373934_0014402 3300035086 Bacteria 2997
351 Ga0373944_0000531 3300035089 Bacteria 8954
352 Ga0373923_0001932 3300035111 Bacteria 6202
353 Ga0373923_0003219 3300035111 Bacteria 5193
354 Ga0373923_0022134 3300035111 Bacteria 2489
355 Ga0373923_0025778 3300035111 Bacteria 2333
356 Ga0373936_0002375 3300035113 Bacteria 7045
357 Ga0373936_0020223 3300035113 Bacteria 2585
358 Ga0373939_0008062 3300035114 Bacteria 2575
359 Ga0373939_0019796 3300035114 Bacteria 1820
360 Ga0373953_0001993 3300035117 Bacteria 6066
361 Ga0373953_0003861 3300035117 Bacteria 4717
362 Ga0373953_0013826 3300035117 Bacteria 2891
363 Ga0373954_0002159 3300035118 Bacteria 8162
364 Ga0373954_0002202 3300035118 Bacteria 8099
365 Ga0373954_0011383 3300035118 Bacteria 3941
366 Ga0373954_0028738 3300035118 Bacteria 2557
367 Ga0373954_0028821 3300035118 Bacteria 2554
368 Ga0373954_0140508 3300035118 Bacteria 1178
369 Ga0373956_0002079 3300035119 Bacteria 8298
370 Ga0373956_0017473 3300035119 Bacteria 3024
371 Ga0373957_0002485 3300035120 Bacteria 5276
372 Ga0373957_0014844 3300035120 Bacteria 2669
373 Ga0373957_0033197 3300035120 Bacteria 1906
374 Ga0373943_0000284 3300035170 Bacteria 21002
375 Ga0373943_0004873 3300035170 Bacteria 6067
376 Ga0373943_0024272 3300035170 Bacteria 2826
377 Ga0373946_0000993 3300035171 Bacteria 9723
378 Ga0373946_0001151 3300035171 Bacteria 9144
379 Ga0373946_0011943 3300035171 Bacteria 3246
380 Ga0373955_0000905 3300035172 Bacteria 12753
381 Ga0373955_0001496 3300035172 Bacteria 9955
382 Ga0373955_0017044 3300035172 Bacteria 3586
383 Ga0373955_0018376 3300035172 Bacteria 3476
384 Ga0373955_0020477 3300035172 Bacteria 3326
385 Ga0373955_0035179 3300035172 Bacteria 2651
386 Ga0373955_0088402 3300035172 Bacteria 1762
387 Ga0373955_0101172 3300035172 Bacteria 1655
388 Ga0373924_0000337 3300035410 Bacteria 14377
389 Ga0373924_0000883 3300035410 Bacteria 9450
390 Ga0373924_0013520 3300035410 Bacteria 3068
391 Ga0373924_0023187 3300035410 Bacteria 2432
392 Ga0373924_0040109 3300035410 Bacteria 1915
393 Ga0373931_0000221 3300035691 Bacteria 24293
394 Ga0373931_0082587 3300035691 Bacteria 1777
395 Ga0373935_0000151 3300035692 Bacteria 32024
396 Ga0373935_0003583 3300035692 Bacteria 9049
397 Ga0373935_0007237 3300035692 Bacteria 6630
398 Ga0373935_0022406 3300035692 Bacteria 3873
399 Ga0373935_0322698 3300035692 Bacteria 1096
400 Ga0373927_0001879 3300035695 Bacteria 15535
401 Ga0373927_0004424 3300035695 Bacteria 9842
402 Ga0373927_0047869 3300035695 Bacteria 2765
403 Ga0373927_0071590 3300035695 Bacteria 2244
404 Ga0373927_0292754 3300035695 Bacteria 1071
405 Ga0373933_0001536 3300035724 Bacteria 13495
406 Ga0373933_0008407 3300035724 Bacteria 5636
407 Ga0373947_0001986 3300035725 Bacteria 12521
408 Ga0373947_0002343 3300035725 Bacteria 11453
409 Ga0373947_0006664 3300035725 Bacteria 6701
410 Ga0373947_0010137 3300035725 Bacteria 5410
411 Ga0373947_0129549 3300035725 Bacteria 1609
412 Ga0373937_0000004 3300036401 Bacteria 212269
413 Ga0373937_0006604 3300036401 Bacteria 10017
414 Ga0373937_0012375 3300036401 Bacteria 7503
415 Ga0373937_0018911 3300036401 Bacteria 6159
416 Ga0373937_0020867 3300036401 Bacteria 5875
417 Ga0373937_0022555 3300036401 Bacteria 5662
418 Ga0373937_0044033 3300036401 Bacteria 4076
419 Ga0373937_0081300 3300036401 Bacteria 2997
420 Ga0373937_0112014 3300036401 Bacteria 2538
421 Ga0373937_0123875 3300036401 Bacteria 2410
422 Ga0373937_0148560 3300036401 Bacteria 2195
423 Ga0373937_0275243 3300036401 Bacteria 1589
424 Ga0373937_0284820 3300036401 Bacteria 1561
425 Ga0373925_0000095 3300037068 Bacteria 95071
426 Ga0373925_0001023 3300037068 Bacteria 25318
427 Ga0373925_0042842 3300037068 Bacteria 3358
428 Ga0373925_0067102 3300037068 Bacteria 2705
429 Ga0373925_0147317 3300037068 Bacteria 1846
430 Ga0373925_0260075 3300037068 Bacteria 1394
431 Ga0395899_0007698 3300037312 Bacteria 8305
432 Ga0395899_0028963 3300037312 Bacteria 4167
433 Ga0395899_0163810 3300037312 Bacteria 1569
434 Ga0395900_0002181 3300037418 Bacteria 21880
435 Ga0395900_0006855 3300037418 Bacteria 11819
436 Ga0395900_0009613 3300037418 Bacteria 9916
437 Ga0395900_0011548 3300037418 Bacteria 9037
438 Ga0395900_0027919 3300037418 Bacteria 5780
439 Ga0395900_0036133 3300037418 Bacteria 5091
440 Ga0395900_0090074 3300037418 Bacteria 3153
441 Ga0395900_0164021 3300037418 Bacteria 2265
442 Ga0395898_0003262 3300037466 Bacteria 18232
443 Ga0395898_0008544 3300037466 Bacteria 10818
444 Ga0395898_0021759 3300037466 Bacteria 6498
445 Ga0395898_0038553 3300037466 Bacteria 4735
446 Ga0395898_0685815 3300037466 Bacteria 966
447 Ga0395905_0062175 3300037471 Bacteria 3492
448 Ga0436364_0229137 3300037853 Bacteria 24094
449 Ga0436364_0329188 3300037853 Bacteria 16674
450 Ga0436364_0488870 3300037853 Bacteria 6192
451 Ga0436364_0491637 3300037853 Bacteria 1554
452 Ga0436364_0560002 3300037853 Bacteria 93566
453 Ga0436364_0787255 3300037853 Bacteria 5050
454 Ga0436364_1279747 3300037853 Bacteria 2071
455 Ga0436364_1329714 3300037853 Bacteria 45658
456 Ga0436364_1358002 3300037853 Bacteria 15093
457 Ga0395901_0004745 3300038443 Bacteria 13719
458 Ga0395901_0007299 3300038443 Bacteria 11154
459 Ga0395901_0013071 3300038443 Bacteria 8426
460 Ga0395901_0029585 3300038443 Bacteria 5640
461 Ga0395901_0031794 3300038443 Bacteria 5442
462 Ga0395901_0158295 3300038443 Bacteria 2379
463 Ga0395901_0576617 3300038443 Bacteria 1137
464 Ga0395901_0586606 3300038443 Bacteria 1125
465 Ga0436365_0190362 3300039437 Bacteria 40496
466 Ga0436365_0249117 3300039437 Bacteria 3194
467 Ga0436365_0260170 3300039437 Bacteria 52235
468 Ga0436365_0695125 3300039437 Bacteria 1700
469 Ga0436365_1165568 3300039437 Bacteria 4030
470 Ga0436365_1183719 3300039437 Bacteria 1586
471 Ga0436365_1291261 3300039437 Bacteria 2572
472 Ga0436365_1751993 3300039437 Bacteria 7810
473 Ga0436360_0265283 3300039438 Bacteria 2027
474 Ga0436360_0651368 3300039438 Bacteria 1434
475 Ga0436360_0676867 3300039438 Bacteria 2655
476 Ga0436360_1161538 3300039438 Bacteria 1446
477 Ga0436361_0400746 3300039447 Bacteria 2049
478 Ga0436361_0520146 3300039447 Bacteria 1203
479 Ga0436361_0522444 3300039447 Bacteria 5116
480 Ga0436361_0666081 3300039447 Bacteria 2357
481 Ga0436361_1113862 3300039447 Bacteria 3899
482 Ga0436363_0101257 3300039450 Bacteria 950
483 Ga0436363_0242104 3300039450 Bacteria 5179
484 Ga0436363_0621480 3300039450 Bacteria 4834
485 Ga0436363_0981994 3300039450 Bacteria 1199
486 Ga0436362_0204855 3300039453 Bacteria 17349
487 Ga0436362_0381210 3300039453 Bacteria 4420
488 Ga0436362_0799354 3300039453 Bacteria 965
489 Ga0436362_0849335 3300039453 Bacteria 1777
490 Ga0466963_0008212 3300044694 Bacteria 6256
491 Ga0466971_0018688 3300044719 Bacteria 3073
492 Ga0466957_0094565 3300044842 Bacteria 1877
493 Ga0466959_0033591 3300045049 Bacteria 3794
494 Ga0466958_0288292 3300045836 Bacteria 1053
495 Ga0466958_0355593 3300045836 Bacteria 943
496 Ga0466967_0038711 3300045976 Bacteria 4092
497 Ga0466967_0043726 3300045976 Bacteria 3880
498 Ga0495592_0000029 3300046454 Bacteria 131879
499 Ga0495592_0002830 3300046454 Bacteria 12307
500 Ga0495592_0036029 3300046454 Bacteria 3727
501 Ga0495592_0094362 3300046454 Bacteria 2141
502 Ga0495603_0000351 3300046455 Bacteria 24737
503 Ga0495603_0030176 3300046455 Bacteria 3267
504 Ga0495603_0140742 3300046455 Bacteria 1403
505 Ga0495629_0000114 3300046459 Bacteria 72778
506 Ga0495629_0000250 3300046459 Bacteria 46648
507 Ga0495629_0007749 3300046459 Bacteria 7901
508 Ga0495629_0008760 3300046459 Bacteria 7439
509 Ga0495629_0235439 3300046459 Bacteria 1261
510 Ga0495641_0014632 3300046461 Bacteria 4236
511 Ga0495641_0044042 3300046461 Bacteria 2061
512 Ga0495651_0001409 3300046462 Bacteria 18662
513 Ga0495651_0011379 3300046462 Bacteria 6836
514 Ga0495651_0013315 3300046462 Bacteria 6362
515 Ga0495651_0034944 3300046462 Bacteria 3916
516 Ga0495651_0132999 3300046462 Bacteria 1814
517 Ga0495653_0000012 3300046463 Bacteria 266880
518 Ga0495653_0014914 3300046463 Bacteria 6339
519 Ga0495653_0044307 3300046463 Bacteria 3453
520 Ga0495653_0046364 3300046463 Bacteria 3366
521 Ga0495653_0077552 3300046463 Bacteria 2467
522 Ga0495653_0231853 3300046463 Bacteria 1235
523 Ga0495580_0000536 3300046472 Bacteria 32045
524 Ga0495580_0007433 3300046472 Bacteria 8807
525 Ga0495580_0017120 3300046472 Bacteria 5427
526 Ga0495580_0034346 3300046472 Bacteria 3651
527 Ga0495580_0128352 3300046472 Bacteria 1760
528 Ga0495582_0000021 3300046473 Bacteria 88264
529 Ga0495582_0017363 3300046473 Bacteria 3938
530 Ga0495582_0124859 3300046473 Bacteria 1452
531 Ga0495582_0135615 3300046473 Bacteria 1393
532 Ga0495582_0155844 3300046473 Bacteria 1298
533 Ga0495582_0184182 3300046473 Bacteria 1190
534 Ga0495639_0000030 3300046475 Bacteria 65832
535 Ga0495639_0004330 3300046475 Bacteria 6089
536 Ga0495639_0006366 3300046475 Bacteria 5075
537 Ga0495639_0065199 3300046475 Bacteria 1675
538 Ga0495662_0000399 3300046476 Bacteria 19430
539 Ga0495662_0015082 3300046476 Bacteria 3755
540 Ga0495662_0015742 3300046476 Bacteria 3670
541 Ga0495664_0000004 3300046477 Bacteria 489411
542 Ga0495664_0014315 3300046477 Bacteria 4494
543 Ga0495664_0016703 3300046477 Bacteria 4186
544 Ga0495664_0027914 3300046477 Bacteria 3293
545 Ga0495594_0000153 3300046499 Bacteria 32752
546 Ga0495608_0000017 3300046511 Bacteria 192929
547 Ga0495608_0001813 3300046511 Bacteria 15258
548 Ga0495608_0015230 3300046511 Bacteria 5335
549 Ga0495608_0071822 3300046511 Bacteria 2258
550 Ga0495618_0000006 3300046514 Bacteria 229906
551 Ga0495618_0008025 3300046514 Bacteria 6392
552 Ga0495618_0010523 3300046514 Bacteria 5596
553 Ga0495618_0044730 3300046514 Bacteria 2792
554 Ga0495618_0052683 3300046514 Bacteria 2572
555 Ga0495618_0139890 3300046514 Bacteria 1549
556 Ga0495628_0000001 3300046516 Bacteria 917742
557 Ga0495628_0005957 3300046516 Bacteria 10669
558 Ga0495628_0039395 3300046516 Bacteria 3780
559 Ga0495628_0057268 3300046516 Bacteria 3066
560 Ga0495628_0072036 3300046516 Bacteria 2693
561 Ga0495628_0104120 3300046516 Bacteria 2188
562 Ga0495630_0000947 3300046517 Bacteria 20279
563 Ga0495630_0010492 3300046517 Bacteria 6692
564 Ga0495630_0010876 3300046517 Bacteria 6572
565 Ga0495630_0025912 3300046517 Bacteria 4339
566 Ga0495630_0093130 3300046517 Bacteria 2277
567 Ga0495666_0004324 3300046526 Bacteria 7172
568 Ga0495666_0011108 3300046526 Bacteria 4494
569 Ga0495666_0033401 3300046526 Bacteria 2513
570 Ga0495652_0000002 3300046529 Bacteria 946606
571 Ga0495652_0021969 3300046529 Bacteria 5670
572 Ga0495652_0059141 3300046529 Bacteria 3243
573 Ga0495652_0108045 3300046529 Bacteria 2243
574 Ga0495652_0121005 3300046529 Bacteria 2088
575 Ga0495652_0165827 3300046529 Bacteria 1710
576 Ga0495652_0170400 3300046529 Bacteria 1681
577 Ga0495665_0000932 3300046531 Bacteria 15431
578 Ga0495665_0002715 3300046531 Bacteria 9547
579 Ga0495640_0000001 3300046533 Bacteria 853827
580 Ga0495640_0002049 3300046533 Bacteria 16077
581 Ga0495640_0005128 3300046533 Bacteria 10411
582 Ga0495640_0024012 3300046533 Bacteria 4435
583 Ga0495640_0025921 3300046533 Bacteria 4245
584 Ga0495640_0193816 3300046533 Bacteria 1291
585 Ga0495640_0198621 3300046533 Bacteria 1272
586 Ga0495586_0148045 3300046535 Bacteria 1320
587 Ga0495587_0000008 3300046536 Bacteria 271097
588 Ga0495587_0026279 3300046536 Bacteria 3550
589 Ga0495587_0050833 3300046536 Bacteria 2452
590 Ga0495645_0000002 3300046543 Bacteria 651644
591 Ga0495645_0033979 3300046543 Bacteria 3720
592 Ga0495645_0037821 3300046543 Bacteria 3518
593 Ga0495645_0042361 3300046543 Bacteria 3319
594 Ga0495645_0043171 3300046543 Bacteria 3289
595 Ga0495645_0064325 3300046543 Bacteria 2654
596 Ga0495667_0000029 3300046559 Bacteria 151568
597 Ga0495667_0011318 3300046559 Bacteria 6039
598 Ga0495667_0017281 3300046559 Bacteria 4873
599 Ga0495667_0018573 3300046559 Bacteria 4695
600 Ga0495667_0086148 3300046559 Bacteria 2038
601 Ga0495667_0093541 3300046559 Bacteria 1946
602 Ga0495667_0193704 3300046559 Bacteria 1302
603 Ga0495634_0000082 3300046642 Bacteria 74301
604 Ga0495634_0001430 3300046642 Bacteria 21294
605 Ga0495634_0005270 3300046642 Bacteria 9987
606 Ga0495634_0010234 3300046642 Bacteria 6876
607 Ga0495634_0011129 3300046642 Bacteria 6562
608 Ga0495634_0013859 3300046642 Bacteria 5825
609 Ga0495634_0029017 3300046642 Bacteria 3834
610 Ga0495635_0000002 3300046663 Bacteria 490490
611 Ga0495635_0001998 3300046663 Bacteria 13860
612 Ga0495635_0005162 3300046663 Bacteria 9090
613 Ga0495635_0007995 3300046663 Bacteria 7391
614 Ga0495635_0019846 3300046663 Bacteria 4683
615 Ga0495635_0029696 3300046663 Bacteria 3802
616 Ga0495588_0000909 3300046674 Bacteria 12964
617 Ga0495588_0073670 3300046674 Bacteria 1778
618 Ga0495657_0000459 3300046675 Bacteria 38116
619 Ga0495657_0002559 3300046675 Bacteria 15255
620 Ga0495657_0026469 3300046675 Bacteria 4107
621 Ga0495657_0121297 3300046675 Bacteria 1646
622 Ga0495657_0126955 3300046675 Bacteria 1601
623 Ga0495599_0000104 3300046678 Bacteria 59442
624 Ga0495599_0000489 3300046678 Bacteria 22608
625 Ga0495599_0012063 3300046678 Bacteria 5318
626 Ga0495599_0032058 3300046678 Bacteria 3298
627 Ga0495599_0058365 3300046678 Bacteria 2414
628 Ga0495599_0138546 3300046678 Bacteria 1510
629 Ga0495623_0000691 3300046679 Bacteria 22400
630 Ga0495623_0014206 3300046679 Bacteria 5157
631 Ga0495623_0033849 3300046679 Bacteria 3278
632 Ga0495623_0080930 3300046679 Bacteria 2010
633 Ga0495623_0170233 3300046679 Bacteria 1273
634 Ga0495646_0000064 3300046680 Bacteria 50992
635 Ga0495646_0020683 3300046680 Bacteria 4164
636 Ga0495646_0044324 3300046680 Bacteria 2720
637 Ga0495646_0056609 3300046680 Bacteria 2350
638 Ga0495646_0193707 3300046680 Bacteria 1110
639 Ga0495647_0000795 3300046681 Bacteria 9413
640 Ga0495647_0033717 3300046681 Bacteria 1914
641 Ga0495658_0000400 3300046683 Bacteria 24322
642 Ga0495658_0016799 3300046683 Bacteria 3771
643 Ga0495613_0001829 3300046689 Bacteria 16164
644 Ga0495613_0005697 3300046689 Bacteria 9338
645 Ga0495613_0006515 3300046689 Bacteria 8724
646 Ga0495613_0044590 3300046689 Bacteria 3280
647 Ga0495613_0053163 3300046689 Bacteria 2981
648 Ga0495613_0346844 3300046689 Bacteria 1020
649 Ga0495624_0000736 3300046690 Bacteria 25747
650 Ga0495624_0004952 3300046690 Bacteria 9655
651 Ga0495624_0040306 3300046690 Bacteria 2991
652 Ga0495600_0000010 3300046809 Bacteria 143675
653 Ga0495600_0000883 3300046809 Bacteria 16030
654 Ga0495600_0040429 3300046809 Bacteria 3037
655 Ga0495600_0061453 3300046809 Bacteria 2454
656 Ga0495600_0068193 3300046809 Bacteria 2324
657 Ga0495600_0125121 3300046809 Bacteria 1672
658 Ga0495581_0000047 3300047315 Bacteria 45397
659 Ga0495581_0009913 3300047315 Bacteria 5512
660 Ga0495604_0000009 3300047317 Bacteria 326341
661 Ga0495604_0009813 3300047317 Bacteria 7573
662 Ga0495604_0025971 3300047317 Bacteria 4665
663 Ga0495604_0041003 3300047317 Bacteria 3632
664 Ga0495604_0069786 3300047317 Bacteria 2663
665 Ga0495674_0000002 3300047319 Bacteria 642785
666 Ga0495674_0000101 3300047319 Bacteria 62646
667 Ga0495674_0013127 3300047319 Bacteria 7790
668 Ga0495674_0056323 3300047319 Bacteria 3443
669 Ga0495674_0075005 3300047319 Bacteria 2911
670 Ga0495674_0133075 3300047319 Bacteria 2094
671 Ga0495676_0010355 3300047321 Bacteria 8457
672 Ga0495680_0000752 3300047322 Bacteria 36296
673 Ga0495680_0000944 3300047322 Bacteria 32310
674 Ga0495680_0032024 3300047322 Bacteria 4272
675 Ga0495680_0037213 3300047322 Bacteria 3899
676 Ga0495680_0043785 3300047322 Bacteria 3542
677 Ga0495675_0000517 3300047444 Bacteria 25028
678 Ga0495675_0010392 3300047444 Bacteria 5817
679 Ga0495675_0033606 3300047444 Bacteria 3273
680 Ga0495675_0273268 3300047444 Bacteria 1009
681 Ga0495684_0000006 3300047471 Bacteria 247568
682 Ga0495684_0000841 3300047471 Bacteria 24812
683 Ga0495684_0007035 3300047471 Bacteria 8740
684 Ga0495684_0028735 3300047471 Bacteria 4269
685 Ga0495593_0000483 3300047673 Bacteria 22411
686 Ga0495593_0003430 3300047673 Bacteria 9490
687 Ga0495593_0013064 3300047673 Bacteria 4741
688 Ga0495593_0034416 3300047673 Bacteria 2756
689 Ga0495593_0076280 3300047673 Bacteria 1737
690 Ga0495593_0083331 3300047673 Bacteria 1652
691 Ga0495593_0100680 3300047673 Bacteria 1482
692 Ga0495602_0000005 3300048088 Bacteria 325957
693 Ga0495602_0013081 3300048088 Bacteria 8486
694 Ga0495602_0054210 3300048088 Bacteria 3542
695 Ga0495602_0200878 3300048088 Bacteria 1521
696 Ga0496100_0094960 3300048903 Bacteria 2043
697 Ga0496100_0117948 3300048903 Bacteria 1853
698 Ga0496101_0026338 3300048904 Bacteria 4043
699 Ga0496101_0131617 3300048904 Bacteria 1900
700 Ga0496101_0327935 3300048904 Bacteria 1201
701 Ga0496102_0005663 3300048905 Bacteria 10606
702 Ga0496102_0024139 3300048905 Bacteria 5404
703 Ga0496102_0041542 3300048905 Bacteria 4164
704 Ga0496102_0042326 3300048905 Bacteria 4127
705 Ga0496102_0063150 3300048905 Bacteria 3391
706 Ga0496103_0058010 3300048906 Bacteria 2405
707 Ga0496104_0000948 3300048907 Bacteria 24943
708 Ga0496104_0006356 3300048907 Bacteria 10393
709 Ga0496104_0009285 3300048907 Bacteria 8746
710 Ga0496104_0014451 3300048907 Bacteria 7131
711 Ga0496104_0038722 3300048907 Bacteria 4462
712 Ga0496104_0068699 3300048907 Bacteria 3367
713 Ga0496104_0089315 3300048907 Bacteria 2944
714 Ga0496105_0007104 3300048908 Bacteria 8637
715 Ga0496105_0014038 3300048908 Bacteria 6373
716 Ga0496105_0033884 3300048908 Bacteria 4197
717 Ga0496106_0014200 3300048909 Bacteria 5881
718 Ga0496106_0062041 3300048909 Bacteria 2838
719 Ga0496106_0087261 3300048909 Bacteria 2404
720 Ga0496106_0225607 3300048909 Bacteria 1495
721 Ga0496106_0284735 3300048909 Bacteria 1324
722 Ga0496107_0032136 3300048910 Bacteria 3750
723 Ga0496107_0080409 3300048910 Bacteria 2377
724 Ga0496108_0000479 3300048911 Bacteria 32030
725 Ga0496108_0001334 3300048911 Bacteria 19392
726 Ga0496108_0012829 3300048911 Bacteria 6823
727 Ga0496108_0024393 3300048911 Bacteria 4979
728 Ga0496108_0099668 3300048911 Bacteria 2477
729 Ga0496109_0000469 3300048912 Bacteria 34339
730 Ga0496109_0006681 3300048912 Bacteria 9711
731 Ga0496109_0009376 3300048912 Bacteria 8339
732 Ga0496109_0018409 3300048912 Bacteria 6136
733 Ga0496109_0020910 3300048912 Bacteria 5784
734 Ga0496109_0073852 3300048912 Bacteria 3134
735 Ga0496110_0001819 3300048913 Bacteria 15723
736 Ga0496110_0011940 3300048913 Bacteria 7135
737 Ga0496110_0050354 3300048913 Bacteria 3657
738 Ga0496110_0620561 3300048913 Bacteria 980
739 Ga0496111_0000112 3300048914 Bacteria 35886
740 Ga0496111_0021445 3300048914 Bacteria 4511
741 Ga0496111_0040428 3300048914 Bacteria 3345
742 Ga0496111_0074297 3300048914 Bacteria 2476
743 Ga0496112_0000979 3300048915 Bacteria 20836
744 Ga0496112_0005973 3300048915 Bacteria 10623
745 Ga0496112_0036769 3300048915 Bacteria 4777
746 Ga0496112_0044005 3300048915 Bacteria 4372
747 Ga0496112_0050774 3300048915 Bacteria 4067
748 Ga0496112_0060945 3300048915 Bacteria 3718
749 Ga0496112_0536080 3300048915 Bacteria 1105
750 Ga0496113_0010030 3300048916 Bacteria 6247
751 Ga0496113_0015988 3300048916 Bacteria 5175
752 Ga0496113_0033714 3300048916 Bacteria 3731
753 Ga0496113_0033748 3300048916 Bacteria 3729
754 Ga0496113_0036503 3300048916 Bacteria 3602
755 Ga0496113_0072730 3300048916 Bacteria 2617
756 Ga0496115_0037865 3300048918 Bacteria 3824
757 Ga0496115_0080961 3300048918 Bacteria 2644
758 Ga0496115_0170174 3300048918 Bacteria 1802
759 Ga0496115_0215224 3300048918 Bacteria 1586
760 Ga0496121_0008649 3300048924 Bacteria 11906
761 Ga0496126_0009299 3300048929 Bacteria 10467
762 Ga0496126_0032055 3300048929 Bacteria 4956
763 Ga0496126_0087662 3300048929 Bacteria 2743
764 Ga0496126_0115195 3300048929 Bacteria 2338
765 Ga0496126_0123675 3300048929 Bacteria 2241
766 Ga0496126_0281038 3300048929 Bacteria 1379
767 Ga0501038_0146473 3300049574 Bacteria 1928
768 nmdc:mga0n895_12310_c1 3300050512 Bacteria 7669
769 nmdc:mga0n895_31651_c1 3300050512 Bacteria 5068
770 nmdc:mga0rr50_19152_c1 3300050513 Bacteria 4613
771 nmdc:mga0rr50_258829_c1 3300050513 Bacteria 1447
772 nmdc:mga0rr50_9008_c1 3300050513 Bacteria 6244
773 nmdc:mga08x19_240455_c1 3300050514 Bacteria 1248
774 nmdc:mga08x19_24_c1 3300050514 Bacteria 245940
775 nmdc:mga08x19_4788_c1 3300050514 Bacteria 8022
776 Ga0495601_0000002 3300053077 Bacteria 528704
777 Ga0495601_0003938 3300053077 Bacteria 8547
778 Ga0495601_0014584 3300053077 Bacteria 4736
779 Ga0495601_0019493 3300053077 Bacteria 4137
780 Ga0495601_0019874 3300053077 Bacteria 4099
781 Ga0495601_0020996 3300053077 Bacteria 3993
782 Ga0495601_0051588 3300053077 Bacteria 2596
783 Ga0495601_0197037 3300053077 Bacteria 1317
784 Ga0495612_0000010 3300053078 Bacteria 227618
785 Ga0495612_0013146 3300053078 Bacteria 3333
786 Ga0495612_0024650 3300053078 Bacteria 2415
787 Ga0495612_0028435 3300053078 Bacteria 2251
788 Ga0495612_0048112 3300053078 Bacteria 1748
789 Ga0495612_0097979 3300053078 Bacteria 1246
790 Ga0495612_0163553 3300053078 Bacteria 972
791 Ga0500635_0002728 3300053080 Bacteria 4382
792 Ga0495595_0001077 3300053084 Bacteria 10556
793 Ga0495595_0002209 3300053084 Bacteria 7564
794 Ga0495595_0003156 3300053084 Bacteria 6537
795 Ga0495595_0015693 3300053084 Bacteria 3232
796 Ga0495595_0050818 3300053084 Bacteria 1921
797 Ga0495595_0124433 3300053084 Bacteria 1257
798 Ga0495619_0000019 3300053085 Bacteria 209518
799 Ga0495619_0001975 3300053085 Bacteria 13675
800 Ga0495619_0004698 3300053085 Bacteria 8703
801 Ga0495619_0005347 3300053085 Bacteria 8128
802 Ga0495619_0005973 3300053085 Bacteria 7709
803 Ga0495619_0010245 3300053085 Bacteria 5902
804 Ga0495619_0017762 3300053085 Bacteria 4507
805 Ga0495619_0021717 3300053085 Bacteria 4101
806 Ga0495619_0076522 3300053085 Bacteria 2247
807 Ga0495619_0094576 3300053085 Bacteria 2027
808 Ga0495619_0101361 3300053085 Bacteria 1960
809 Ga0500554_004224 3300053102 Bacteria 3024
810 Ga0500603_000117 3300053150 Bacteria 18585
811 Ga0500637_0005039 3300053178 Bacteria 6357

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046689 Ga0495613_0346844 Ga0495613_0346844_15_830 254
2 3300045836 Ga0466958_0355593 Ga0466958_0355593_115_933 257
3 3300046461 Ga0495641_0044042 Ga0495641_0044042_1195_2031 258
4 3300053078 Ga0495612_0163553 Ga0495612_0163553_108_947 259
5 3300037068 Ga0373925_0147317 Ga0373925_0147317_30_911 271
6 3300037466 Ga0395898_0685815 Ga0395898_0685815_12_890 273
7 3300046516 Ga0495628_0104120 Ga0495628_0104120_34_915 273
8 3300047673 Ga0495593_0083331 Ga0495593_0083331_34_915 273
9 3300047673 Ga0495593_0100680 Ga0495593_0100680_19_897 274
10 3300048913 Ga0496110_0620561 Ga0496110_0620561_75_953 274
11 3300053084 Ga0495595_0050818 Ga0495595_0050818_60_944 274
12 3300035086 Ga0373934_0014402 Ga0373934_0014402_2098_2976 275
13 3300035114 Ga0373939_0019796 Ga0373939_0019796_21_899 275
14 3300035118 Ga0373954_0140508 Ga0373954_0140508_143_1072 275
15 3300039450 Ga0436363_0101257 Ga0436363_0101257_33_911 275
16 3300047444 Ga0495675_0273268 Ga0495675_0273268_39_920 275
17 3300053078 Ga0495612_0013146 Ga0495612_0013146_21_899 275
18 3300045836 Ga0466958_0288292 Ga0466958_0288292_18_896 276
19 3300039453 Ga0436362_0799354 Ga0436362_0799354_56_937 277
20 3300036401 Ga0373937_0123875 Ga0373937_0123875_856_1815 278
21 3300005563 Ga0068855_100107338 Ga0068855_1001073383 283
22 3300025949 Ga0207667_10257280 Ga0207667_102572802 283
23 3300026067 Ga0207678_10011125 Ga0207678_100111254 283
24 3300035410 Ga0373924_0000883 Ga0373924_0000883_8269_9228 285
25 3300046543 Ga0495645_0043171 Ga0495645_0043171_490_1407 285
26 3300039438 Ga0436360_0676867 Ga0436360_0676867_783_1703 287
27 3300048915 Ga0496112_0536080 Ga0496112_0536080_126_1079 288
28 3300005458 Ga0070681_10104231 Ga0070681_101042312 290
29 3300025916 Ga0207663_10286588 Ga0207663_102865882 290
30 3300025939 Ga0207665_10324947 Ga0207665_103249471 290
31 3300046472 Ga0495580_0128352 Ga0495580_0128352_399_1340 290
32 3300005436 Ga0070713_100162467 Ga0070713_1001624672 291
33 3300006175 Ga0070712_100017096 Ga0070712_1000170962 291
34 3300025915 Ga0207693_10007700 Ga0207693_100077007 291
35 3300035692 Ga0373935_0322698 Ga0373935_0322698_126_1052 291
36 3300036401 Ga0373937_0012375 Ga0373937_0012375_5214_6140 291
37 3300037418 Ga0395900_0006855 Ga0395900_0006855_382_1362 291
38 3300037466 Ga0395898_0003262 Ga0395898_0003262_6414_7394 291
39 3300037471 Ga0395905_0062175 Ga0395905_0062175_1845_2825 291
40 3300037853 Ga0436364_0491637 Ga0436364_0491637_43_975 291
41 3300038443 Ga0395901_0029585 Ga0395901_0029585_3421_4401 291
42 3300039437 Ga0436365_1751993 Ga0436365_1751993_2227_3177 291
43 3300039438 Ga0436360_0265283 Ga0436360_0265283_729_1712 291
44 3300046543 Ga0495645_0042361 Ga0495645_0042361_14_943 291
45 3300046543 Ga0495645_0064325 Ga0495645_0064325_338_1273 291
46 3300046559 Ga0495667_0193704 Ga0495667_0193704_339_1265 291
47 3300005458 Ga0070681_10011984 Ga0070681_100119848 292
48 3300013104 Ga0157370_10013304 Ga0157370_100133044 292
49 3300025917 Ga0207660_10066105 Ga0207660_100661053 292
50 3300039447 Ga0436361_0666081 Ga0436361_0666081_1015_1962 292
51 3300014968 Ga0157379_10270221 Ga0157379_102702212 293
52 3300048907 Ga0496104_0089315 Ga0496104_0089315_640_1569 293
53 3300048909 Ga0496106_0014200 Ga0496106_0014200_1846_2775 293
54 3300048911 Ga0496108_0001334 Ga0496108_0001334_2744_3673 293
55 3300048912 Ga0496109_0000469 Ga0496109_0000469_6185_7114 293
56 3300048916 Ga0496113_0033748 Ga0496113_0033748_283_1212 293
57 3300028573 Ga0265334_10065421 Ga0265334_100654212 294
58 3300035111 Ga0373923_0003219 Ga0373923_0003219_1938_2891 294
59 3300035117 Ga0373953_0003861 Ga0373953_0003861_3305_4258 294
60 3300035118 Ga0373954_0002159 Ga0373954_0002159_2419_3372 294
61 3300035119 Ga0373956_0002079 Ga0373956_0002079_6131_7084 294
62 3300035172 Ga0373955_0000905 Ga0373955_0000905_3303_4256 294
63 3300035410 Ga0373924_0013520 Ga0373924_0013520_501_1454 294
64 3300035724 Ga0373933_0008407 Ga0373933_0008407_2982_3935 294
65 3300036401 Ga0373937_0020867 Ga0373937_0020867_2235_3188 294
66 3300037312 Ga0395899_0163810 Ga0395899_0163810_77_1024 294
67 3300037418 Ga0395900_0036133 Ga0395900_0036133_570_1517 294
68 3300038443 Ga0395901_0586606 Ga0395901_0586606_32_979 294
69 3300039447 Ga0436361_1113862 Ga0436361_1113862_1784_2800 294
70 3300039453 Ga0436362_0381210 Ga0436362_0381210_1460_2476 294
71 3300046454 Ga0495592_0002830 Ga0495592_0002830_7708_8661 294
72 3300046459 Ga0495629_0000114 Ga0495629_0000114_12343_13296 294
73 3300046462 Ga0495651_0013315 Ga0495651_0013315_3303_4256 294
74 3300046511 Ga0495608_0001813 Ga0495608_0001813_5051_6004 294
75 3300046516 Ga0495628_0005957 Ga0495628_0005957_1681_2634 294
76 3300046529 Ga0495652_0021969 Ga0495652_0021969_1191_2144 294
77 3300046529 Ga0495652_0165827 Ga0495652_0165827_506_1459 294
78 3300046533 Ga0495640_0024012 Ga0495640_0024012_2707_3660 294
79 3300046543 Ga0495645_0037821 Ga0495645_0037821_447_1400 294
80 3300046559 Ga0495667_0011318 Ga0495667_0011318_2356_3309 294
81 3300046642 Ga0495634_0010234 Ga0495634_0010234_3342_4295 294
82 3300046663 Ga0495635_0007995 Ga0495635_0007995_3817_4770 294
83 3300046675 Ga0495657_0002559 Ga0495657_0002559_12370_13323 294
84 3300046678 Ga0495599_0000489 Ga0495599_0000489_14537_15490 294
85 3300046680 Ga0495646_0056609 Ga0495646_0056609_51_1004 294
86 3300046689 Ga0495613_0044590 Ga0495613_0044590_2290_3243 294
87 3300046809 Ga0495600_0000883 Ga0495600_0000883_12370_13323 294
88 3300047317 Ga0495604_0009813 Ga0495604_0009813_4688_5641 294
89 3300047319 Ga0495674_0075005 Ga0495674_0075005_1869_2822 294
90 3300047319 Ga0495674_0133075 Ga0495674_0133075_1018_1977 294
91 3300047322 Ga0495680_0000944 Ga0495680_0000944_14270_15223 294
92 3300047471 Ga0495684_0000841 Ga0495684_0000841_6735_7688 294
93 3300047673 Ga0495593_0003430 Ga0495593_0003430_1342_2295 294
94 3300048088 Ga0495602_0013081 Ga0495602_0013081_2666_3619 294
95 3300048918 Ga0496115_0215224 Ga0496115_0215224_451_1404 294
96 3300053077 Ga0495601_0019874 Ga0495601_0019874_3082_4035 294
97 3300053084 Ga0495595_0015693 Ga0495595_0015693_2234_3187 294
98 3300053085 Ga0495619_0001975 Ga0495619_0001975_6327_7280 294
99 3300005336 Ga0070680_100038587 Ga0070680_1000385872 295
100 3300005435 Ga0070714_100070223 Ga0070714_1000702232 295
101 3300005436 Ga0070713_100400126 Ga0070713_1004001261 295
102 3300005458 Ga0070681_10168535 Ga0070681_101685351 295
103 3300005467 Ga0070706_100222207 Ga0070706_1002222072 295
104 3300005530 Ga0070679_100031365 Ga0070679_1000313655 295
105 3300005535 Ga0070684_100076578 Ga0070684_1000765782 295
106 3300005536 Ga0070697_100093960 Ga0070697_1000939602 295
107 3300005539 Ga0068853_100078646 Ga0068853_1000786462 295
108 3300005547 Ga0070693_100033785 Ga0070693_1000337852 295
109 3300005564 Ga0070664_100453319 Ga0070664_1004533192 295
110 3300006173 Ga0070716_100107027 Ga0070716_1001070272 295
111 3300006175 Ga0070712_100021427 Ga0070712_1000214274 295
112 3300006914 Ga0075436_100049211 Ga0075436_1000492112 295
113 3300009174 Ga0105241_10053973 Ga0105241_100539733 295
114 3300009551 Ga0105238_10071809 Ga0105238_100718093 295
115 3300013105 Ga0157369_10020808 Ga0157369_100208086 295
116 3300013307 Ga0157372_10176623 Ga0157372_101766232 295
117 3300021384 Ga0213876_10072442 Ga0213876_100724422 295
118 3300025898 Ga0207692_10033935 Ga0207692_100339353 295
119 3300025910 Ga0207684_10341995 Ga0207684_103419951 295
120 3300025915 Ga0207693_10004667 Ga0207693_100046676 295
121 3300025924 Ga0207694_10034292 Ga0207694_100342923 295
122 3300025924 Ga0207694_10114885 Ga0207694_101148853 295
123 3300026041 Ga0207639_10066332 Ga0207639_100663322 295
124 3300026078 Ga0207702_10527407 Ga0207702_105274072 295
125 3300026142 Ga0207698_10062472 Ga0207698_100624722 295
126 3300031344 Ga0265316_10054901 Ga0265316_100549014 295
127 3300036401 Ga0373937_0148560 Ga0373937_0148560_870_1820 295
128 3300048929 Ga0496126_0281038 Ga0496126_0281038_247_1197 295
129 3300005336 Ga0070680_100095507 Ga0070680_1000955073 296
130 3300005336 Ga0070680_100321717 Ga0070680_1003217171 296
131 3300005435 Ga0070714_100271799 Ga0070714_1002717992 296
132 3300005436 Ga0070713_100263103 Ga0070713_1002631032 296
133 3300005536 Ga0070697_100024702 Ga0070697_1000247023 296
134 3300006914 Ga0075436_100016744 Ga0075436_1000167442 296
135 3300009093 Ga0105240_10268135 Ga0105240_102681352 296
136 3300009551 Ga0105238_10003206 Ga0105238_1000320611 296
137 3300013307 Ga0157372_10352028 Ga0157372_103520282 296
138 3300025913 Ga0207695_10199900 Ga0207695_101999002 296
139 3300025917 Ga0207660_10091367 Ga0207660_100913672 296
140 3300025921 Ga0207652_10114506 Ga0207652_101145062 296
141 3300025924 Ga0207694_10021667 Ga0207694_100216675 296
142 3300035695 Ga0373927_0292754 Ga0373927_0292754_67_1023 296
143 3300035725 Ga0373947_0129549 Ga0373947_0129549_583_1539 296
144 3300036401 Ga0373937_0022555 Ga0373937_0022555_2678_3634 296
145 3300037068 Ga0373925_0260075 Ga0373925_0260075_78_1034 296
146 3300037418 Ga0395900_0164021 Ga0395900_0164021_167_1129 296
147 3300038443 Ga0395901_0158295 Ga0395901_0158295_26_976 296
148 3300039447 Ga0436361_0400746 Ga0436361_0400746_444_1397 296
149 3300046455 Ga0495603_0030176 Ga0495603_0030176_1490_2446 296
150 3300046463 Ga0495653_0044307 Ga0495653_0044307_1672_2628 296
151 3300046472 Ga0495580_0007433 Ga0495580_0007433_6987_7940 296
152 3300046473 Ga0495582_0184182 Ga0495582_0184182_219_1175 296
153 3300046475 Ga0495639_0004330 Ga0495639_0004330_3649_4605 296
154 3300046476 Ga0495662_0015082 Ga0495662_0015082_1727_2683 296
155 3300046514 Ga0495618_0052683 Ga0495618_0052683_803_1759 296
156 3300046517 Ga0495630_0010492 Ga0495630_0010492_4072_5028 296
157 3300046526 Ga0495666_0011108 Ga0495666_0011108_821_1777 296
158 3300046529 Ga0495652_0121005 Ga0495652_0121005_346_1302 296
159 3300046533 Ga0495640_0005128 Ga0495640_0005128_7817_8773 296
160 3300046642 Ga0495634_0011129 Ga0495634_0011129_4688_5644 296
161 3300046642 Ga0495634_0029017 Ga0495634_0029017_1596_2552 296
162 3300046663 Ga0495635_0019846 Ga0495635_0019846_1672_2628 296
163 3300046674 Ga0495588_0073670 Ga0495588_0073670_220_1176 296
164 3300046680 Ga0495646_0193707 Ga0495646_0193707_67_1023 296
165 3300046683 Ga0495658_0016799 Ga0495658_0016799_704_1660 296
166 3300046690 Ga0495624_0040306 Ga0495624_0040306_617_1573 296
167 3300047317 Ga0495604_0025971 Ga0495604_0025971_1150_2106 296
168 3300047319 Ga0495674_0056323 Ga0495674_0056323_1658_2614 296
169 3300047322 Ga0495680_0032024 Ga0495680_0032024_1138_2094 296
170 3300047471 Ga0495684_0007035 Ga0495684_0007035_1661_2617 296
171 3300048914 Ga0496111_0074297 Ga0496111_0074297_272_1222 296
172 3300050514 nmdc:mga08x19_4788_c1 nmdc:mga08x19_4788_c1_5137_6090 296
173 3300053077 Ga0495601_0014584 Ga0495601_0014584_1134_2090 296
174 3300053085 Ga0495619_0010245 Ga0495619_0010245_2242_3198 296
175 3300005327 Ga0070658_10016692 Ga0070658_100166924 297
176 3300005329 Ga0070683_100095544 Ga0070683_1000955443 297
177 3300005334 Ga0068869_100141338 Ga0068869_1001413381 297
178 3300005336 Ga0070680_100007540 Ga0070680_1000075407 297
179 3300005336 Ga0070680_100010316 Ga0070680_1000103166 297
180 3300005336 Ga0070680_100099517 Ga0070680_1000995172 297
181 3300005339 Ga0070660_100034632 Ga0070660_1000346323 297
182 3300005339 Ga0070660_100047315 Ga0070660_1000473153 297
183 3300005339 Ga0070660_100083968 Ga0070660_1000839683 297
184 3300005344 Ga0070661_100004970 Ga0070661_1000049707 297
185 3300005345 Ga0070692_10004009 Ga0070692_100040092 297
186 3300005366 Ga0070659_100017494 Ga0070659_1000174943 297
187 3300005366 Ga0070659_100106441 Ga0070659_1001064412 297
188 3300005434 Ga0070709_10047420 Ga0070709_100474202 297
189 3300005435 Ga0070714_100002138 Ga0070714_10000213812 297
190 3300005436 Ga0070713_100009299 Ga0070713_1000092996 297
191 3300005437 Ga0070710_10014721 Ga0070710_100147215 297
192 3300005439 Ga0070711_100045350 Ga0070711_1000453503 297
193 3300005440 Ga0070705_100003606 Ga0070705_1000036063 297
194 3300005444 Ga0070694_100033461 Ga0070694_1000334613 297
195 3300005445 Ga0070708_100161092 Ga0070708_1001610922 297
196 3300005458 Ga0070681_10028904 Ga0070681_100289044 297
197 3300005458 Ga0070681_10092187 Ga0070681_100921872 297
198 3300005458 Ga0070681_10199476 Ga0070681_101994762 297
199 3300005468 Ga0070707_100068680 Ga0070707_1000686805 297
200 3300005471 Ga0070698_100139696 Ga0070698_1001396962 297
201 3300005518 Ga0070699_100013662 Ga0070699_1000136623 297
202 3300005518 Ga0070699_100016626 Ga0070699_1000166262 297
203 3300005530 Ga0070679_100030659 Ga0070679_1000306593 297
204 3300005530 Ga0070679_100086992 Ga0070679_1000869922 297
205 3300005536 Ga0070697_100051116 Ga0070697_1000511164 297
206 3300005539 Ga0068853_100006310 Ga0068853_1000063103 297
207 3300005539 Ga0068853_100054551 Ga0068853_1000545513 297
208 3300005545 Ga0070695_100018760 Ga0070695_1000187604 297
209 3300005546 Ga0070696_100069654 Ga0070696_1000696543 297
210 3300005547 Ga0070693_100010668 Ga0070693_1000106683 297
211 3300005549 Ga0070704_100030514 Ga0070704_1000305143 297
212 3300005563 Ga0068855_100017840 Ga0068855_1000178406 297
213 3300005563 Ga0068855_100021639 Ga0068855_1000216394 297
214 3300005563 Ga0068855_100749509 Ga0068855_1007495091 297
215 3300005564 Ga0070664_100026248 Ga0070664_1000262485 297
216 3300005577 Ga0068857_100055709 Ga0068857_1000557094 297
217 3300005578 Ga0068854_100009175 Ga0068854_1000091753 297
218 3300005578 Ga0068854_100125656 Ga0068854_1001256562 297
219 3300005614 Ga0068856_100017680 Ga0068856_1000176803 297
220 3300005614 Ga0068856_100028035 Ga0068856_1000280354 297
221 3300005616 Ga0068852_100224561 Ga0068852_1002245612 297
222 3300005616 Ga0068852_100249846 Ga0068852_1002498462 297
223 3300005834 Ga0068851_10021741 Ga0068851_100217413 297
224 3300006175 Ga0070712_100000052 Ga0070712_10000005250 297
225 3300006175 Ga0070712_100032063 Ga0070712_1000320632 297
226 3300006871 Ga0075434_100014102 Ga0075434_1000141027 297
227 3300006914 Ga0075436_100038128 Ga0075436_1000381283 297
228 3300006914 Ga0075436_100151508 Ga0075436_1001515082 297
229 3300007076 Ga0075435_100012722 Ga0075435_1000127224 297
230 3300009093 Ga0105240_10026154 Ga0105240_100261547 297
231 3300009093 Ga0105240_10107237 Ga0105240_101072373 297
232 3300009098 Ga0105245_10043724 Ga0105245_100437244 297
233 3300009545 Ga0105237_10028324 Ga0105237_100283243 297
234 3300009551 Ga0105238_10042262 Ga0105238_100422623 297
235 3300009551 Ga0105238_10108711 Ga0105238_101087113 297
236 3300010375 Ga0105239_10070408 Ga0105239_100704084 297
237 3300011119 Ga0105246_10010340 Ga0105246_100103402 297
238 3300011119 Ga0105246_10181670 Ga0105246_101816702 297
239 3300013100 Ga0157373_10047557 Ga0157373_100475572 297
240 3300013102 Ga0157371_10032724 Ga0157371_100327244 297
241 3300013104 Ga0157370_10004982 Ga0157370_100049829 297
242 3300013104 Ga0157370_10018409 Ga0157370_100184094 297
243 3300013105 Ga0157369_10100691 Ga0157369_101006912 297
244 3300013105 Ga0157369_10165724 Ga0157369_101657243 297
245 3300013296 Ga0157374_10015897 Ga0157374_100158973 297
246 3300013306 Ga0163162_10323210 Ga0163162_103232102 297
247 3300013307 Ga0157372_10167721 Ga0157372_101677212 297
248 3300014325 Ga0163163_10006821 Ga0163163_100068216 297
249 3300014745 Ga0157377_10104914 Ga0157377_101049142 297
250 3300021384 Ga0213876_10085795 Ga0213876_100857952 297
251 3300021388 Ga0213875_10110401 Ga0213875_101104012 297
252 3300025911 Ga0207654_10004049 Ga0207654_100040497 297
253 3300025912 Ga0207707_10009475 Ga0207707_100094757 297
254 3300025912 Ga0207707_10072597 Ga0207707_100725973 297
255 3300025913 Ga0207695_10031367 Ga0207695_100313673 297
256 3300025914 Ga0207671_10017472 Ga0207671_100174722 297
257 3300025915 Ga0207693_10000915 Ga0207693_1000091514 297
258 3300025915 Ga0207693_10015221 Ga0207693_100152214 297
259 3300025917 Ga0207660_10006764 Ga0207660_100067643 297
260 3300025917 Ga0207660_10154327 Ga0207660_101543272 297
261 3300025919 Ga0207657_10005116 Ga0207657_1000511610 297
262 3300025919 Ga0207657_10033396 Ga0207657_100333964 297
263 3300025919 Ga0207657_10086551 Ga0207657_100865512 297
264 3300025921 Ga0207652_10005325 Ga0207652_100053258 297
265 3300025924 Ga0207694_10066194 Ga0207694_100661943 297
266 3300025927 Ga0207687_10052797 Ga0207687_100527973 297
267 3300025928 Ga0207700_10002466 Ga0207700_100024667 297
268 3300025928 Ga0207700_10004080 Ga0207700_100040803 297
269 3300025929 Ga0207664_10010006 Ga0207664_100100065 297
270 3300025929 Ga0207664_10057611 Ga0207664_100576112 297
271 3300025932 Ga0207690_10222899 Ga0207690_102228992 297
272 3300025936 Ga0207670_10395535 Ga0207670_103955352 297
273 3300025939 Ga0207665_10010681 Ga0207665_100106813 297
274 3300025942 Ga0207689_10022758 Ga0207689_100227582 297
275 3300025945 Ga0207679_10069056 Ga0207679_100690563 297
276 3300025949 Ga0207667_10037490 Ga0207667_100374903 297
277 3300025949 Ga0207667_10042794 Ga0207667_100427943 297
278 3300025949 Ga0207667_10137207 Ga0207667_101372072 297
279 3300026041 Ga0207639_10206147 Ga0207639_102061472 297
280 3300026078 Ga0207702_10142522 Ga0207702_101425222 297
281 3300026078 Ga0207702_10166117 Ga0207702_101661171 297
282 3300026116 Ga0207674_10028168 Ga0207674_100281684 297
283 3300026142 Ga0207698_10117825 Ga0207698_101178253 297
284 3300028800 Ga0265338_10026507 Ga0265338_100265075 297
285 3300031344 Ga0265316_10323492 Ga0265316_103234922 297
286 3300031595 Ga0265313_10037122 Ga0265313_100371223 297
287 3300031711 Ga0265314_10002422 Ga0265314_100024224 297
288 3300031711 Ga0265314_10141342 Ga0265314_101413422 297
289 3300035111 Ga0373923_0025778 Ga0373923_0025778_649_1602 297
290 3300035113 Ga0373936_0020223 Ga0373936_0020223_1577_2530 297
291 3300035118 Ga0373954_0002202 Ga0373954_0002202_1333_2286 297
292 3300035119 Ga0373956_0017473 Ga0373956_0017473_293_1246 297
293 3300035120 Ga0373957_0002485 Ga0373957_0002485_1378_2331 297
294 3300035120 Ga0373957_0033197 Ga0373957_0033197_389_1342 297
295 3300035172 Ga0373955_0017044 Ga0373955_0017044_1367_2320 297
296 3300035172 Ga0373955_0088402 Ga0373955_0088402_527_1480 297
297 3300035410 Ga0373924_0040109 Ga0373924_0040109_393_1346 297
298 3300036401 Ga0373937_0081300 Ga0373937_0081300_1040_1993 297
299 3300036401 Ga0373937_0275243 Ga0373937_0275243_382_1350 297
300 3300037853 Ga0436364_1279747 Ga0436364_1279747_829_1785 297
301 3300039437 Ga0436365_0249117 Ga0436365_0249117_1689_2633 297
302 3300039437 Ga0436365_0695125 Ga0436365_0695125_525_1469 297
303 3300039437 Ga0436365_1291261 Ga0436365_1291261_931_1887 297
304 3300045976 Ga0466967_0038711 Ga0466967_0038711_1260_2213 297
305 3300046459 Ga0495629_0235439 Ga0495629_0235439_184_1137 297
306 3300046462 Ga0495651_0011379 Ga0495651_0011379_1347_2300 297
307 3300046463 Ga0495653_0014914 Ga0495653_0014914_4228_5181 297
308 3300046473 Ga0495582_0135615 Ga0495582_0135615_323_1279 297
309 3300046475 Ga0495639_0065199 Ga0495639_0065199_10_966 297
310 3300046511 Ga0495608_0015230 Ga0495608_0015230_670_1623 297
311 3300046514 Ga0495618_0010523 Ga0495618_0010523_4005_4958 297
312 3300046516 Ga0495628_0039395 Ga0495628_0039395_499_1452 297
313 3300046517 Ga0495630_0025912 Ga0495630_0025912_529_1482 297
314 3300046529 Ga0495652_0059141 Ga0495652_0059141_658_1611 297
315 3300046536 Ga0495587_0026279 Ga0495587_0026279_2305_3258 297
316 3300046559 Ga0495667_0093541 Ga0495667_0093541_701_1654 297
317 3300046663 Ga0495635_0029696 Ga0495635_0029696_2359_3312 297
318 3300046675 Ga0495657_0126955 Ga0495657_0126955_112_1065 297
319 3300046678 Ga0495599_0032058 Ga0495599_0032058_825_1778 297
320 3300046679 Ga0495623_0014206 Ga0495623_0014206_1330_2283 297
321 3300046809 Ga0495600_0068193 Ga0495600_0068193_43_996 297
322 3300047319 Ga0495674_0013127 Ga0495674_0013127_3115_4068 297
323 3300047444 Ga0495675_0010392 Ga0495675_0010392_1724_2677 297
324 3300048903 Ga0496100_0094960 Ga0496100_0094960_200_1153 297
325 3300048904 Ga0496101_0131617 Ga0496101_0131617_903_1856 297
326 3300048905 Ga0496102_0005663 Ga0496102_0005663_2771_3724 297
327 3300048905 Ga0496102_0041542 Ga0496102_0041542_1511_2470 297
328 3300048907 Ga0496104_0000948 Ga0496104_0000948_10427_11383 297
329 3300048907 Ga0496104_0006356 Ga0496104_0006356_3544_4497 297
330 3300048908 Ga0496105_0007104 Ga0496105_0007104_1998_2954 297
331 3300048909 Ga0496106_0087261 Ga0496106_0087261_164_1117 297
332 3300048909 Ga0496106_0225607 Ga0496106_0225607_57_1016 297
333 3300048910 Ga0496107_0080409 Ga0496107_0080409_582_1535 297
334 3300048911 Ga0496108_0000479 Ga0496108_0000479_7352_8308 297
335 3300048912 Ga0496109_0009376 Ga0496109_0009376_4948_5904 297
336 3300048914 Ga0496111_0000112 Ga0496111_0000112_16542_17498 297
337 3300048915 Ga0496112_0036769 Ga0496112_0036769_2746_3699 297
338 3300048915 Ga0496112_0050774 Ga0496112_0050774_1545_2501 297
339 3300048916 Ga0496113_0036503 Ga0496113_0036503_2124_3077 297
340 3300048918 Ga0496115_0037865 Ga0496115_0037865_1553_2509 297
341 3300048918 Ga0496115_0170174 Ga0496115_0170174_536_1489 297
342 3300048924 Ga0496121_0008649 Ga0496121_0008649_9945_10901 297
343 3300048929 Ga0496126_0032055 Ga0496126_0032055_1855_2811 297
344 3300048929 Ga0496126_0087662 Ga0496126_0087662_1735_2688 297
345 3300050512 nmdc:mga0n895_12310_c1 nmdc:mga0n895_12310_c1_6399_7358 297
346 3300050513 nmdc:mga0rr50_258829_c1 nmdc:mga0rr50_258829_c1_265_1224 297
347 3300050513 nmdc:mga0rr50_9008_c1 nmdc:mga0rr50_9008_c1_2845_3804 297
348 3300050514 nmdc:mga08x19_240455_c1 nmdc:mga08x19_240455_c1_228_1187 297
349 3300053077 Ga0495601_0003938 Ga0495601_0003938_304_1260 297
350 3300053077 Ga0495601_0020996 Ga0495601_0020996_2748_3701 297
351 3300053077 Ga0495601_0197037 Ga0495601_0197037_44_997 297
352 3300053084 Ga0495595_0003156 Ga0495595_0003156_3054_4007 297
353 3300053085 Ga0495619_0004698 Ga0495619_0004698_4769_5725 297
354 3300005330 Ga0070690_100003720 Ga0070690_1000037204 298
355 3300005334 Ga0068869_100002056 Ga0068869_1000020567 298
356 3300005336 Ga0070680_100079888 Ga0070680_1000798881 298
357 3300005336 Ga0070680_100236239 Ga0070680_1002362392 298
358 3300005338 Ga0068868_100399502 Ga0068868_1003995022 298
359 3300005340 Ga0070689_100006977 Ga0070689_1000069776 298
360 3300005355 Ga0070671_100042208 Ga0070671_1000422085 298
361 3300005435 Ga0070714_100269732 Ga0070714_1002697321 298
362 3300005436 Ga0070713_100000065 Ga0070713_10000006530 298
363 3300005438 Ga0070701_10065347 Ga0070701_100653472 298
364 3300005440 Ga0070705_100182098 Ga0070705_1001820982 298
365 3300005441 Ga0070700_100001467 Ga0070700_1000014672 298
366 3300005444 Ga0070694_100011614 Ga0070694_1000116144 298
367 3300005445 Ga0070708_100533424 Ga0070708_1005334241 298
368 3300005459 Ga0068867_100004140 Ga0068867_1000041404 298
369 3300005467 Ga0070706_100164818 Ga0070706_1001648182 298
370 3300005468 Ga0070707_100459500 Ga0070707_1004595002 298
371 3300005530 Ga0070679_100021876 Ga0070679_1000218765 298
372 3300005536 Ga0070697_100002755 Ga0070697_10000275511 298
373 3300005544 Ga0070686_100006725 Ga0070686_1000067254 298
374 3300005545 Ga0070695_100000795 Ga0070695_10000079512 298
375 3300005547 Ga0070693_100015556 Ga0070693_1000155562 298
376 3300005547 Ga0070693_100032201 Ga0070693_1000322014 298
377 3300005564 Ga0070664_100385973 Ga0070664_1003859732 298
378 3300005614 Ga0068856_100000476 Ga0068856_10000047615 298
379 3300005617 Ga0068859_100040199 Ga0068859_1000401995 298
380 3300005718 Ga0068866_10002101 Ga0068866_100021014 298
381 3300005841 Ga0068863_100371758 Ga0068863_1003717582 298
382 3300005842 Ga0068858_100033258 Ga0068858_1000332584 298
383 3300005844 Ga0068862_100110905 Ga0068862_1001109053 298
384 3300006163 Ga0070715_10080801 Ga0070715_100808012 298
385 3300006237 Ga0097621_100014579 Ga0097621_1000145794 298
386 3300006237 Ga0097621_100312542 Ga0097621_1003125422 298
387 3300006358 Ga0068871_100011570 Ga0068871_1000115704 298
388 3300006881 Ga0068865_100004018 Ga0068865_1000040187 298
389 3300006914 Ga0075436_100000339 Ga0075436_10000033916 298
390 3300006931 Ga0097620_100040199 Ga0097620_1000401995 298
391 3300009098 Ga0105245_10006477 Ga0105245_100064774 298
392 3300009098 Ga0105245_10053683 Ga0105245_100536832 298
393 3300009148 Ga0105243_10037056 Ga0105243_100370562 298
394 3300009176 Ga0105242_10006151 Ga0105242_100061514 298
395 3300009177 Ga0105248_10461693 Ga0105248_104616932 298
396 3300013105 Ga0157369_10023064 Ga0157369_100230642 298
397 3300013296 Ga0157374_10029820 Ga0157374_100298203 298
398 3300013297 Ga0157378_10002093 Ga0157378_100020934 298
399 3300013297 Ga0157378_10010637 Ga0157378_100106374 298
400 3300013308 Ga0157375_10017330 Ga0157375_100173304 298
401 3300014325 Ga0163163_10014359 Ga0163163_100143594 298
402 3300014325 Ga0163163_10162745 Ga0163163_101627452 298
403 3300021377 Ga0213874_10005567 Ga0213874_100055672 298
404 3300021384 Ga0213876_10002788 Ga0213876_100027885 298
405 3300025899 Ga0207642_10031820 Ga0207642_100318202 298
406 3300025904 Ga0207647_10150732 Ga0207647_101507321 298
407 3300025905 Ga0207685_10088304 Ga0207685_100883041 298
408 3300025908 Ga0207643_10018881 Ga0207643_100188813 298
409 3300025910 Ga0207684_10056482 Ga0207684_100564823 298
410 3300025912 Ga0207707_10007324 Ga0207707_100073247 298
411 3300025915 Ga0207693_10158375 Ga0207693_101583752 298
412 3300025917 Ga0207660_10080858 Ga0207660_100808582 298
413 3300025921 Ga0207652_10062790 Ga0207652_100627902 298
414 3300025927 Ga0207687_10006743 Ga0207687_100067435 298
415 3300025928 Ga0207700_10000046 Ga0207700_1000004647 298
416 3300025928 Ga0207700_10044479 Ga0207700_100444792 298
417 3300025929 Ga0207664_10126435 Ga0207664_101264352 298
418 3300025934 Ga0207686_10006534 Ga0207686_100065344 298
419 3300025935 Ga0207709_10013178 Ga0207709_100131782 298
420 3300025936 Ga0207670_10010015 Ga0207670_100100153 298
421 3300025938 Ga0207704_10009822 Ga0207704_100098222 298
422 3300025939 Ga0207665_10052097 Ga0207665_100520972 298
423 3300025939 Ga0207665_10187583 Ga0207665_101875831 298
424 3300025941 Ga0207711_10211250 Ga0207711_102112501 298
425 3300025942 Ga0207689_10000455 Ga0207689_1000045519 298
426 3300025944 Ga0207661_10007889 Ga0207661_100078893 298
427 3300025944 Ga0207661_10473189 Ga0207661_104731892 298
428 3300025945 Ga0207679_10387238 Ga0207679_103872382 298
429 3300026035 Ga0207703_10006428 Ga0207703_100064284 298
430 3300026035 Ga0207703_10310881 Ga0207703_103108812 298
431 3300026075 Ga0207708_10000339 Ga0207708_1000033938 298
432 3300026078 Ga0207702_10000514 Ga0207702_1000051434 298
433 3300026088 Ga0207641_10370614 Ga0207641_103706142 298
434 3300026089 Ga0207648_10001197 Ga0207648_1000119717 298
435 3300028577 Ga0265318_10029464 Ga0265318_100294642 298
436 3300031238 Ga0265332_10004884 Ga0265332_100048842 298
437 3300031238 Ga0265332_10011382 Ga0265332_100113822 298
438 3300031247 Ga0265340_10014281 Ga0265340_100142814 298
439 3300031247 Ga0265340_10023667 Ga0265340_100236672 298
440 3300031249 Ga0265339_10004408 Ga0265339_100044086 298
441 3300031250 Ga0265331_10007186 Ga0265331_100071864 298
442 3300031250 Ga0265331_10017067 Ga0265331_100170672 298
443 3300031251 Ga0265327_10002824 Ga0265327_1000282413 298
444 3300031616 Ga0307508_10008446 Ga0307508_100084468 298
445 3300031711 Ga0265314_10027306 Ga0265314_100273067 298
446 3300031711 Ga0265314_10089609 Ga0265314_100896092 298
447 3300031712 Ga0265342_10000146 Ga0265342_1000014626 298
448 3300031712 Ga0265342_10018437 Ga0265342_100184373 298
449 3300031712 Ga0265342_10029041 Ga0265342_100290414 298
450 3300035085 Ga0373929_0005888 Ga0373929_0005888_864_1817 298
451 3300035111 Ga0373923_0001932 Ga0373923_0001932_3966_4925 298
452 3300035113 Ga0373936_0002375 Ga0373936_0002375_789_1748 298
453 3300035117 Ga0373953_0001993 Ga0373953_0001993_4946_5905 298
454 3300035117 Ga0373953_0013826 Ga0373953_0013826_818_1771 298
455 3300035118 Ga0373954_0011383 Ga0373954_0011383_1304_2257 298
456 3300035118 Ga0373954_0028738 Ga0373954_0028738_1305_2264 298
457 3300035120 Ga0373957_0014844 Ga0373957_0014844_14_967 298
458 3300035170 Ga0373943_0024272 Ga0373943_0024272_957_1916 298
459 3300035171 Ga0373946_0001151 Ga0373946_0001151_3525_4484 298
460 3300035172 Ga0373955_0001496 Ga0373955_0001496_2163_3122 298
461 3300035172 Ga0373955_0035179 Ga0373955_0035179_1193_2146 298
462 3300035172 Ga0373955_0101172 Ga0373955_0101172_469_1428 298
463 3300035410 Ga0373924_0000337 Ga0373924_0000337_6993_7952 298
464 3300035691 Ga0373931_0000221 Ga0373931_0000221_15316_16269 298
465 3300035692 Ga0373935_0000151 Ga0373935_0000151_6631_7590 298
466 3300035692 Ga0373935_0022406 Ga0373935_0022406_2326_3279 298
467 3300035695 Ga0373927_0047869 Ga0373927_0047869_685_1638 298
468 3300035695 Ga0373927_0071590 Ga0373927_0071590_86_1045 298
469 3300035724 Ga0373933_0001536 Ga0373933_0001536_4997_5956 298
470 3300035725 Ga0373947_0001986 Ga0373947_0001986_10917_11876 298
471 3300035725 Ga0373947_0010137 Ga0373947_0010137_2772_3725 298
472 3300036401 Ga0373937_0000004 Ga0373937_0000004_126640_127599 298
473 3300036401 Ga0373937_0112014 Ga0373937_0112014_267_1223 298
474 3300037068 Ga0373925_0000095 Ga0373925_0000095_85414_86373 298
475 3300037068 Ga0373925_0042842 Ga0373925_0042842_1952_2911 298
476 3300037853 Ga0436364_0488870 Ga0436364_0488870_4934_5887 298
477 3300039437 Ga0436365_0260170 Ga0436365_0260170_14318_15277 298
478 3300039450 Ga0436363_0621480 Ga0436363_0621480_2053_3012 298
479 3300046454 Ga0495592_0000029 Ga0495592_0000029_87270_88229 298
480 3300046455 Ga0495603_0140742 Ga0495603_0140742_415_1368 298
481 3300046459 Ga0495629_0007749 Ga0495629_0007749_2270_3229 298
482 3300046462 Ga0495651_0001409 Ga0495651_0001409_2571_3530 298
483 3300046463 Ga0495653_0000012 Ga0495653_0000012_264425_265384 298
484 3300046472 Ga0495580_0034346 Ga0495580_0034346_1201_2154 298
485 3300046473 Ga0495582_0017363 Ga0495582_0017363_2775_3728 298
486 3300046473 Ga0495582_0124859 Ga0495582_0124859_451_1410 298
487 3300046475 Ga0495639_0006366 Ga0495639_0006366_211_1164 298
488 3300046476 Ga0495662_0015742 Ga0495662_0015742_2367_3326 298
489 3300046477 Ga0495664_0000004 Ga0495664_0000004_116934_117893 298
490 3300046477 Ga0495664_0014315 Ga0495664_0014315_406_1359 298
491 3300046477 Ga0495664_0027914 Ga0495664_0027914_1734_2687 298
492 3300046511 Ga0495608_0000017 Ga0495608_0000017_116921_117880 298
493 3300046514 Ga0495618_0000006 Ga0495618_0000006_76027_76986 298
494 3300046514 Ga0495618_0008025 Ga0495618_0008025_2915_3868 298
495 3300046516 Ga0495628_0000001 Ga0495628_0000001_116923_117882 298
496 3300046516 Ga0495628_0057268 Ga0495628_0057268_1296_2249 298
497 3300046517 Ga0495630_0000947 Ga0495630_0000947_12805_13764 298
498 3300046517 Ga0495630_0010876 Ga0495630_0010876_3911_4864 298
499 3300046529 Ga0495652_0000002 Ga0495652_0000002_331457_332416 298
500 3300046533 Ga0495640_0000001 Ga0495640_0000001_425461_426420 298
501 3300046533 Ga0495640_0198621 Ga0495640_0198621_65_1018 298
502 3300046535 Ga0495586_0148045 Ga0495586_0148045_234_1187 298
503 3300046536 Ga0495587_0000008 Ga0495587_0000008_117141_118100 298
504 3300046543 Ga0495645_0000002 Ga0495645_0000002_116936_117895 298
505 3300046543 Ga0495645_0033979 Ga0495645_0033979_2091_3044 298
506 3300046559 Ga0495667_0000029 Ga0495667_0000029_116932_117891 298
507 3300046559 Ga0495667_0086148 Ga0495667_0086148_406_1359 298
508 3300046642 Ga0495634_0000082 Ga0495634_0000082_71786_72745 298
509 3300046642 Ga0495634_0013859 Ga0495634_0013859_1970_2923 298
510 3300046663 Ga0495635_0000002 Ga0495635_0000002_369042_370001 298
511 3300046675 Ga0495657_0000459 Ga0495657_0000459_1447_2406 298
512 3300046678 Ga0495599_0000104 Ga0495599_0000104_38649_39608 298
513 3300046678 Ga0495599_0058365 Ga0495599_0058365_159_1112 298
514 3300046679 Ga0495623_0000691 Ga0495623_0000691_851_1810 298
515 3300046679 Ga0495623_0080930 Ga0495623_0080930_33_986 298
516 3300046679 Ga0495623_0170233 Ga0495623_0170233_153_1109 298
517 3300046680 Ga0495646_0000064 Ga0495646_0000064_43367_44326 298
518 3300046680 Ga0495646_0020683 Ga0495646_0020683_2026_2979 298
519 3300046689 Ga0495613_0006515 Ga0495613_0006515_6924_7883 298
520 3300046689 Ga0495613_0053163 Ga0495613_0053163_1199_2152 298
521 3300046809 Ga0495600_0000010 Ga0495600_0000010_122172_123131 298
522 3300047315 Ga0495581_0009913 Ga0495581_0009913_3090_4049 298
523 3300047317 Ga0495604_0000009 Ga0495604_0000009_208410_209369 298
524 3300047319 Ga0495674_0000002 Ga0495674_0000002_116924_117883 298
525 3300047322 Ga0495680_0000752 Ga0495680_0000752_34347_35306 298
526 3300047444 Ga0495675_0000517 Ga0495675_0000517_14131_15090 298
527 3300047471 Ga0495684_0000006 Ga0495684_0000006_116883_117842 298
528 3300047673 Ga0495593_0034416 Ga0495593_0034416_643_1602 298
529 3300047673 Ga0495593_0076280 Ga0495593_0076280_101_1054 298
530 3300048088 Ga0495602_0000005 Ga0495602_0000005_227791_228750 298
531 3300048904 Ga0496101_0327935 Ga0496101_0327935_164_1117 298
532 3300048905 Ga0496102_0024139 Ga0496102_0024139_486_1439 298
533 3300048905 Ga0496102_0042326 Ga0496102_0042326_1607_2563 298
534 3300048905 Ga0496102_0063150 Ga0496102_0063150_1027_1980 298
535 3300048906 Ga0496103_0058010 Ga0496103_0058010_992_1948 298
536 3300048907 Ga0496104_0009285 Ga0496104_0009285_1519_2472 298
537 3300048907 Ga0496104_0014451 Ga0496104_0014451_4439_5395 298
538 3300048907 Ga0496104_0038722 Ga0496104_0038722_1589_2542 298
539 3300048908 Ga0496105_0014038 Ga0496105_0014038_1737_2693 298
540 3300048908 Ga0496105_0033884 Ga0496105_0033884_1717_2670 298
541 3300048911 Ga0496108_0012829 Ga0496108_0012829_4268_5224 298
542 3300048911 Ga0496108_0024393 Ga0496108_0024393_674_1627 298
543 3300048912 Ga0496109_0006681 Ga0496109_0006681_6901_7854 298
544 3300048912 Ga0496109_0018409 Ga0496109_0018409_3567_4523 298
545 3300048912 Ga0496109_0020910 Ga0496109_0020910_1625_2578 298
546 3300048913 Ga0496110_0001819 Ga0496110_0001819_192_1145 298
547 3300048913 Ga0496110_0011940 Ga0496110_0011940_3964_4920 298
548 3300048913 Ga0496110_0050354 Ga0496110_0050354_2416_3369 298
549 3300048914 Ga0496111_0021445 Ga0496111_0021445_1950_2906 298
550 3300048914 Ga0496111_0040428 Ga0496111_0040428_2230_3183 298
551 3300048915 Ga0496112_0000979 Ga0496112_0000979_1587_2543 298
552 3300048915 Ga0496112_0060945 Ga0496112_0060945_2423_3376 298
553 3300048916 Ga0496113_0010030 Ga0496113_0010030_663_1616 298
554 3300048916 Ga0496113_0015988 Ga0496113_0015988_1417_2373 298
555 3300048918 Ga0496115_0080961 Ga0496115_0080961_86_1039 298
556 3300050513 nmdc:mga0rr50_19152_c1 nmdc:mga0rr50_19152_c1_3423_4379 298
557 3300050514 nmdc:mga08x19_24_c1 nmdc:mga08x19_24_c1_218645_219601 298
558 3300053077 Ga0495601_0000002 Ga0495601_0000002_193579_194538 298
559 3300053078 Ga0495612_0000010 Ga0495612_0000010_129467_130426 298
560 3300053078 Ga0495612_0024650 Ga0495612_0024650_955_1908 298
561 3300053078 Ga0495612_0028435 Ga0495612_0028435_1120_2073 298
562 3300053080 Ga0500635_0002728 Ga0500635_0002728_2932_3885 298
563 3300053084 Ga0495595_0001077 Ga0495595_0001077_1095_2054 298
564 3300053085 Ga0495619_0000019 Ga0495619_0000019_152915_153874 298
565 3300053085 Ga0495619_0021717 Ga0495619_0021717_3036_3989 298
566 3300053085 Ga0495619_0076522 Ga0495619_0076522_718_1671 298
567 3300053102 Ga0500554_004224 Ga0500554_004224_1517_2470 298
568 3300053150 Ga0500603_000117 Ga0500603_000117_13579_14532 298
569 3300053178 Ga0500637_0005039 Ga0500637_0005039_247_1200 298
570 iso_pu_bacteria 2858688981 2858698379 298
571 3300005344 Ga0070661_100028320 Ga0070661_1000283202 299
572 3300005471 Ga0070698_100112606 Ga0070698_1001126062 299
573 3300005577 Ga0068857_100438020 Ga0068857_1004380201 299
574 3300005578 Ga0068854_100048773 Ga0068854_1000487732 299
575 3300006914 Ga0075436_100015236 Ga0075436_1000152365 299
576 3300009545 Ga0105237_10174010 Ga0105237_101740102 299
577 3300013105 Ga0157369_10488664 Ga0157369_104886641 299
578 3300014969 Ga0157376_10007767 Ga0157376_100077675 299
579 3300021384 Ga0213876_10040212 Ga0213876_100402123 299
580 3300021441 Ga0213871_10046988 Ga0213871_100469881 299
581 3300025915 Ga0207693_10229152 Ga0207693_102291522 299
582 3300025933 Ga0207706_10149903 Ga0207706_101499032 299
583 3300025944 Ga0207661_10273255 Ga0207661_102732552 299
584 3300025949 Ga0207667_10174121 Ga0207667_101741212 299
585 3300026078 Ga0207702_10573768 Ga0207702_105737681 299
586 3300026142 Ga0207698_10249347 Ga0207698_102493472 299
587 3300028556 Ga0265337_1000530 Ga0265337_100053016 299
588 3300035114 Ga0373939_0008062 Ga0373939_0008062_430_1389 299
589 3300036401 Ga0373937_0006604 Ga0373937_0006604_3865_4824 299
590 3300037853 Ga0436364_0329188 Ga0436364_0329188_13137_14096 299
591 3300039437 Ga0436365_0190362 Ga0436365_0190362_10813_11772 299
592 3300039438 Ga0436360_0651368 Ga0436360_0651368_78_1040 299
593 3300039438 Ga0436360_1161538 Ga0436360_1161538_442_1401 299
594 3300039450 Ga0436363_0242104 Ga0436363_0242104_4179_5132 299
595 3300039450 Ga0436363_0981994 Ga0436363_0981994_212_1171 299
596 3300039453 Ga0436362_0204855 Ga0436362_0204855_13539_14498 299
597 3300044694 Ga0466963_0008212 Ga0466963_0008212_3348_4328 299
598 3300044719 Ga0466971_0018688 Ga0466971_0018688_1217_2170 299
599 3300044842 Ga0466957_0094565 Ga0466957_0094565_754_1707 299
600 3300045976 Ga0466967_0043726 Ga0466967_0043726_325_1305 299
601 3300046559 Ga0495667_0018573 Ga0495667_0018573_2640_3599 299
602 3300046675 Ga0495657_0026469 Ga0495657_0026469_962_1921 299
603 3300046809 Ga0495600_0040429 Ga0495600_0040429_269_1228 299
604 3300047317 Ga0495604_0069786 Ga0495604_0069786_1649_2608 299
605 3300047322 Ga0495680_0043785 Ga0495680_0043785_28_987 299
606 3300048088 Ga0495602_0200878 Ga0495602_0200878_526_1485 299
607 3300048909 Ga0496106_0284735 Ga0496106_0284735_239_1192 299
608 3300048910 Ga0496107_0032136 Ga0496107_0032136_2625_3578 299
609 3300048915 Ga0496112_0005973 Ga0496112_0005973_8695_9648 299
610 3300053077 Ga0495601_0019493 Ga0495601_0019493_1620_2579 299
611 3300053078 Ga0495612_0048112 Ga0495612_0048112_321_1280 299
612 3300053084 Ga0495595_0124433 Ga0495595_0124433_77_1036 299
613 3300053085 Ga0495619_0005347 Ga0495619_0005347_1315_2274 299
614 3300005329 Ga0070683_100147953 Ga0070683_1001479533 300
615 3300005331 Ga0070670_100011727 Ga0070670_1000117276 300
616 3300005335 Ga0070666_10220353 Ga0070666_102203532 300
617 3300005340 Ga0070689_100013029 Ga0070689_1000130295 300
618 3300005439 Ga0070711_100019808 Ga0070711_1000198082 300
619 3300005455 Ga0070663_100013409 Ga0070663_1000134092 300
620 3300005468 Ga0070707_100177400 Ga0070707_1001774002 300
621 3300005616 Ga0068852_100114443 Ga0068852_1001144433 300
622 3300009093 Ga0105240_10178313 Ga0105240_101783132 300
623 3300009098 Ga0105245_10151080 Ga0105245_101510803 300
624 3300009177 Ga0105248_10075361 Ga0105248_100753615 300
625 3300009551 Ga0105238_10263085 Ga0105238_102630852 300
626 3300013100 Ga0157373_10195093 Ga0157373_101950932 300
627 3300013105 Ga0157369_10135780 Ga0157369_101357803 300
628 3300014325 Ga0163163_10084903 Ga0163163_100849033 300
629 3300014497 Ga0182008_10089019 Ga0182008_100890192 300
630 3300014968 Ga0157379_10193985 Ga0157379_101939852 300
631 3300025903 Ga0207680_10142553 Ga0207680_101425532 300
632 3300025913 Ga0207695_10028695 Ga0207695_100286954 300
633 3300025916 Ga0207663_10127639 Ga0207663_101276392 300
634 3300025922 Ga0207646_10235966 Ga0207646_102359662 300
635 3300025925 Ga0207650_10005625 Ga0207650_100056253 300
636 3300025926 Ga0207659_10120276 Ga0207659_101202762 300
637 3300025928 Ga0207700_10186926 Ga0207700_101869262 300
638 3300025931 Ga0207644_10001557 Ga0207644_1000155713 300
639 3300025932 Ga0207690_10005073 Ga0207690_100050739 300
640 3300025932 Ga0207690_10097558 Ga0207690_100975582 300
641 3300025936 Ga0207670_10013168 Ga0207670_100131684 300
642 3300025944 Ga0207661_10004929 Ga0207661_100049292 300
643 3300026067 Ga0207678_10079624 Ga0207678_100796242 300
644 3300026078 Ga0207702_10426829 Ga0207702_104268292 300
645 3300026116 Ga0207674_10166840 Ga0207674_101668402 300
646 3300026142 Ga0207698_10034168 Ga0207698_100341683 300
647 3300035089 Ga0373944_0000531 Ga0373944_0000531_5787_6758 300
648 3300035111 Ga0373923_0022134 Ga0373923_0022134_1312_2265 300
649 3300035170 Ga0373943_0000284 Ga0373943_0000284_15565_16536 300
650 3300035170 Ga0373943_0004873 Ga0373943_0004873_1053_2006 300
651 3300035171 Ga0373946_0000993 Ga0373946_0000993_3738_4709 300
652 3300035171 Ga0373946_0011943 Ga0373946_0011943_1148_2101 300
653 3300035172 Ga0373955_0018376 Ga0373955_0018376_252_1205 300
654 3300035692 Ga0373935_0003583 Ga0373935_0003583_3717_4688 300
655 3300035692 Ga0373935_0007237 Ga0373935_0007237_2483_3436 300
656 3300035695 Ga0373927_0001879 Ga0373927_0001879_13671_14624 300
657 3300035695 Ga0373927_0004424 Ga0373927_0004424_6062_7033 300
658 3300035725 Ga0373947_0002343 Ga0373947_0002343_6037_7008 300
659 3300035725 Ga0373947_0006664 Ga0373947_0006664_2039_2992 300
660 3300036401 Ga0373937_0018911 Ga0373937_0018911_3725_4678 300
661 3300037068 Ga0373925_0001023 Ga0373925_0001023_6094_7065 300
662 3300037068 Ga0373925_0067102 Ga0373925_0067102_869_1822 300
663 3300037312 Ga0395899_0007698 Ga0395899_0007698_2209_3186 300
664 3300037418 Ga0395900_0009613 Ga0395900_0009613_2634_3587 300
665 3300037418 Ga0395900_0011548 Ga0395900_0011548_20_997 300
666 3300037418 Ga0395900_0027919 Ga0395900_0027919_3073_4026 300
667 3300037466 Ga0395898_0008544 Ga0395898_0008544_7730_8707 300
668 3300037466 Ga0395898_0038553 Ga0395898_0038553_1695_2648 300
669 3300038443 Ga0395901_0007299 Ga0395901_0007299_7898_8875 300
670 3300038443 Ga0395901_0013071 Ga0395901_0013071_1479_2432 300
671 3300038443 Ga0395901_0576617 Ga0395901_0576617_120_1073 300
672 3300039437 Ga0436365_1183719 Ga0436365_1183719_430_1386 300
673 3300039447 Ga0436361_0522444 Ga0436361_0522444_688_1641 300
674 3300046454 Ga0495592_0036029 Ga0495592_0036029_518_1471 300
675 3300046455 Ga0495603_0000351 Ga0495603_0000351_9081_10034 300
676 3300046459 Ga0495629_0000250 Ga0495629_0000250_1663_2616 300
677 3300046459 Ga0495629_0008760 Ga0495629_0008760_2438_3409 300
678 3300046461 Ga0495641_0014632 Ga0495641_0014632_974_1927 300
679 3300046462 Ga0495651_0132999 Ga0495651_0132999_624_1577 300
680 3300046463 Ga0495653_0077552 Ga0495653_0077552_616_1569 300
681 3300046463 Ga0495653_0231853 Ga0495653_0231853_221_1192 300
682 3300046472 Ga0495580_0000536 Ga0495580_0000536_4718_5671 300
683 3300046472 Ga0495580_0017120 Ga0495580_0017120_1936_2907 300
684 3300046473 Ga0495582_0000021 Ga0495582_0000021_80729_81682 300
685 3300046475 Ga0495639_0000030 Ga0495639_0000030_1054_2007 300
686 3300046476 Ga0495662_0000399 Ga0495662_0000399_5307_6260 300
687 3300046477 Ga0495664_0016703 Ga0495664_0016703_919_1872 300
688 3300046499 Ga0495594_0000153 Ga0495594_0000153_11328_12281 300
689 3300046511 Ga0495608_0071822 Ga0495608_0071822_827_1798 300
690 3300046514 Ga0495618_0044730 Ga0495618_0044730_1340_2311 300
691 3300046514 Ga0495618_0139890 Ga0495618_0139890_158_1111 300
692 3300046516 Ga0495628_0072036 Ga0495628_0072036_1147_2100 300
693 3300046517 Ga0495630_0093130 Ga0495630_0093130_391_1344 300
694 3300046526 Ga0495666_0004324 Ga0495666_0004324_4662_5633 300
695 3300046526 Ga0495666_0033401 Ga0495666_0033401_1368_2321 300
696 3300046529 Ga0495652_0108045 Ga0495652_0108045_328_1281 300
697 3300046531 Ga0495665_0000932 Ga0495665_0000932_13324_14277 300
698 3300046531 Ga0495665_0002715 Ga0495665_0002715_3976_4947 300
699 3300046533 Ga0495640_0002049 Ga0495640_0002049_13278_14231 300
700 3300046533 Ga0495640_0025921 Ga0495640_0025921_3103_4074 300
701 3300046559 Ga0495667_0017281 Ga0495667_0017281_800_1753 300
702 3300046642 Ga0495634_0001430 Ga0495634_0001430_19967_20920 300
703 3300046642 Ga0495634_0005270 Ga0495634_0005270_3499_4470 300
704 3300046663 Ga0495635_0001998 Ga0495635_0001998_8415_9386 300
705 3300046663 Ga0495635_0005162 Ga0495635_0005162_3377_4330 300
706 3300046674 Ga0495588_0000909 Ga0495588_0000909_9643_10596 300
707 3300046675 Ga0495657_0121297 Ga0495657_0121297_350_1321 300
708 3300046680 Ga0495646_0044324 Ga0495646_0044324_1556_2509 300
709 3300046681 Ga0495647_0000795 Ga0495647_0000795_2983_3936 300
710 3300046681 Ga0495647_0033717 Ga0495647_0033717_383_1354 300
711 3300046683 Ga0495658_0000400 Ga0495658_0000400_14535_15488 300
712 3300046689 Ga0495613_0001829 Ga0495613_0001829_10491_11462 300
713 3300046689 Ga0495613_0005697 Ga0495613_0005697_4590_5543 300
714 3300046690 Ga0495624_0000736 Ga0495624_0000736_1054_2007 300
715 3300046690 Ga0495624_0004952 Ga0495624_0004952_8401_9372 300
716 3300046809 Ga0495600_0061453 Ga0495600_0061453_304_1257 300
717 3300046809 Ga0495600_0125121 Ga0495600_0125121_521_1492 300
718 3300047315 Ga0495581_0000047 Ga0495581_0000047_36740_37693 300
719 3300047319 Ga0495674_0000101 Ga0495674_0000101_57658_58611 300
720 3300047321 Ga0495676_0010355 Ga0495676_0010355_3636_4607 300
721 3300047471 Ga0495684_0028735 Ga0495684_0028735_2168_3121 300
722 3300047673 Ga0495593_0000483 Ga0495593_0000483_17630_18583 300
723 3300047673 Ga0495593_0013064 Ga0495593_0013064_1104_2075 300
724 3300048903 Ga0496100_0117948 Ga0496100_0117948_540_1514 300
725 3300048915 Ga0496112_0044005 Ga0496112_0044005_168_1142 300
726 3300048916 Ga0496113_0033714 Ga0496113_0033714_1889_2863 300
727 3300048929 Ga0496126_0009299 Ga0496126_0009299_9249_10202 300
728 3300048929 Ga0496126_0123675 Ga0496126_0123675_1245_2198 300
729 3300053085 Ga0495619_0005973 Ga0495619_0005973_2558_3529 300
730 3300053085 Ga0495619_0094576 Ga0495619_0094576_697_1650 300
731 iso_pu_bacteria 2791355137 2792833460 300
732 iso_pu_bacteria 2904615490 2904622176 300
733 3300024227 Ga0228598_1000253 Ga0228598_10002539 301
734 3300025915 Ga0207693_10252385 Ga0207693_102523852 301
735 3300035118 Ga0373954_0028821 Ga0373954_0028821_1562_2533 301
736 3300035172 Ga0373955_0020477 Ga0373955_0020477_455_1426 301
737 3300035410 Ga0373924_0023187 Ga0373924_0023187_1170_2141 301
738 3300036401 Ga0373937_0284820 Ga0373937_0284820_560_1537 301
739 3300037312 Ga0395899_0028963 Ga0395899_0028963_714_1694 301
740 3300037418 Ga0395900_0002181 Ga0395900_0002181_11784_12764 301
741 3300038443 Ga0395901_0004745 Ga0395901_0004745_956_1936 301
742 3300045049 Ga0466959_0033591 Ga0466959_0033591_1245_2201 301
743 3300046454 Ga0495592_0094362 Ga0495592_0094362_174_1145 301
744 3300046462 Ga0495651_0034944 Ga0495651_0034944_961_1932 301
745 3300046463 Ga0495653_0046364 Ga0495653_0046364_1999_2970 301
746 3300046473 Ga0495582_0155844 Ga0495582_0155844_75_1046 301
747 3300046529 Ga0495652_0170400 Ga0495652_0170400_270_1262 301
748 3300046533 Ga0495640_0193816 Ga0495640_0193816_195_1166 301
749 3300046536 Ga0495587_0050833 Ga0495587_0050833_1363_2334 301
750 3300046678 Ga0495599_0012063 Ga0495599_0012063_2493_3464 301
751 3300046678 Ga0495599_0138546 Ga0495599_0138546_278_1270 301
752 3300046679 Ga0495623_0033849 Ga0495623_0033849_22_993 301
753 3300047317 Ga0495604_0041003 Ga0495604_0041003_574_1545 301
754 3300047322 Ga0495680_0037213 Ga0495680_0037213_1355_2326 301
755 3300047444 Ga0495675_0033606 Ga0495675_0033606_245_1216 301
756 3300048088 Ga0495602_0054210 Ga0495602_0054210_2126_3097 301
757 3300048904 Ga0496101_0026338 Ga0496101_0026338_650_1648 301
758 3300048907 Ga0496104_0068699 Ga0496104_0068699_1939_2937 301
759 3300048909 Ga0496106_0062041 Ga0496106_0062041_230_1228 301
760 3300048911 Ga0496108_0099668 Ga0496108_0099668_802_1800 301
761 3300053077 Ga0495601_0051588 Ga0495601_0051588_684_1676 301
762 3300053078 Ga0495612_0097979 Ga0495612_0097979_27_998 301
763 3300053084 Ga0495595_0002209 Ga0495595_0002209_4736_5728 301
764 3300053085 Ga0495619_0017762 Ga0495619_0017762_2553_3545 301
765 3300053085 Ga0495619_0101361 Ga0495619_0101361_113_1084 301
766 3300005536 Ga0070697_100279858 Ga0070697_1002798582 302
767 3300005548 Ga0070665_100211366 Ga0070665_1002113662 302
768 3300006871 Ga0075434_100212903 Ga0075434_1002129032 302
769 3300050512 nmdc:mga0n895_31651_c1 nmdc:mga0n895_31651_c1_1082_2041 302
770 3300005577 Ga0068857_100023092 Ga0068857_1000230922 303
771 3300005937 Ga0081455_10001982 Ga0081455_1000198220 303
772 3300009093 Ga0105240_10003221 Ga0105240_1000322114 303
773 3300009545 Ga0105237_10261905 Ga0105237_102619052 303
774 3300021388 Ga0213875_10002629 Ga0213875_100026294 303
775 3300026116 Ga0207674_10027845 Ga0207674_100278453 303
776 3300037418 Ga0395900_0090074 Ga0395900_0090074_832_1809 303
777 3300037466 Ga0395898_0021759 Ga0395898_0021759_709_1686 303
778 3300037853 Ga0436364_0229137 Ga0436364_0229137_7032_8048 303
779 3300005355 Ga0070671_100006289 Ga0070671_1000062892 306
780 3300009177 Ga0105248_10027250 Ga0105248_100272504 306
781 3300021388 Ga0213875_10009158 Ga0213875_100091583 306
782 3300025931 Ga0207644_10005689 Ga0207644_100056894 306
783 3300025941 Ga0207711_10048325 Ga0207711_100483253 306
784 3300037853 Ga0436364_0787255 Ga0436364_0787255_1252_2235 306
785 3300048912 Ga0496109_0073852 Ga0496109_0073852_952_1968 306
786 3300048916 Ga0496113_0072730 Ga0496113_0072730_1500_2516 306
787 3300021388 Ga0213875_10005169 Ga0213875_100051694 307
788 3300037853 Ga0436364_1358002 Ga0436364_1358002_9995_10978 307
789 3300048929 Ga0496126_0115195 Ga0496126_0115195_188_1171 307
790 3300005445 Ga0070708_100189092 Ga0070708_1001890922 308
791 3300005467 Ga0070706_100059063 Ga0070706_1000590632 308
792 3300005518 Ga0070699_100075570 Ga0070699_1000755703 308
793 3300005536 Ga0070697_100039824 Ga0070697_1000398242 308
794 3300035691 Ga0373931_0082587 Ga0373931_0082587_195_1175 308
795 3300036401 Ga0373937_0044033 Ga0373937_0044033_603_1580 308
796 3300037853 Ga0436364_1329714 Ga0436364_1329714_39046_40101 308
797 3300039437 Ga0436365_1165568 Ga0436365_1165568_1483_2562 308
798 3300039447 Ga0436361_0520146 Ga0436361_0520146_170_1153 308
799 3300039453 Ga0436362_0849335 Ga0436362_0849335_658_1635 308
800 3300049574 Ga0501038_0146473 Ga0501038_0146473_214_1197 308
801 3300037853 Ga0436364_0560002 Ga0436364_0560002_68789_69877 310
802 3300038443 Ga0395901_0031794 Ga0395901_0031794_2519_3496 310
803 3300005327 Ga0070658_10001212 Ga0070658_1000121213 313
804 3300005336 Ga0070680_100005766 Ga0070680_1000057663 313
805 3300005339 Ga0070660_100102218 Ga0070660_1001022181 313
806 3300005341 Ga0070691_10006751 Ga0070691_100067514 313
807 3300005458 Ga0070681_10003586 Ga0070681_1000358612 313
808 3300005530 Ga0070679_100003590 Ga0070679_1000035904 313
809 3300005563 Ga0068855_100007073 Ga0068855_1000070738 313
810 3300025912 Ga0207707_10021345 Ga0207707_100213454 313
811 3300025913 Ga0207695_10069421 Ga0207695_100694212 313
812 3300025917 Ga0207660_10047433 Ga0207660_100474332 313
813 3300025919 Ga0207657_10039615 Ga0207657_100396153 313
814 3300025949 Ga0207667_10174756 Ga0207667_101747562 313

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

72

133

0.93

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

125

326

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.4973 43 296
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.4574 43 296
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.4316 43 295
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.4151 43 295
2nq2-assembly1.cif.gz_B an inward-facing conformation of a putative metal-chelate type abc transporter. 0.3763 43 309
ID Description Score Start End Superfamily
af_Q58666_4_320_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.74 43 298 1.10.3470.10
af_P39328_55_321_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6969 43 295 1.10.3470.10
af_P0AE26_50_315_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6754 41 296 1.10.3470.10
af_P39328_55_321_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6622 43 295 1.10.3470.10
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.66 43 297 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A5E4UUL1-F1-model_v4 Inner-membrane translocator 0.9118 16 313 GO:0005886
GO:0015658
AF-A0A850HTY6-F1-model_v4 deleted 0.9099 43 310
AF-A0A522TNS8-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9079 23 310 GO:0005886
GO:0015658
AF-A0A1J5DGU4-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9023 17 313 GO:0005886
GO:0015658
AF-D6V7Q8-F1-model_v4 Inner-membrane translocator 0.8943 29 308 GO:0005886
GO:0015658

Feature Viewer

pLDDT pTM Quality
76.41 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map