F481988
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 814 | 268 | 811 | 305 |
Family's Representative Sequence
| Representative Sequence | 3300039437|Ga0436365_1165568|Ga0436365_1165568_1483_2562 |
| Length | 342 |
| Sequence | VTQEELQGQLRVETRGNELQRQSDAETPARSPAAAQVPALPWRERLASDRLWLVGVWVVLLTAPLWIGAVGGYTALATRVVVLGLAAMSINFLLGFTGFMSFGHAAFFGLGAYGAGLSLKLLAPSTPLALLVRRRGVYFAMVTIAFGQVFYYIAYRWNSLTGGDDGLRGFSRQPLHLGPVNLDILNDATLFYFFILFCFALATGLMGFLLRSPFGRSLLAIRENERRARFLGIPIELHVWISFTLSCFFMSFAGALYALLNNFADPSNLHYVMSGNLVIMAVLGGIRAFWGPLLGAAVFVVLQDYLSSITTNWMSFVGLLFVLVVLFFPRGLLGFLQPRSAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 2 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 3 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 65 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 66 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 90 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 94 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 95 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 96 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 97 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 98 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 144 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 145 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 146 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 147 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 148 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 149 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 150 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 151 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 152 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 153 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 154 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 155 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 157 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 158 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 159 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 160 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 161 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 162 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 163 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 164 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 165 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 166 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 167 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 168 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 169 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 170 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 171 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 172 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 173 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 174 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 175 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 176 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 177 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 179 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 180 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 181 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 182 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 183 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 184 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 185 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 186 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 187 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 188 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 189 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 190 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 191 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 192 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 193 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 194 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 195 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 243 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 244 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 245 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 246 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 247 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 248 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 251 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 252 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 253 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 254 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 255 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 256 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 257 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 264 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 267 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 268 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.63 |
| Metatranscriptomes | 0 |
| Isolates | 0.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.49 |
| Nodule | 0 |
| Rhizoplane | 7.86 |
| Rhizosphere | 86.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10001212 | 3300005327 | Bacteria | 22108 |
| 2 | Ga0070658_10016692 | 3300005327 | Bacteria | 5877 |
| 3 | Ga0070683_100095544 | 3300005329 | Bacteria | 2795 |
| 4 | Ga0070683_100147953 | 3300005329 | Bacteria | 2226 |
| 5 | Ga0070690_100003720 | 3300005330 | Bacteria | 8399 |
| 6 | Ga0070670_100011727 | 3300005331 | Bacteria | 7497 |
| 7 | Ga0068869_100002056 | 3300005334 | Bacteria | 12095 |
| 8 | Ga0068869_100141338 | 3300005334 | Bacteria | 1859 |
| 9 | Ga0070666_10220353 | 3300005335 | Bacteria | 1338 |
| 10 | Ga0070680_100005766 | 3300005336 | Bacteria | 9397 |
| 11 | Ga0070680_100007540 | 3300005336 | Bacteria | 8295 |
| 12 | Ga0070680_100010316 | 3300005336 | Bacteria | 7203 |
| 13 | Ga0070680_100038587 | 3300005336 | Bacteria | 3862 |
| 14 | Ga0070680_100079888 | 3300005336 | Bacteria | 2696 |
| 15 | Ga0070680_100095507 | 3300005336 | Bacteria | 2464 |
| 16 | Ga0070680_100099517 | 3300005336 | Bacteria | 2413 |
| 17 | Ga0070680_100236239 | 3300005336 | Bacteria | 1544 |
| 18 | Ga0070680_100321717 | 3300005336 | Bacteria | 1313 |
| 19 | Ga0068868_100399502 | 3300005338 | Bacteria | 1186 |
| 20 | Ga0070660_100034632 | 3300005339 | Bacteria | 3817 |
| 21 | Ga0070660_100047315 | 3300005339 | Bacteria | 3300 |
| 22 | Ga0070660_100083968 | 3300005339 | Bacteria | 2503 |
| 23 | Ga0070660_100102218 | 3300005339 | Bacteria | 2272 |
| 24 | Ga0070689_100006977 | 3300005340 | Bacteria | 7867 |
| 25 | Ga0070689_100013029 | 3300005340 | Bacteria | 6007 |
| 26 | Ga0070691_10006751 | 3300005341 | Bacteria | 5253 |
| 27 | Ga0070661_100004970 | 3300005344 | Bacteria | 9155 |
| 28 | Ga0070661_100028320 | 3300005344 | Bacteria | 4040 |
| 29 | Ga0070692_10004009 | 3300005345 | Bacteria | 6084 |
| 30 | Ga0070671_100006289 | 3300005355 | Bacteria | 9466 |
| 31 | Ga0070671_100042208 | 3300005355 | Bacteria | 3791 |
| 32 | Ga0070659_100017494 | 3300005366 | Bacteria | 5398 |
| 33 | Ga0070659_100106441 | 3300005366 | Bacteria | 2261 |
| 34 | Ga0070709_10047420 | 3300005434 | Bacteria | 2676 |
| 35 | Ga0070714_100002138 | 3300005435 | Bacteria | 14524 |
| 36 | Ga0070714_100070223 | 3300005435 | Bacteria | 3027 |
| 37 | Ga0070714_100269732 | 3300005435 | Bacteria | 1578 |
| 38 | Ga0070714_100271799 | 3300005435 | Bacteria | 1572 |
| 39 | Ga0070713_100000065 | 3300005436 | Bacteria | 66969 |
| 40 | Ga0070713_100009299 | 3300005436 | Bacteria | 7026 |
| 41 | Ga0070713_100162467 | 3300005436 | Bacteria | 1994 |
| 42 | Ga0070713_100263103 | 3300005436 | Bacteria | 1577 |
| 43 | Ga0070713_100400126 | 3300005436 | Bacteria | 1282 |
| 44 | Ga0070710_10014721 | 3300005437 | Bacteria | 3942 |
| 45 | Ga0070701_10065347 | 3300005438 | Bacteria | 1930 |
| 46 | Ga0070711_100019808 | 3300005439 | Bacteria | 4324 |
| 47 | Ga0070711_100045350 | 3300005439 | Bacteria | 2990 |
| 48 | Ga0070705_100003606 | 3300005440 | Bacteria | 7582 |
| 49 | Ga0070705_100182098 | 3300005440 | Bacteria | 1424 |
| 50 | Ga0070700_100001467 | 3300005441 | Bacteria | 11730 |
| 51 | Ga0070694_100011614 | 3300005444 | Bacteria | 5453 |
| 52 | Ga0070694_100033461 | 3300005444 | Bacteria | 3382 |
| 53 | Ga0070708_100161092 | 3300005445 | Bacteria | 2091 |
| 54 | Ga0070708_100189092 | 3300005445 | Bacteria | 1926 |
| 55 | Ga0070708_100533424 | 3300005445 | Bacteria | 1107 |
| 56 | Ga0070663_100013409 | 3300005455 | Bacteria | 5226 |
| 57 | Ga0070681_10003586 | 3300005458 | Bacteria | 14558 |
| 58 | Ga0070681_10011984 | 3300005458 | Bacteria | 8595 |
| 59 | Ga0070681_10028904 | 3300005458 | Bacteria | 5570 |
| 60 | Ga0070681_10092187 | 3300005458 | Bacteria | 2979 |
| 61 | Ga0070681_10104231 | 3300005458 | Bacteria | 2779 |
| 62 | Ga0070681_10168535 | 3300005458 | Bacteria | 2112 |
| 63 | Ga0070681_10199476 | 3300005458 | Bacteria | 1919 |
| 64 | Ga0068867_100004140 | 3300005459 | Bacteria | 10190 |
| 65 | Ga0070706_100059063 | 3300005467 | Bacteria | 3539 |
| 66 | Ga0070706_100164818 | 3300005467 | Bacteria | 2070 |
| 67 | Ga0070706_100222207 | 3300005467 | Bacteria | 1763 |
| 68 | Ga0070707_100068680 | 3300005468 | Bacteria | 3411 |
| 69 | Ga0070707_100177400 | 3300005468 | Bacteria | 2077 |
| 70 | Ga0070707_100459500 | 3300005468 | Bacteria | 1234 |
| 71 | Ga0070698_100112606 | 3300005471 | Bacteria | 2686 |
| 72 | Ga0070698_100139696 | 3300005471 | Bacteria | 2374 |
| 73 | Ga0070699_100013662 | 3300005518 | Bacteria | 6986 |
| 74 | Ga0070699_100016626 | 3300005518 | Bacteria | 6315 |
| 75 | Ga0070699_100075570 | 3300005518 | Bacteria | 2932 |
| 76 | Ga0070679_100003590 | 3300005530 | Bacteria | 14189 |
| 77 | Ga0070679_100021876 | 3300005530 | Bacteria | 6246 |
| 78 | Ga0070679_100030659 | 3300005530 | Bacteria | 5311 |
| 79 | Ga0070679_100031365 | 3300005530 | Bacteria | 5249 |
| 80 | Ga0070679_100086992 | 3300005530 | Bacteria | 3112 |
| 81 | Ga0070684_100076578 | 3300005535 | Bacteria | 2953 |
| 82 | Ga0070697_100002755 | 3300005536 | Bacteria | 13535 |
| 83 | Ga0070697_100024702 | 3300005536 | Bacteria | 4786 |
| 84 | Ga0070697_100039824 | 3300005536 | Bacteria | 3801 |
| 85 | Ga0070697_100051116 | 3300005536 | Bacteria | 3357 |
| 86 | Ga0070697_100093960 | 3300005536 | Bacteria | 2484 |
| 87 | Ga0070697_100279858 | 3300005536 | Bacteria | 1431 |
| 88 | Ga0068853_100006310 | 3300005539 | Bacteria | 9408 |
| 89 | Ga0068853_100054551 | 3300005539 | Bacteria | 3445 |
| 90 | Ga0068853_100078646 | 3300005539 | Bacteria | 2883 |
| 91 | Ga0070686_100006725 | 3300005544 | Bacteria | 6398 |
| 92 | Ga0070695_100000795 | 3300005545 | Bacteria | 16980 |
| 93 | Ga0070695_100018760 | 3300005545 | Bacteria | 4203 |
| 94 | Ga0070696_100069654 | 3300005546 | Bacteria | 2472 |
| 95 | Ga0070693_100010668 | 3300005547 | Bacteria | 4607 |
| 96 | Ga0070693_100015556 | 3300005547 | Bacteria | 3919 |
| 97 | Ga0070693_100032201 | 3300005547 | Bacteria | 2881 |
| 98 | Ga0070693_100033785 | 3300005547 | Bacteria | 2826 |
| 99 | Ga0070665_100211366 | 3300005548 | Bacteria | 1941 |
| 100 | Ga0070704_100030514 | 3300005549 | Bacteria | 3613 |
| 101 | Ga0068855_100007073 | 3300005563 | Bacteria | 13610 |
| 102 | Ga0068855_100017840 | 3300005563 | Bacteria | 8530 |
| 103 | Ga0068855_100021639 | 3300005563 | Bacteria | 7714 |
| 104 | Ga0068855_100107338 | 3300005563 | Unclassified | 3208 |
| 105 | Ga0068855_100749509 | 3300005563 | Bacteria | 1041 |
| 106 | Ga0070664_100026248 | 3300005564 | Bacteria | 4830 |
| 107 | Ga0070664_100385973 | 3300005564 | Bacteria | 1279 |
| 108 | Ga0070664_100453319 | 3300005564 | Bacteria | 1178 |
| 109 | Ga0068857_100023092 | 3300005577 | Bacteria | 5471 |
| 110 | Ga0068857_100055709 | 3300005577 | Bacteria | 3508 |
| 111 | Ga0068857_100438020 | 3300005577 | Bacteria | 1221 |
| 112 | Ga0068854_100009175 | 3300005578 | Bacteria | 6380 |
| 113 | Ga0068854_100048773 | 3300005578 | Bacteria | 3022 |
| 114 | Ga0068854_100125656 | 3300005578 | Bacteria | 1953 |
| 115 | Ga0068856_100000476 | 3300005614 | Bacteria | 44310 |
| 116 | Ga0068856_100017680 | 3300005614 | Bacteria | 6912 |
| 117 | Ga0068856_100028035 | 3300005614 | Bacteria | 5495 |
| 118 | Ga0068852_100114443 | 3300005616 | Bacteria | 2458 |
| 119 | Ga0068852_100224561 | 3300005616 | Bacteria | 1788 |
| 120 | Ga0068852_100249846 | 3300005616 | Bacteria | 1699 |
| 121 | Ga0068859_100040199 | 3300005617 | Bacteria | 4695 |
| 122 | Ga0068866_10002101 | 3300005718 | Bacteria | 8288 |
| 123 | Ga0068851_10021741 | 3300005834 | Bacteria | 3116 |
| 124 | Ga0068863_100371758 | 3300005841 | Bacteria | 1395 |
| 125 | Ga0068858_100033258 | 3300005842 | Bacteria | 4787 |
| 126 | Ga0068862_100110905 | 3300005844 | Bacteria | 2408 |
| 127 | Ga0081455_10001982 | 3300005937 | Bacteria | 24463 |
| 128 | Ga0070715_10080801 | 3300006163 | Bacteria | 1475 |
| 129 | Ga0070716_100107027 | 3300006173 | Bacteria | 1726 |
| 130 | Ga0070712_100000052 | 3300006175 | Bacteria | 62524 |
| 131 | Ga0070712_100017096 | 3300006175 | Bacteria | 4690 |
| 132 | Ga0070712_100021427 | 3300006175 | Bacteria | 4244 |
| 133 | Ga0070712_100032063 | 3300006175 | Bacteria | 3546 |
| 134 | Ga0097621_100014579 | 3300006237 | Bacteria | 5888 |
| 135 | Ga0097621_100312542 | 3300006237 | Bacteria | 1390 |
| 136 | Ga0068871_100011570 | 3300006358 | Bacteria | 6474 |
| 137 | Ga0075434_100014102 | 3300006871 | Bacteria | 7632 |
| 138 | Ga0075434_100212903 | 3300006871 | Bacteria | 1952 |
| 139 | Ga0068865_100004018 | 3300006881 | Bacteria | 8836 |
| 140 | Ga0075436_100000339 | 3300006914 | Bacteria | 29854 |
| 141 | Ga0075436_100015236 | 3300006914 | Bacteria | 5265 |
| 142 | Ga0075436_100016744 | 3300006914 | Bacteria | 5017 |
| 143 | Ga0075436_100038128 | 3300006914 | Bacteria | 3318 |
| 144 | Ga0075436_100049211 | 3300006914 | Bacteria | 2908 |
| 145 | Ga0075436_100151508 | 3300006914 | Bacteria | 1632 |
| 146 | Ga0097620_100040199 | 3300006931 | Bacteria | 4695 |
| 147 | Ga0075435_100012722 | 3300007076 | Bacteria | 6235 |
| 148 | Ga0105240_10003221 | 3300009093 | Bacteria | 25561 |
| 149 | Ga0105240_10026154 | 3300009093 | Bacteria | 7658 |
| 150 | Ga0105240_10107237 | 3300009093 | Bacteria | 3387 |
| 151 | Ga0105240_10178313 | 3300009093 | Bacteria | 2510 |
| 152 | Ga0105240_10268135 | 3300009093 | Bacteria | 1967 |
| 153 | Ga0105245_10006477 | 3300009098 | Bacteria | 10296 |
| 154 | Ga0105245_10043724 | 3300009098 | Bacteria | 3996 |
| 155 | Ga0105245_10053683 | 3300009098 | Bacteria | 3617 |
| 156 | Ga0105245_10151080 | 3300009098 | Bacteria | 2196 |
| 157 | Ga0105243_10037056 | 3300009148 | Bacteria | 3787 |
| 158 | Ga0105241_10053973 | 3300009174 | Bacteria | 3075 |
| 159 | Ga0105242_10006151 | 3300009176 | Bacteria | 9251 |
| 160 | Ga0105248_10027250 | 3300009177 | Bacteria | 6359 |
| 161 | Ga0105248_10075361 | 3300009177 | Bacteria | 3792 |
| 162 | Ga0105248_10461693 | 3300009177 | Bacteria | 1431 |
| 163 | Ga0105237_10028324 | 3300009545 | Bacteria | 5707 |
| 164 | Ga0105237_10174010 | 3300009545 | Bacteria | 2153 |
| 165 | Ga0105237_10261905 | 3300009545 | Bacteria | 1732 |
| 166 | Ga0105238_10003206 | 3300009551 | Bacteria | 16334 |
| 167 | Ga0105238_10042262 | 3300009551 | Bacteria | 4616 |
| 168 | Ga0105238_10071809 | 3300009551 | Bacteria | 3459 |
| 169 | Ga0105238_10108711 | 3300009551 | Bacteria | 2754 |
| 170 | Ga0105238_10263085 | 3300009551 | Bacteria | 1705 |
| 171 | Ga0105239_10070408 | 3300010375 | Bacteria | 3842 |
| 172 | Ga0105246_10010340 | 3300011119 | Bacteria | 5770 |
| 173 | Ga0105246_10181670 | 3300011119 | Bacteria | 1620 |
| 174 | Ga0157373_10047557 | 3300013100 | Bacteria | 3060 |
| 175 | Ga0157373_10195093 | 3300013100 | Bacteria | 1427 |
| 176 | Ga0157371_10032724 | 3300013102 | Bacteria | 3740 |
| 177 | Ga0157370_10004982 | 3300013104 | Bacteria | 15030 |
| 178 | Ga0157370_10013304 | 3300013104 | Bacteria | 8477 |
| 179 | Ga0157370_10018409 | 3300013104 | Bacteria | 7027 |
| 180 | Ga0157369_10020808 | 3300013105 | Bacteria | 7332 |
| 181 | Ga0157369_10023064 | 3300013105 | Bacteria | 6936 |
| 182 | Ga0157369_10100691 | 3300013105 | Bacteria | 3080 |
| 183 | Ga0157369_10135780 | 3300013105 | Bacteria | 2604 |
| 184 | Ga0157369_10165724 | 3300013105 | Bacteria | 2331 |
| 185 | Ga0157369_10488664 | 3300013105 | Bacteria | 1274 |
| 186 | Ga0157374_10015897 | 3300013296 | Bacteria | 6611 |
| 187 | Ga0157374_10029820 | 3300013296 | Bacteria | 4947 |
| 188 | Ga0157378_10002093 | 3300013297 | Bacteria | 17823 |
| 189 | Ga0157378_10010637 | 3300013297 | Bacteria | 8040 |
| 190 | Ga0163162_10323210 | 3300013306 | Bacteria | 1675 |
| 191 | Ga0157372_10167721 | 3300013307 | Bacteria | 2539 |
| 192 | Ga0157372_10176623 | 3300013307 | Bacteria | 2472 |
| 193 | Ga0157372_10352028 | 3300013307 | Bacteria | 1716 |
| 194 | Ga0157375_10017330 | 3300013308 | Bacteria | 6498 |
| 195 | Ga0163163_10006821 | 3300014325 | Bacteria | 10017 |
| 196 | Ga0163163_10014359 | 3300014325 | Bacteria | 7281 |
| 197 | Ga0163163_10084903 | 3300014325 | Bacteria | 3173 |
| 198 | Ga0163163_10162745 | 3300014325 | Bacteria | 2277 |
| 199 | Ga0182008_10089019 | 3300014497 | Bacteria | 1521 |
| 200 | Ga0157377_10104914 | 3300014745 | Bacteria | 1690 |
| 201 | Ga0157379_10193985 | 3300014968 | Bacteria | 1835 |
| 202 | Ga0157379_10270221 | 3300014968 | Bacteria | 1546 |
| 203 | Ga0157376_10007767 | 3300014969 | Bacteria | 7689 |
| 204 | Ga0213874_10005567 | 3300021377 | Bacteria | 2942 |
| 205 | Ga0213876_10002788 | 3300021384 | Bacteria | 10179 |
| 206 | Ga0213876_10040212 | 3300021384 | Bacteria | 2469 |
| 207 | Ga0213876_10072442 | 3300021384 | Bacteria | 1820 |
| 208 | Ga0213876_10085795 | 3300021384 | Bacteria | 1666 |
| 209 | Ga0213875_10002629 | 3300021388 | Bacteria | 10642 |
| 210 | Ga0213875_10005169 | 3300021388 | Bacteria | 7057 |
| 211 | Ga0213875_10009158 | 3300021388 | Bacteria | 5026 |
| 212 | Ga0213875_10110401 | 3300021388 | Bacteria | 1284 |
| 213 | Ga0213871_10046988 | 3300021441 | Bacteria | 1173 |
| 214 | Ga0228598_1000253 | 3300024227 | Bacteria | 10348 |
| 215 | Ga0207692_10033935 | 3300025898 | Bacteria | 2467 |
| 216 | Ga0207642_10031820 | 3300025899 | Bacteria | 2214 |
| 217 | Ga0207680_10142553 | 3300025903 | Bacteria | 1590 |
| 218 | Ga0207647_10150732 | 3300025904 | Bacteria | 1359 |
| 219 | Ga0207685_10088304 | 3300025905 | Bacteria | 1299 |
| 220 | Ga0207643_10018881 | 3300025908 | Bacteria | 3777 |
| 221 | Ga0207684_10056482 | 3300025910 | Bacteria | 3330 |
| 222 | Ga0207684_10341995 | 3300025910 | Bacteria | 1288 |
| 223 | Ga0207654_10004049 | 3300025911 | Bacteria | 7380 |
| 224 | Ga0207707_10007324 | 3300025912 | Bacteria | 9612 |
| 225 | Ga0207707_10009475 | 3300025912 | Bacteria | 8444 |
| 226 | Ga0207707_10021345 | 3300025912 | Bacteria | 5661 |
| 227 | Ga0207707_10072597 | 3300025912 | Bacteria | 3000 |
| 228 | Ga0207695_10028695 | 3300025913 | Bacteria | 6161 |
| 229 | Ga0207695_10031367 | 3300025913 | Bacteria | 5829 |
| 230 | Ga0207695_10069421 | 3300025913 | Bacteria | 3605 |
| 231 | Ga0207695_10199900 | 3300025913 | Bacteria | 1913 |
| 232 | Ga0207671_10017472 | 3300025914 | Bacteria | 5528 |
| 233 | Ga0207693_10000915 | 3300025915 | Bacteria | 26473 |
| 234 | Ga0207693_10004667 | 3300025915 | Bacteria | 11545 |
| 235 | Ga0207693_10007700 | 3300025915 | Bacteria | 8842 |
| 236 | Ga0207693_10015221 | 3300025915 | Bacteria | 6173 |
| 237 | Ga0207693_10158375 | 3300025915 | Bacteria | 1781 |
| 238 | Ga0207693_10229152 | 3300025915 | Bacteria | 1459 |
| 239 | Ga0207693_10252385 | 3300025915 | Bacteria | 1384 |
| 240 | Ga0207663_10127639 | 3300025916 | Bacteria | 1752 |
| 241 | Ga0207663_10286588 | 3300025916 | Bacteria | 1225 |
| 242 | Ga0207660_10006764 | 3300025917 | Bacteria | 7423 |
| 243 | Ga0207660_10047433 | 3300025917 | Bacteria | 3037 |
| 244 | Ga0207660_10066105 | 3300025917 | Bacteria | 2615 |
| 245 | Ga0207660_10080858 | 3300025917 | Bacteria | 2387 |
| 246 | Ga0207660_10091367 | 3300025917 | Bacteria | 2258 |
| 247 | Ga0207660_10154327 | 3300025917 | Bacteria | 1766 |
| 248 | Ga0207657_10005116 | 3300025919 | Bacteria | 13739 |
| 249 | Ga0207657_10033396 | 3300025919 | Bacteria | 4639 |
| 250 | Ga0207657_10039615 | 3300025919 | Bacteria | 4185 |
| 251 | Ga0207657_10086551 | 3300025919 | Bacteria | 2622 |
| 252 | Ga0207652_10005325 | 3300025921 | Bacteria | 10432 |
| 253 | Ga0207652_10062790 | 3300025921 | Bacteria | 3211 |
| 254 | Ga0207652_10114506 | 3300025921 | Bacteria | 2395 |
| 255 | Ga0207646_10235966 | 3300025922 | Bacteria | 1652 |
| 256 | Ga0207694_10021667 | 3300025924 | Bacteria | 4870 |
| 257 | Ga0207694_10034292 | 3300025924 | Bacteria | 3891 |
| 258 | Ga0207694_10066194 | 3300025924 | Bacteria | 2818 |
| 259 | Ga0207694_10114885 | 3300025924 | Bacteria | 2144 |
| 260 | Ga0207650_10005625 | 3300025925 | Bacteria | 8560 |
| 261 | Ga0207659_10120276 | 3300025926 | Bacteria | 2012 |
| 262 | Ga0207687_10006743 | 3300025927 | Bacteria | 7567 |
| 263 | Ga0207687_10052797 | 3300025927 | Bacteria | 2838 |
| 264 | Ga0207700_10000046 | 3300025928 | Bacteria | 87971 |
| 265 | Ga0207700_10002466 | 3300025928 | Bacteria | 10612 |
| 266 | Ga0207700_10004080 | 3300025928 | Bacteria | 8561 |
| 267 | Ga0207700_10044479 | 3300025928 | Bacteria | 3270 |
| 268 | Ga0207700_10186926 | 3300025928 | Bacteria | 1738 |
| 269 | Ga0207664_10010006 | 3300025929 | Bacteria | 6683 |
| 270 | Ga0207664_10057611 | 3300025929 | Bacteria | 3089 |
| 271 | Ga0207664_10126435 | 3300025929 | Bacteria | 2147 |
| 272 | Ga0207644_10001557 | 3300025931 | Bacteria | 14800 |
| 273 | Ga0207644_10005689 | 3300025931 | Bacteria | 8115 |
| 274 | Ga0207690_10005073 | 3300025932 | Bacteria | 7777 |
| 275 | Ga0207690_10097558 | 3300025932 | Bacteria | 2092 |
| 276 | Ga0207690_10222899 | 3300025932 | Bacteria | 1444 |
| 277 | Ga0207706_10149903 | 3300025933 | Bacteria | 2051 |
| 278 | Ga0207686_10006534 | 3300025934 | Bacteria | 6279 |
| 279 | Ga0207709_10013178 | 3300025935 | Bacteria | 4561 |
| 280 | Ga0207670_10010015 | 3300025936 | Bacteria | 5439 |
| 281 | Ga0207670_10013168 | 3300025936 | Bacteria | 4868 |
| 282 | Ga0207670_10395535 | 3300025936 | Bacteria | 1104 |
| 283 | Ga0207704_10009822 | 3300025938 | Bacteria | 4635 |
| 284 | Ga0207665_10010681 | 3300025939 | Bacteria | 6031 |
| 285 | Ga0207665_10052097 | 3300025939 | Bacteria | 2757 |
| 286 | Ga0207665_10187583 | 3300025939 | Bacteria | 1501 |
| 287 | Ga0207665_10324947 | 3300025939 | Bacteria | 1155 |
| 288 | Ga0207711_10048325 | 3300025941 | Bacteria | 3640 |
| 289 | Ga0207711_10211250 | 3300025941 | Bacteria | 1772 |
| 290 | Ga0207689_10000455 | 3300025942 | Bacteria | 38509 |
| 291 | Ga0207689_10022758 | 3300025942 | Bacteria | 5264 |
| 292 | Ga0207661_10004929 | 3300025944 | Bacteria | 9358 |
| 293 | Ga0207661_10007889 | 3300025944 | Bacteria | 7587 |
| 294 | Ga0207661_10273255 | 3300025944 | Bacteria | 1508 |
| 295 | Ga0207661_10473189 | 3300025944 | Bacteria | 1143 |
| 296 | Ga0207679_10069056 | 3300025945 | Bacteria | 2657 |
| 297 | Ga0207679_10387238 | 3300025945 | Bacteria | 1227 |
| 298 | Ga0207667_10037490 | 3300025949 | Bacteria | 5181 |
| 299 | Ga0207667_10042794 | 3300025949 | Bacteria | 4812 |
| 300 | Ga0207667_10137207 | 3300025949 | Bacteria | 2518 |
| 301 | Ga0207667_10174121 | 3300025949 | Bacteria | 2211 |
| 302 | Ga0207667_10174756 | 3300025949 | Bacteria | 2207 |
| 303 | Ga0207667_10257280 | 3300025949 | Unclassified | 1785 |
| 304 | Ga0207703_10006428 | 3300026035 | Bacteria | 9392 |
| 305 | Ga0207703_10310881 | 3300026035 | Bacteria | 1440 |
| 306 | Ga0207639_10066332 | 3300026041 | Bacteria | 2805 |
| 307 | Ga0207639_10206147 | 3300026041 | Bacteria | 1689 |
| 308 | Ga0207678_10011125 | 3300026067 | Bacteria | 7905 |
| 309 | Ga0207678_10079624 | 3300026067 | Bacteria | 2805 |
| 310 | Ga0207708_10000339 | 3300026075 | Bacteria | 36860 |
| 311 | Ga0207702_10000514 | 3300026078 | Bacteria | 43618 |
| 312 | Ga0207702_10142522 | 3300026078 | Bacteria | 2170 |
| 313 | Ga0207702_10166117 | 3300026078 | Bacteria | 2019 |
| 314 | Ga0207702_10426829 | 3300026078 | Bacteria | 1283 |
| 315 | Ga0207702_10527407 | 3300026078 | Bacteria | 1153 |
| 316 | Ga0207702_10573768 | 3300026078 | Bacteria | 1105 |
| 317 | Ga0207641_10370614 | 3300026088 | Bacteria | 1369 |
| 318 | Ga0207648_10001197 | 3300026089 | Bacteria | 29072 |
| 319 | Ga0207674_10027845 | 3300026116 | Bacteria | 5971 |
| 320 | Ga0207674_10028168 | 3300026116 | Bacteria | 5934 |
| 321 | Ga0207674_10166840 | 3300026116 | Bacteria | 2156 |
| 322 | Ga0207698_10034168 | 3300026142 | Bacteria | 3704 |
| 323 | Ga0207698_10062472 | 3300026142 | Bacteria | 2909 |
| 324 | Ga0207698_10117825 | 3300026142 | Bacteria | 2241 |
| 325 | Ga0207698_10249347 | 3300026142 | Bacteria | 1623 |
| 326 | Ga0265337_1000530 | 3300028556 | Bacteria | 20270 |
| 327 | Ga0265334_10065421 | 3300028573 | Bacteria | 1363 |
| 328 | Ga0265318_10029464 | 3300028577 | Bacteria | 2140 |
| 329 | Ga0265338_10026507 | 3300028800 | Bacteria | 5842 |
| 330 | Ga0265332_10004884 | 3300031238 | Bacteria | 6233 |
| 331 | Ga0265332_10011382 | 3300031238 | Bacteria | 3954 |
| 332 | Ga0265340_10014281 | 3300031247 | Bacteria | 4153 |
| 333 | Ga0265340_10023667 | 3300031247 | Bacteria | 3130 |
| 334 | Ga0265339_10004408 | 3300031249 | Bacteria | 9606 |
| 335 | Ga0265331_10007186 | 3300031250 | Bacteria | 6470 |
| 336 | Ga0265331_10017067 | 3300031250 | Bacteria | 3795 |
| 337 | Ga0265327_10002824 | 3300031251 | Bacteria | 17539 |
| 338 | Ga0265316_10054901 | 3300031344 | Bacteria | 3118 |
| 339 | Ga0265316_10323492 | 3300031344 | Bacteria | 1120 |
| 340 | Ga0265313_10037122 | 3300031595 | Bacteria | 2439 |
| 341 | Ga0307508_10008446 | 3300031616 | Bacteria | 9512 |
| 342 | Ga0265314_10002422 | 3300031711 | Bacteria | 19127 |
| 343 | Ga0265314_10027306 | 3300031711 | Bacteria | 4275 |
| 344 | Ga0265314_10089609 | 3300031711 | Bacteria | 2006 |
| 345 | Ga0265314_10141342 | 3300031711 | Bacteria | 1488 |
| 346 | Ga0265342_10000146 | 3300031712 | Bacteria | 80151 |
| 347 | Ga0265342_10018437 | 3300031712 | Bacteria | 4520 |
| 348 | Ga0265342_10029041 | 3300031712 | Bacteria | 3437 |
| 349 | Ga0373929_0005888 | 3300035085 | Bacteria | 2214 |
| 350 | Ga0373934_0014402 | 3300035086 | Bacteria | 2997 |
| 351 | Ga0373944_0000531 | 3300035089 | Bacteria | 8954 |
| 352 | Ga0373923_0001932 | 3300035111 | Bacteria | 6202 |
| 353 | Ga0373923_0003219 | 3300035111 | Bacteria | 5193 |
| 354 | Ga0373923_0022134 | 3300035111 | Bacteria | 2489 |
| 355 | Ga0373923_0025778 | 3300035111 | Bacteria | 2333 |
| 356 | Ga0373936_0002375 | 3300035113 | Bacteria | 7045 |
| 357 | Ga0373936_0020223 | 3300035113 | Bacteria | 2585 |
| 358 | Ga0373939_0008062 | 3300035114 | Bacteria | 2575 |
| 359 | Ga0373939_0019796 | 3300035114 | Bacteria | 1820 |
| 360 | Ga0373953_0001993 | 3300035117 | Bacteria | 6066 |
| 361 | Ga0373953_0003861 | 3300035117 | Bacteria | 4717 |
| 362 | Ga0373953_0013826 | 3300035117 | Bacteria | 2891 |
| 363 | Ga0373954_0002159 | 3300035118 | Bacteria | 8162 |
| 364 | Ga0373954_0002202 | 3300035118 | Bacteria | 8099 |
| 365 | Ga0373954_0011383 | 3300035118 | Bacteria | 3941 |
| 366 | Ga0373954_0028738 | 3300035118 | Bacteria | 2557 |
| 367 | Ga0373954_0028821 | 3300035118 | Bacteria | 2554 |
| 368 | Ga0373954_0140508 | 3300035118 | Bacteria | 1178 |
| 369 | Ga0373956_0002079 | 3300035119 | Bacteria | 8298 |
| 370 | Ga0373956_0017473 | 3300035119 | Bacteria | 3024 |
| 371 | Ga0373957_0002485 | 3300035120 | Bacteria | 5276 |
| 372 | Ga0373957_0014844 | 3300035120 | Bacteria | 2669 |
| 373 | Ga0373957_0033197 | 3300035120 | Bacteria | 1906 |
| 374 | Ga0373943_0000284 | 3300035170 | Bacteria | 21002 |
| 375 | Ga0373943_0004873 | 3300035170 | Bacteria | 6067 |
| 376 | Ga0373943_0024272 | 3300035170 | Bacteria | 2826 |
| 377 | Ga0373946_0000993 | 3300035171 | Bacteria | 9723 |
| 378 | Ga0373946_0001151 | 3300035171 | Bacteria | 9144 |
| 379 | Ga0373946_0011943 | 3300035171 | Bacteria | 3246 |
| 380 | Ga0373955_0000905 | 3300035172 | Bacteria | 12753 |
| 381 | Ga0373955_0001496 | 3300035172 | Bacteria | 9955 |
| 382 | Ga0373955_0017044 | 3300035172 | Bacteria | 3586 |
| 383 | Ga0373955_0018376 | 3300035172 | Bacteria | 3476 |
| 384 | Ga0373955_0020477 | 3300035172 | Bacteria | 3326 |
| 385 | Ga0373955_0035179 | 3300035172 | Bacteria | 2651 |
| 386 | Ga0373955_0088402 | 3300035172 | Bacteria | 1762 |
| 387 | Ga0373955_0101172 | 3300035172 | Bacteria | 1655 |
| 388 | Ga0373924_0000337 | 3300035410 | Bacteria | 14377 |
| 389 | Ga0373924_0000883 | 3300035410 | Bacteria | 9450 |
| 390 | Ga0373924_0013520 | 3300035410 | Bacteria | 3068 |
| 391 | Ga0373924_0023187 | 3300035410 | Bacteria | 2432 |
| 392 | Ga0373924_0040109 | 3300035410 | Bacteria | 1915 |
| 393 | Ga0373931_0000221 | 3300035691 | Bacteria | 24293 |
| 394 | Ga0373931_0082587 | 3300035691 | Bacteria | 1777 |
| 395 | Ga0373935_0000151 | 3300035692 | Bacteria | 32024 |
| 396 | Ga0373935_0003583 | 3300035692 | Bacteria | 9049 |
| 397 | Ga0373935_0007237 | 3300035692 | Bacteria | 6630 |
| 398 | Ga0373935_0022406 | 3300035692 | Bacteria | 3873 |
| 399 | Ga0373935_0322698 | 3300035692 | Bacteria | 1096 |
| 400 | Ga0373927_0001879 | 3300035695 | Bacteria | 15535 |
| 401 | Ga0373927_0004424 | 3300035695 | Bacteria | 9842 |
| 402 | Ga0373927_0047869 | 3300035695 | Bacteria | 2765 |
| 403 | Ga0373927_0071590 | 3300035695 | Bacteria | 2244 |
| 404 | Ga0373927_0292754 | 3300035695 | Bacteria | 1071 |
| 405 | Ga0373933_0001536 | 3300035724 | Bacteria | 13495 |
| 406 | Ga0373933_0008407 | 3300035724 | Bacteria | 5636 |
| 407 | Ga0373947_0001986 | 3300035725 | Bacteria | 12521 |
| 408 | Ga0373947_0002343 | 3300035725 | Bacteria | 11453 |
| 409 | Ga0373947_0006664 | 3300035725 | Bacteria | 6701 |
| 410 | Ga0373947_0010137 | 3300035725 | Bacteria | 5410 |
| 411 | Ga0373947_0129549 | 3300035725 | Bacteria | 1609 |
| 412 | Ga0373937_0000004 | 3300036401 | Bacteria | 212269 |
| 413 | Ga0373937_0006604 | 3300036401 | Bacteria | 10017 |
| 414 | Ga0373937_0012375 | 3300036401 | Bacteria | 7503 |
| 415 | Ga0373937_0018911 | 3300036401 | Bacteria | 6159 |
| 416 | Ga0373937_0020867 | 3300036401 | Bacteria | 5875 |
| 417 | Ga0373937_0022555 | 3300036401 | Bacteria | 5662 |
| 418 | Ga0373937_0044033 | 3300036401 | Bacteria | 4076 |
| 419 | Ga0373937_0081300 | 3300036401 | Bacteria | 2997 |
| 420 | Ga0373937_0112014 | 3300036401 | Bacteria | 2538 |
| 421 | Ga0373937_0123875 | 3300036401 | Bacteria | 2410 |
| 422 | Ga0373937_0148560 | 3300036401 | Bacteria | 2195 |
| 423 | Ga0373937_0275243 | 3300036401 | Bacteria | 1589 |
| 424 | Ga0373937_0284820 | 3300036401 | Bacteria | 1561 |
| 425 | Ga0373925_0000095 | 3300037068 | Bacteria | 95071 |
| 426 | Ga0373925_0001023 | 3300037068 | Bacteria | 25318 |
| 427 | Ga0373925_0042842 | 3300037068 | Bacteria | 3358 |
| 428 | Ga0373925_0067102 | 3300037068 | Bacteria | 2705 |
| 429 | Ga0373925_0147317 | 3300037068 | Bacteria | 1846 |
| 430 | Ga0373925_0260075 | 3300037068 | Bacteria | 1394 |
| 431 | Ga0395899_0007698 | 3300037312 | Bacteria | 8305 |
| 432 | Ga0395899_0028963 | 3300037312 | Bacteria | 4167 |
| 433 | Ga0395899_0163810 | 3300037312 | Bacteria | 1569 |
| 434 | Ga0395900_0002181 | 3300037418 | Bacteria | 21880 |
| 435 | Ga0395900_0006855 | 3300037418 | Bacteria | 11819 |
| 436 | Ga0395900_0009613 | 3300037418 | Bacteria | 9916 |
| 437 | Ga0395900_0011548 | 3300037418 | Bacteria | 9037 |
| 438 | Ga0395900_0027919 | 3300037418 | Bacteria | 5780 |
| 439 | Ga0395900_0036133 | 3300037418 | Bacteria | 5091 |
| 440 | Ga0395900_0090074 | 3300037418 | Bacteria | 3153 |
| 441 | Ga0395900_0164021 | 3300037418 | Bacteria | 2265 |
| 442 | Ga0395898_0003262 | 3300037466 | Bacteria | 18232 |
| 443 | Ga0395898_0008544 | 3300037466 | Bacteria | 10818 |
| 444 | Ga0395898_0021759 | 3300037466 | Bacteria | 6498 |
| 445 | Ga0395898_0038553 | 3300037466 | Bacteria | 4735 |
| 446 | Ga0395898_0685815 | 3300037466 | Bacteria | 966 |
| 447 | Ga0395905_0062175 | 3300037471 | Bacteria | 3492 |
| 448 | Ga0436364_0229137 | 3300037853 | Bacteria | 24094 |
| 449 | Ga0436364_0329188 | 3300037853 | Bacteria | 16674 |
| 450 | Ga0436364_0488870 | 3300037853 | Bacteria | 6192 |
| 451 | Ga0436364_0491637 | 3300037853 | Bacteria | 1554 |
| 452 | Ga0436364_0560002 | 3300037853 | Bacteria | 93566 |
| 453 | Ga0436364_0787255 | 3300037853 | Bacteria | 5050 |
| 454 | Ga0436364_1279747 | 3300037853 | Bacteria | 2071 |
| 455 | Ga0436364_1329714 | 3300037853 | Bacteria | 45658 |
| 456 | Ga0436364_1358002 | 3300037853 | Bacteria | 15093 |
| 457 | Ga0395901_0004745 | 3300038443 | Bacteria | 13719 |
| 458 | Ga0395901_0007299 | 3300038443 | Bacteria | 11154 |
| 459 | Ga0395901_0013071 | 3300038443 | Bacteria | 8426 |
| 460 | Ga0395901_0029585 | 3300038443 | Bacteria | 5640 |
| 461 | Ga0395901_0031794 | 3300038443 | Bacteria | 5442 |
| 462 | Ga0395901_0158295 | 3300038443 | Bacteria | 2379 |
| 463 | Ga0395901_0576617 | 3300038443 | Bacteria | 1137 |
| 464 | Ga0395901_0586606 | 3300038443 | Bacteria | 1125 |
| 465 | Ga0436365_0190362 | 3300039437 | Bacteria | 40496 |
| 466 | Ga0436365_0249117 | 3300039437 | Bacteria | 3194 |
| 467 | Ga0436365_0260170 | 3300039437 | Bacteria | 52235 |
| 468 | Ga0436365_0695125 | 3300039437 | Bacteria | 1700 |
| 469 | Ga0436365_1165568 | 3300039437 | Bacteria | 4030 |
| 470 | Ga0436365_1183719 | 3300039437 | Bacteria | 1586 |
| 471 | Ga0436365_1291261 | 3300039437 | Bacteria | 2572 |
| 472 | Ga0436365_1751993 | 3300039437 | Bacteria | 7810 |
| 473 | Ga0436360_0265283 | 3300039438 | Bacteria | 2027 |
| 474 | Ga0436360_0651368 | 3300039438 | Bacteria | 1434 |
| 475 | Ga0436360_0676867 | 3300039438 | Bacteria | 2655 |
| 476 | Ga0436360_1161538 | 3300039438 | Bacteria | 1446 |
| 477 | Ga0436361_0400746 | 3300039447 | Bacteria | 2049 |
| 478 | Ga0436361_0520146 | 3300039447 | Bacteria | 1203 |
| 479 | Ga0436361_0522444 | 3300039447 | Bacteria | 5116 |
| 480 | Ga0436361_0666081 | 3300039447 | Bacteria | 2357 |
| 481 | Ga0436361_1113862 | 3300039447 | Bacteria | 3899 |
| 482 | Ga0436363_0101257 | 3300039450 | Bacteria | 950 |
| 483 | Ga0436363_0242104 | 3300039450 | Bacteria | 5179 |
| 484 | Ga0436363_0621480 | 3300039450 | Bacteria | 4834 |
| 485 | Ga0436363_0981994 | 3300039450 | Bacteria | 1199 |
| 486 | Ga0436362_0204855 | 3300039453 | Bacteria | 17349 |
| 487 | Ga0436362_0381210 | 3300039453 | Bacteria | 4420 |
| 488 | Ga0436362_0799354 | 3300039453 | Bacteria | 965 |
| 489 | Ga0436362_0849335 | 3300039453 | Bacteria | 1777 |
| 490 | Ga0466963_0008212 | 3300044694 | Bacteria | 6256 |
| 491 | Ga0466971_0018688 | 3300044719 | Bacteria | 3073 |
| 492 | Ga0466957_0094565 | 3300044842 | Bacteria | 1877 |
| 493 | Ga0466959_0033591 | 3300045049 | Bacteria | 3794 |
| 494 | Ga0466958_0288292 | 3300045836 | Bacteria | 1053 |
| 495 | Ga0466958_0355593 | 3300045836 | Bacteria | 943 |
| 496 | Ga0466967_0038711 | 3300045976 | Bacteria | 4092 |
| 497 | Ga0466967_0043726 | 3300045976 | Bacteria | 3880 |
| 498 | Ga0495592_0000029 | 3300046454 | Bacteria | 131879 |
| 499 | Ga0495592_0002830 | 3300046454 | Bacteria | 12307 |
| 500 | Ga0495592_0036029 | 3300046454 | Bacteria | 3727 |
| 501 | Ga0495592_0094362 | 3300046454 | Bacteria | 2141 |
| 502 | Ga0495603_0000351 | 3300046455 | Bacteria | 24737 |
| 503 | Ga0495603_0030176 | 3300046455 | Bacteria | 3267 |
| 504 | Ga0495603_0140742 | 3300046455 | Bacteria | 1403 |
| 505 | Ga0495629_0000114 | 3300046459 | Bacteria | 72778 |
| 506 | Ga0495629_0000250 | 3300046459 | Bacteria | 46648 |
| 507 | Ga0495629_0007749 | 3300046459 | Bacteria | 7901 |
| 508 | Ga0495629_0008760 | 3300046459 | Bacteria | 7439 |
| 509 | Ga0495629_0235439 | 3300046459 | Bacteria | 1261 |
| 510 | Ga0495641_0014632 | 3300046461 | Bacteria | 4236 |
| 511 | Ga0495641_0044042 | 3300046461 | Bacteria | 2061 |
| 512 | Ga0495651_0001409 | 3300046462 | Bacteria | 18662 |
| 513 | Ga0495651_0011379 | 3300046462 | Bacteria | 6836 |
| 514 | Ga0495651_0013315 | 3300046462 | Bacteria | 6362 |
| 515 | Ga0495651_0034944 | 3300046462 | Bacteria | 3916 |
| 516 | Ga0495651_0132999 | 3300046462 | Bacteria | 1814 |
| 517 | Ga0495653_0000012 | 3300046463 | Bacteria | 266880 |
| 518 | Ga0495653_0014914 | 3300046463 | Bacteria | 6339 |
| 519 | Ga0495653_0044307 | 3300046463 | Bacteria | 3453 |
| 520 | Ga0495653_0046364 | 3300046463 | Bacteria | 3366 |
| 521 | Ga0495653_0077552 | 3300046463 | Bacteria | 2467 |
| 522 | Ga0495653_0231853 | 3300046463 | Bacteria | 1235 |
| 523 | Ga0495580_0000536 | 3300046472 | Bacteria | 32045 |
| 524 | Ga0495580_0007433 | 3300046472 | Bacteria | 8807 |
| 525 | Ga0495580_0017120 | 3300046472 | Bacteria | 5427 |
| 526 | Ga0495580_0034346 | 3300046472 | Bacteria | 3651 |
| 527 | Ga0495580_0128352 | 3300046472 | Bacteria | 1760 |
| 528 | Ga0495582_0000021 | 3300046473 | Bacteria | 88264 |
| 529 | Ga0495582_0017363 | 3300046473 | Bacteria | 3938 |
| 530 | Ga0495582_0124859 | 3300046473 | Bacteria | 1452 |
| 531 | Ga0495582_0135615 | 3300046473 | Bacteria | 1393 |
| 532 | Ga0495582_0155844 | 3300046473 | Bacteria | 1298 |
| 533 | Ga0495582_0184182 | 3300046473 | Bacteria | 1190 |
| 534 | Ga0495639_0000030 | 3300046475 | Bacteria | 65832 |
| 535 | Ga0495639_0004330 | 3300046475 | Bacteria | 6089 |
| 536 | Ga0495639_0006366 | 3300046475 | Bacteria | 5075 |
| 537 | Ga0495639_0065199 | 3300046475 | Bacteria | 1675 |
| 538 | Ga0495662_0000399 | 3300046476 | Bacteria | 19430 |
| 539 | Ga0495662_0015082 | 3300046476 | Bacteria | 3755 |
| 540 | Ga0495662_0015742 | 3300046476 | Bacteria | 3670 |
| 541 | Ga0495664_0000004 | 3300046477 | Bacteria | 489411 |
| 542 | Ga0495664_0014315 | 3300046477 | Bacteria | 4494 |
| 543 | Ga0495664_0016703 | 3300046477 | Bacteria | 4186 |
| 544 | Ga0495664_0027914 | 3300046477 | Bacteria | 3293 |
| 545 | Ga0495594_0000153 | 3300046499 | Bacteria | 32752 |
| 546 | Ga0495608_0000017 | 3300046511 | Bacteria | 192929 |
| 547 | Ga0495608_0001813 | 3300046511 | Bacteria | 15258 |
| 548 | Ga0495608_0015230 | 3300046511 | Bacteria | 5335 |
| 549 | Ga0495608_0071822 | 3300046511 | Bacteria | 2258 |
| 550 | Ga0495618_0000006 | 3300046514 | Bacteria | 229906 |
| 551 | Ga0495618_0008025 | 3300046514 | Bacteria | 6392 |
| 552 | Ga0495618_0010523 | 3300046514 | Bacteria | 5596 |
| 553 | Ga0495618_0044730 | 3300046514 | Bacteria | 2792 |
| 554 | Ga0495618_0052683 | 3300046514 | Bacteria | 2572 |
| 555 | Ga0495618_0139890 | 3300046514 | Bacteria | 1549 |
| 556 | Ga0495628_0000001 | 3300046516 | Bacteria | 917742 |
| 557 | Ga0495628_0005957 | 3300046516 | Bacteria | 10669 |
| 558 | Ga0495628_0039395 | 3300046516 | Bacteria | 3780 |
| 559 | Ga0495628_0057268 | 3300046516 | Bacteria | 3066 |
| 560 | Ga0495628_0072036 | 3300046516 | Bacteria | 2693 |
| 561 | Ga0495628_0104120 | 3300046516 | Bacteria | 2188 |
| 562 | Ga0495630_0000947 | 3300046517 | Bacteria | 20279 |
| 563 | Ga0495630_0010492 | 3300046517 | Bacteria | 6692 |
| 564 | Ga0495630_0010876 | 3300046517 | Bacteria | 6572 |
| 565 | Ga0495630_0025912 | 3300046517 | Bacteria | 4339 |
| 566 | Ga0495630_0093130 | 3300046517 | Bacteria | 2277 |
| 567 | Ga0495666_0004324 | 3300046526 | Bacteria | 7172 |
| 568 | Ga0495666_0011108 | 3300046526 | Bacteria | 4494 |
| 569 | Ga0495666_0033401 | 3300046526 | Bacteria | 2513 |
| 570 | Ga0495652_0000002 | 3300046529 | Bacteria | 946606 |
| 571 | Ga0495652_0021969 | 3300046529 | Bacteria | 5670 |
| 572 | Ga0495652_0059141 | 3300046529 | Bacteria | 3243 |
| 573 | Ga0495652_0108045 | 3300046529 | Bacteria | 2243 |
| 574 | Ga0495652_0121005 | 3300046529 | Bacteria | 2088 |
| 575 | Ga0495652_0165827 | 3300046529 | Bacteria | 1710 |
| 576 | Ga0495652_0170400 | 3300046529 | Bacteria | 1681 |
| 577 | Ga0495665_0000932 | 3300046531 | Bacteria | 15431 |
| 578 | Ga0495665_0002715 | 3300046531 | Bacteria | 9547 |
| 579 | Ga0495640_0000001 | 3300046533 | Bacteria | 853827 |
| 580 | Ga0495640_0002049 | 3300046533 | Bacteria | 16077 |
| 581 | Ga0495640_0005128 | 3300046533 | Bacteria | 10411 |
| 582 | Ga0495640_0024012 | 3300046533 | Bacteria | 4435 |
| 583 | Ga0495640_0025921 | 3300046533 | Bacteria | 4245 |
| 584 | Ga0495640_0193816 | 3300046533 | Bacteria | 1291 |
| 585 | Ga0495640_0198621 | 3300046533 | Bacteria | 1272 |
| 586 | Ga0495586_0148045 | 3300046535 | Bacteria | 1320 |
| 587 | Ga0495587_0000008 | 3300046536 | Bacteria | 271097 |
| 588 | Ga0495587_0026279 | 3300046536 | Bacteria | 3550 |
| 589 | Ga0495587_0050833 | 3300046536 | Bacteria | 2452 |
| 590 | Ga0495645_0000002 | 3300046543 | Bacteria | 651644 |
| 591 | Ga0495645_0033979 | 3300046543 | Bacteria | 3720 |
| 592 | Ga0495645_0037821 | 3300046543 | Bacteria | 3518 |
| 593 | Ga0495645_0042361 | 3300046543 | Bacteria | 3319 |
| 594 | Ga0495645_0043171 | 3300046543 | Bacteria | 3289 |
| 595 | Ga0495645_0064325 | 3300046543 | Bacteria | 2654 |
| 596 | Ga0495667_0000029 | 3300046559 | Bacteria | 151568 |
| 597 | Ga0495667_0011318 | 3300046559 | Bacteria | 6039 |
| 598 | Ga0495667_0017281 | 3300046559 | Bacteria | 4873 |
| 599 | Ga0495667_0018573 | 3300046559 | Bacteria | 4695 |
| 600 | Ga0495667_0086148 | 3300046559 | Bacteria | 2038 |
| 601 | Ga0495667_0093541 | 3300046559 | Bacteria | 1946 |
| 602 | Ga0495667_0193704 | 3300046559 | Bacteria | 1302 |
| 603 | Ga0495634_0000082 | 3300046642 | Bacteria | 74301 |
| 604 | Ga0495634_0001430 | 3300046642 | Bacteria | 21294 |
| 605 | Ga0495634_0005270 | 3300046642 | Bacteria | 9987 |
| 606 | Ga0495634_0010234 | 3300046642 | Bacteria | 6876 |
| 607 | Ga0495634_0011129 | 3300046642 | Bacteria | 6562 |
| 608 | Ga0495634_0013859 | 3300046642 | Bacteria | 5825 |
| 609 | Ga0495634_0029017 | 3300046642 | Bacteria | 3834 |
| 610 | Ga0495635_0000002 | 3300046663 | Bacteria | 490490 |
| 611 | Ga0495635_0001998 | 3300046663 | Bacteria | 13860 |
| 612 | Ga0495635_0005162 | 3300046663 | Bacteria | 9090 |
| 613 | Ga0495635_0007995 | 3300046663 | Bacteria | 7391 |
| 614 | Ga0495635_0019846 | 3300046663 | Bacteria | 4683 |
| 615 | Ga0495635_0029696 | 3300046663 | Bacteria | 3802 |
| 616 | Ga0495588_0000909 | 3300046674 | Bacteria | 12964 |
| 617 | Ga0495588_0073670 | 3300046674 | Bacteria | 1778 |
| 618 | Ga0495657_0000459 | 3300046675 | Bacteria | 38116 |
| 619 | Ga0495657_0002559 | 3300046675 | Bacteria | 15255 |
| 620 | Ga0495657_0026469 | 3300046675 | Bacteria | 4107 |
| 621 | Ga0495657_0121297 | 3300046675 | Bacteria | 1646 |
| 622 | Ga0495657_0126955 | 3300046675 | Bacteria | 1601 |
| 623 | Ga0495599_0000104 | 3300046678 | Bacteria | 59442 |
| 624 | Ga0495599_0000489 | 3300046678 | Bacteria | 22608 |
| 625 | Ga0495599_0012063 | 3300046678 | Bacteria | 5318 |
| 626 | Ga0495599_0032058 | 3300046678 | Bacteria | 3298 |
| 627 | Ga0495599_0058365 | 3300046678 | Bacteria | 2414 |
| 628 | Ga0495599_0138546 | 3300046678 | Bacteria | 1510 |
| 629 | Ga0495623_0000691 | 3300046679 | Bacteria | 22400 |
| 630 | Ga0495623_0014206 | 3300046679 | Bacteria | 5157 |
| 631 | Ga0495623_0033849 | 3300046679 | Bacteria | 3278 |
| 632 | Ga0495623_0080930 | 3300046679 | Bacteria | 2010 |
| 633 | Ga0495623_0170233 | 3300046679 | Bacteria | 1273 |
| 634 | Ga0495646_0000064 | 3300046680 | Bacteria | 50992 |
| 635 | Ga0495646_0020683 | 3300046680 | Bacteria | 4164 |
| 636 | Ga0495646_0044324 | 3300046680 | Bacteria | 2720 |
| 637 | Ga0495646_0056609 | 3300046680 | Bacteria | 2350 |
| 638 | Ga0495646_0193707 | 3300046680 | Bacteria | 1110 |
| 639 | Ga0495647_0000795 | 3300046681 | Bacteria | 9413 |
| 640 | Ga0495647_0033717 | 3300046681 | Bacteria | 1914 |
| 641 | Ga0495658_0000400 | 3300046683 | Bacteria | 24322 |
| 642 | Ga0495658_0016799 | 3300046683 | Bacteria | 3771 |
| 643 | Ga0495613_0001829 | 3300046689 | Bacteria | 16164 |
| 644 | Ga0495613_0005697 | 3300046689 | Bacteria | 9338 |
| 645 | Ga0495613_0006515 | 3300046689 | Bacteria | 8724 |
| 646 | Ga0495613_0044590 | 3300046689 | Bacteria | 3280 |
| 647 | Ga0495613_0053163 | 3300046689 | Bacteria | 2981 |
| 648 | Ga0495613_0346844 | 3300046689 | Bacteria | 1020 |
| 649 | Ga0495624_0000736 | 3300046690 | Bacteria | 25747 |
| 650 | Ga0495624_0004952 | 3300046690 | Bacteria | 9655 |
| 651 | Ga0495624_0040306 | 3300046690 | Bacteria | 2991 |
| 652 | Ga0495600_0000010 | 3300046809 | Bacteria | 143675 |
| 653 | Ga0495600_0000883 | 3300046809 | Bacteria | 16030 |
| 654 | Ga0495600_0040429 | 3300046809 | Bacteria | 3037 |
| 655 | Ga0495600_0061453 | 3300046809 | Bacteria | 2454 |
| 656 | Ga0495600_0068193 | 3300046809 | Bacteria | 2324 |
| 657 | Ga0495600_0125121 | 3300046809 | Bacteria | 1672 |
| 658 | Ga0495581_0000047 | 3300047315 | Bacteria | 45397 |
| 659 | Ga0495581_0009913 | 3300047315 | Bacteria | 5512 |
| 660 | Ga0495604_0000009 | 3300047317 | Bacteria | 326341 |
| 661 | Ga0495604_0009813 | 3300047317 | Bacteria | 7573 |
| 662 | Ga0495604_0025971 | 3300047317 | Bacteria | 4665 |
| 663 | Ga0495604_0041003 | 3300047317 | Bacteria | 3632 |
| 664 | Ga0495604_0069786 | 3300047317 | Bacteria | 2663 |
| 665 | Ga0495674_0000002 | 3300047319 | Bacteria | 642785 |
| 666 | Ga0495674_0000101 | 3300047319 | Bacteria | 62646 |
| 667 | Ga0495674_0013127 | 3300047319 | Bacteria | 7790 |
| 668 | Ga0495674_0056323 | 3300047319 | Bacteria | 3443 |
| 669 | Ga0495674_0075005 | 3300047319 | Bacteria | 2911 |
| 670 | Ga0495674_0133075 | 3300047319 | Bacteria | 2094 |
| 671 | Ga0495676_0010355 | 3300047321 | Bacteria | 8457 |
| 672 | Ga0495680_0000752 | 3300047322 | Bacteria | 36296 |
| 673 | Ga0495680_0000944 | 3300047322 | Bacteria | 32310 |
| 674 | Ga0495680_0032024 | 3300047322 | Bacteria | 4272 |
| 675 | Ga0495680_0037213 | 3300047322 | Bacteria | 3899 |
| 676 | Ga0495680_0043785 | 3300047322 | Bacteria | 3542 |
| 677 | Ga0495675_0000517 | 3300047444 | Bacteria | 25028 |
| 678 | Ga0495675_0010392 | 3300047444 | Bacteria | 5817 |
| 679 | Ga0495675_0033606 | 3300047444 | Bacteria | 3273 |
| 680 | Ga0495675_0273268 | 3300047444 | Bacteria | 1009 |
| 681 | Ga0495684_0000006 | 3300047471 | Bacteria | 247568 |
| 682 | Ga0495684_0000841 | 3300047471 | Bacteria | 24812 |
| 683 | Ga0495684_0007035 | 3300047471 | Bacteria | 8740 |
| 684 | Ga0495684_0028735 | 3300047471 | Bacteria | 4269 |
| 685 | Ga0495593_0000483 | 3300047673 | Bacteria | 22411 |
| 686 | Ga0495593_0003430 | 3300047673 | Bacteria | 9490 |
| 687 | Ga0495593_0013064 | 3300047673 | Bacteria | 4741 |
| 688 | Ga0495593_0034416 | 3300047673 | Bacteria | 2756 |
| 689 | Ga0495593_0076280 | 3300047673 | Bacteria | 1737 |
| 690 | Ga0495593_0083331 | 3300047673 | Bacteria | 1652 |
| 691 | Ga0495593_0100680 | 3300047673 | Bacteria | 1482 |
| 692 | Ga0495602_0000005 | 3300048088 | Bacteria | 325957 |
| 693 | Ga0495602_0013081 | 3300048088 | Bacteria | 8486 |
| 694 | Ga0495602_0054210 | 3300048088 | Bacteria | 3542 |
| 695 | Ga0495602_0200878 | 3300048088 | Bacteria | 1521 |
| 696 | Ga0496100_0094960 | 3300048903 | Bacteria | 2043 |
| 697 | Ga0496100_0117948 | 3300048903 | Bacteria | 1853 |
| 698 | Ga0496101_0026338 | 3300048904 | Bacteria | 4043 |
| 699 | Ga0496101_0131617 | 3300048904 | Bacteria | 1900 |
| 700 | Ga0496101_0327935 | 3300048904 | Bacteria | 1201 |
| 701 | Ga0496102_0005663 | 3300048905 | Bacteria | 10606 |
| 702 | Ga0496102_0024139 | 3300048905 | Bacteria | 5404 |
| 703 | Ga0496102_0041542 | 3300048905 | Bacteria | 4164 |
| 704 | Ga0496102_0042326 | 3300048905 | Bacteria | 4127 |
| 705 | Ga0496102_0063150 | 3300048905 | Bacteria | 3391 |
| 706 | Ga0496103_0058010 | 3300048906 | Bacteria | 2405 |
| 707 | Ga0496104_0000948 | 3300048907 | Bacteria | 24943 |
| 708 | Ga0496104_0006356 | 3300048907 | Bacteria | 10393 |
| 709 | Ga0496104_0009285 | 3300048907 | Bacteria | 8746 |
| 710 | Ga0496104_0014451 | 3300048907 | Bacteria | 7131 |
| 711 | Ga0496104_0038722 | 3300048907 | Bacteria | 4462 |
| 712 | Ga0496104_0068699 | 3300048907 | Bacteria | 3367 |
| 713 | Ga0496104_0089315 | 3300048907 | Bacteria | 2944 |
| 714 | Ga0496105_0007104 | 3300048908 | Bacteria | 8637 |
| 715 | Ga0496105_0014038 | 3300048908 | Bacteria | 6373 |
| 716 | Ga0496105_0033884 | 3300048908 | Bacteria | 4197 |
| 717 | Ga0496106_0014200 | 3300048909 | Bacteria | 5881 |
| 718 | Ga0496106_0062041 | 3300048909 | Bacteria | 2838 |
| 719 | Ga0496106_0087261 | 3300048909 | Bacteria | 2404 |
| 720 | Ga0496106_0225607 | 3300048909 | Bacteria | 1495 |
| 721 | Ga0496106_0284735 | 3300048909 | Bacteria | 1324 |
| 722 | Ga0496107_0032136 | 3300048910 | Bacteria | 3750 |
| 723 | Ga0496107_0080409 | 3300048910 | Bacteria | 2377 |
| 724 | Ga0496108_0000479 | 3300048911 | Bacteria | 32030 |
| 725 | Ga0496108_0001334 | 3300048911 | Bacteria | 19392 |
| 726 | Ga0496108_0012829 | 3300048911 | Bacteria | 6823 |
| 727 | Ga0496108_0024393 | 3300048911 | Bacteria | 4979 |
| 728 | Ga0496108_0099668 | 3300048911 | Bacteria | 2477 |
| 729 | Ga0496109_0000469 | 3300048912 | Bacteria | 34339 |
| 730 | Ga0496109_0006681 | 3300048912 | Bacteria | 9711 |
| 731 | Ga0496109_0009376 | 3300048912 | Bacteria | 8339 |
| 732 | Ga0496109_0018409 | 3300048912 | Bacteria | 6136 |
| 733 | Ga0496109_0020910 | 3300048912 | Bacteria | 5784 |
| 734 | Ga0496109_0073852 | 3300048912 | Bacteria | 3134 |
| 735 | Ga0496110_0001819 | 3300048913 | Bacteria | 15723 |
| 736 | Ga0496110_0011940 | 3300048913 | Bacteria | 7135 |
| 737 | Ga0496110_0050354 | 3300048913 | Bacteria | 3657 |
| 738 | Ga0496110_0620561 | 3300048913 | Bacteria | 980 |
| 739 | Ga0496111_0000112 | 3300048914 | Bacteria | 35886 |
| 740 | Ga0496111_0021445 | 3300048914 | Bacteria | 4511 |
| 741 | Ga0496111_0040428 | 3300048914 | Bacteria | 3345 |
| 742 | Ga0496111_0074297 | 3300048914 | Bacteria | 2476 |
| 743 | Ga0496112_0000979 | 3300048915 | Bacteria | 20836 |
| 744 | Ga0496112_0005973 | 3300048915 | Bacteria | 10623 |
| 745 | Ga0496112_0036769 | 3300048915 | Bacteria | 4777 |
| 746 | Ga0496112_0044005 | 3300048915 | Bacteria | 4372 |
| 747 | Ga0496112_0050774 | 3300048915 | Bacteria | 4067 |
| 748 | Ga0496112_0060945 | 3300048915 | Bacteria | 3718 |
| 749 | Ga0496112_0536080 | 3300048915 | Bacteria | 1105 |
| 750 | Ga0496113_0010030 | 3300048916 | Bacteria | 6247 |
| 751 | Ga0496113_0015988 | 3300048916 | Bacteria | 5175 |
| 752 | Ga0496113_0033714 | 3300048916 | Bacteria | 3731 |
| 753 | Ga0496113_0033748 | 3300048916 | Bacteria | 3729 |
| 754 | Ga0496113_0036503 | 3300048916 | Bacteria | 3602 |
| 755 | Ga0496113_0072730 | 3300048916 | Bacteria | 2617 |
| 756 | Ga0496115_0037865 | 3300048918 | Bacteria | 3824 |
| 757 | Ga0496115_0080961 | 3300048918 | Bacteria | 2644 |
| 758 | Ga0496115_0170174 | 3300048918 | Bacteria | 1802 |
| 759 | Ga0496115_0215224 | 3300048918 | Bacteria | 1586 |
| 760 | Ga0496121_0008649 | 3300048924 | Bacteria | 11906 |
| 761 | Ga0496126_0009299 | 3300048929 | Bacteria | 10467 |
| 762 | Ga0496126_0032055 | 3300048929 | Bacteria | 4956 |
| 763 | Ga0496126_0087662 | 3300048929 | Bacteria | 2743 |
| 764 | Ga0496126_0115195 | 3300048929 | Bacteria | 2338 |
| 765 | Ga0496126_0123675 | 3300048929 | Bacteria | 2241 |
| 766 | Ga0496126_0281038 | 3300048929 | Bacteria | 1379 |
| 767 | Ga0501038_0146473 | 3300049574 | Bacteria | 1928 |
| 768 | nmdc:mga0n895_12310_c1 | 3300050512 | Bacteria | 7669 |
| 769 | nmdc:mga0n895_31651_c1 | 3300050512 | Bacteria | 5068 |
| 770 | nmdc:mga0rr50_19152_c1 | 3300050513 | Bacteria | 4613 |
| 771 | nmdc:mga0rr50_258829_c1 | 3300050513 | Bacteria | 1447 |
| 772 | nmdc:mga0rr50_9008_c1 | 3300050513 | Bacteria | 6244 |
| 773 | nmdc:mga08x19_240455_c1 | 3300050514 | Bacteria | 1248 |
| 774 | nmdc:mga08x19_24_c1 | 3300050514 | Bacteria | 245940 |
| 775 | nmdc:mga08x19_4788_c1 | 3300050514 | Bacteria | 8022 |
| 776 | Ga0495601_0000002 | 3300053077 | Bacteria | 528704 |
| 777 | Ga0495601_0003938 | 3300053077 | Bacteria | 8547 |
| 778 | Ga0495601_0014584 | 3300053077 | Bacteria | 4736 |
| 779 | Ga0495601_0019493 | 3300053077 | Bacteria | 4137 |
| 780 | Ga0495601_0019874 | 3300053077 | Bacteria | 4099 |
| 781 | Ga0495601_0020996 | 3300053077 | Bacteria | 3993 |
| 782 | Ga0495601_0051588 | 3300053077 | Bacteria | 2596 |
| 783 | Ga0495601_0197037 | 3300053077 | Bacteria | 1317 |
| 784 | Ga0495612_0000010 | 3300053078 | Bacteria | 227618 |
| 785 | Ga0495612_0013146 | 3300053078 | Bacteria | 3333 |
| 786 | Ga0495612_0024650 | 3300053078 | Bacteria | 2415 |
| 787 | Ga0495612_0028435 | 3300053078 | Bacteria | 2251 |
| 788 | Ga0495612_0048112 | 3300053078 | Bacteria | 1748 |
| 789 | Ga0495612_0097979 | 3300053078 | Bacteria | 1246 |
| 790 | Ga0495612_0163553 | 3300053078 | Bacteria | 972 |
| 791 | Ga0500635_0002728 | 3300053080 | Bacteria | 4382 |
| 792 | Ga0495595_0001077 | 3300053084 | Bacteria | 10556 |
| 793 | Ga0495595_0002209 | 3300053084 | Bacteria | 7564 |
| 794 | Ga0495595_0003156 | 3300053084 | Bacteria | 6537 |
| 795 | Ga0495595_0015693 | 3300053084 | Bacteria | 3232 |
| 796 | Ga0495595_0050818 | 3300053084 | Bacteria | 1921 |
| 797 | Ga0495595_0124433 | 3300053084 | Bacteria | 1257 |
| 798 | Ga0495619_0000019 | 3300053085 | Bacteria | 209518 |
| 799 | Ga0495619_0001975 | 3300053085 | Bacteria | 13675 |
| 800 | Ga0495619_0004698 | 3300053085 | Bacteria | 8703 |
| 801 | Ga0495619_0005347 | 3300053085 | Bacteria | 8128 |
| 802 | Ga0495619_0005973 | 3300053085 | Bacteria | 7709 |
| 803 | Ga0495619_0010245 | 3300053085 | Bacteria | 5902 |
| 804 | Ga0495619_0017762 | 3300053085 | Bacteria | 4507 |
| 805 | Ga0495619_0021717 | 3300053085 | Bacteria | 4101 |
| 806 | Ga0495619_0076522 | 3300053085 | Bacteria | 2247 |
| 807 | Ga0495619_0094576 | 3300053085 | Bacteria | 2027 |
| 808 | Ga0495619_0101361 | 3300053085 | Bacteria | 1960 |
| 809 | Ga0500554_004224 | 3300053102 | Bacteria | 3024 |
| 810 | Ga0500603_000117 | 3300053150 | Bacteria | 18585 |
| 811 | Ga0500637_0005039 | 3300053178 | Bacteria | 6357 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046689 | Ga0495613_0346844 | Ga0495613_0346844_15_830 | 254 |
| 2 | 3300045836 | Ga0466958_0355593 | Ga0466958_0355593_115_933 | 257 |
| 3 | 3300046461 | Ga0495641_0044042 | Ga0495641_0044042_1195_2031 | 258 |
| 4 | 3300053078 | Ga0495612_0163553 | Ga0495612_0163553_108_947 | 259 |
| 5 | 3300037068 | Ga0373925_0147317 | Ga0373925_0147317_30_911 | 271 |
| 6 | 3300037466 | Ga0395898_0685815 | Ga0395898_0685815_12_890 | 273 |
| 7 | 3300046516 | Ga0495628_0104120 | Ga0495628_0104120_34_915 | 273 |
| 8 | 3300047673 | Ga0495593_0083331 | Ga0495593_0083331_34_915 | 273 |
| 9 | 3300047673 | Ga0495593_0100680 | Ga0495593_0100680_19_897 | 274 |
| 10 | 3300048913 | Ga0496110_0620561 | Ga0496110_0620561_75_953 | 274 |
| 11 | 3300053084 | Ga0495595_0050818 | Ga0495595_0050818_60_944 | 274 |
| 12 | 3300035086 | Ga0373934_0014402 | Ga0373934_0014402_2098_2976 | 275 |
| 13 | 3300035114 | Ga0373939_0019796 | Ga0373939_0019796_21_899 | 275 |
| 14 | 3300035118 | Ga0373954_0140508 | Ga0373954_0140508_143_1072 | 275 |
| 15 | 3300039450 | Ga0436363_0101257 | Ga0436363_0101257_33_911 | 275 |
| 16 | 3300047444 | Ga0495675_0273268 | Ga0495675_0273268_39_920 | 275 |
| 17 | 3300053078 | Ga0495612_0013146 | Ga0495612_0013146_21_899 | 275 |
| 18 | 3300045836 | Ga0466958_0288292 | Ga0466958_0288292_18_896 | 276 |
| 19 | 3300039453 | Ga0436362_0799354 | Ga0436362_0799354_56_937 | 277 |
| 20 | 3300036401 | Ga0373937_0123875 | Ga0373937_0123875_856_1815 | 278 |
| 21 | 3300005563 | Ga0068855_100107338 | Ga0068855_1001073383 | 283 |
| 22 | 3300025949 | Ga0207667_10257280 | Ga0207667_102572802 | 283 |
| 23 | 3300026067 | Ga0207678_10011125 | Ga0207678_100111254 | 283 |
| 24 | 3300035410 | Ga0373924_0000883 | Ga0373924_0000883_8269_9228 | 285 |
| 25 | 3300046543 | Ga0495645_0043171 | Ga0495645_0043171_490_1407 | 285 |
| 26 | 3300039438 | Ga0436360_0676867 | Ga0436360_0676867_783_1703 | 287 |
| 27 | 3300048915 | Ga0496112_0536080 | Ga0496112_0536080_126_1079 | 288 |
| 28 | 3300005458 | Ga0070681_10104231 | Ga0070681_101042312 | 290 |
| 29 | 3300025916 | Ga0207663_10286588 | Ga0207663_102865882 | 290 |
| 30 | 3300025939 | Ga0207665_10324947 | Ga0207665_103249471 | 290 |
| 31 | 3300046472 | Ga0495580_0128352 | Ga0495580_0128352_399_1340 | 290 |
| 32 | 3300005436 | Ga0070713_100162467 | Ga0070713_1001624672 | 291 |
| 33 | 3300006175 | Ga0070712_100017096 | Ga0070712_1000170962 | 291 |
| 34 | 3300025915 | Ga0207693_10007700 | Ga0207693_100077007 | 291 |
| 35 | 3300035692 | Ga0373935_0322698 | Ga0373935_0322698_126_1052 | 291 |
| 36 | 3300036401 | Ga0373937_0012375 | Ga0373937_0012375_5214_6140 | 291 |
| 37 | 3300037418 | Ga0395900_0006855 | Ga0395900_0006855_382_1362 | 291 |
| 38 | 3300037466 | Ga0395898_0003262 | Ga0395898_0003262_6414_7394 | 291 |
| 39 | 3300037471 | Ga0395905_0062175 | Ga0395905_0062175_1845_2825 | 291 |
| 40 | 3300037853 | Ga0436364_0491637 | Ga0436364_0491637_43_975 | 291 |
| 41 | 3300038443 | Ga0395901_0029585 | Ga0395901_0029585_3421_4401 | 291 |
| 42 | 3300039437 | Ga0436365_1751993 | Ga0436365_1751993_2227_3177 | 291 |
| 43 | 3300039438 | Ga0436360_0265283 | Ga0436360_0265283_729_1712 | 291 |
| 44 | 3300046543 | Ga0495645_0042361 | Ga0495645_0042361_14_943 | 291 |
| 45 | 3300046543 | Ga0495645_0064325 | Ga0495645_0064325_338_1273 | 291 |
| 46 | 3300046559 | Ga0495667_0193704 | Ga0495667_0193704_339_1265 | 291 |
| 47 | 3300005458 | Ga0070681_10011984 | Ga0070681_100119848 | 292 |
| 48 | 3300013104 | Ga0157370_10013304 | Ga0157370_100133044 | 292 |
| 49 | 3300025917 | Ga0207660_10066105 | Ga0207660_100661053 | 292 |
| 50 | 3300039447 | Ga0436361_0666081 | Ga0436361_0666081_1015_1962 | 292 |
| 51 | 3300014968 | Ga0157379_10270221 | Ga0157379_102702212 | 293 |
| 52 | 3300048907 | Ga0496104_0089315 | Ga0496104_0089315_640_1569 | 293 |
| 53 | 3300048909 | Ga0496106_0014200 | Ga0496106_0014200_1846_2775 | 293 |
| 54 | 3300048911 | Ga0496108_0001334 | Ga0496108_0001334_2744_3673 | 293 |
| 55 | 3300048912 | Ga0496109_0000469 | Ga0496109_0000469_6185_7114 | 293 |
| 56 | 3300048916 | Ga0496113_0033748 | Ga0496113_0033748_283_1212 | 293 |
| 57 | 3300028573 | Ga0265334_10065421 | Ga0265334_100654212 | 294 |
| 58 | 3300035111 | Ga0373923_0003219 | Ga0373923_0003219_1938_2891 | 294 |
| 59 | 3300035117 | Ga0373953_0003861 | Ga0373953_0003861_3305_4258 | 294 |
| 60 | 3300035118 | Ga0373954_0002159 | Ga0373954_0002159_2419_3372 | 294 |
| 61 | 3300035119 | Ga0373956_0002079 | Ga0373956_0002079_6131_7084 | 294 |
| 62 | 3300035172 | Ga0373955_0000905 | Ga0373955_0000905_3303_4256 | 294 |
| 63 | 3300035410 | Ga0373924_0013520 | Ga0373924_0013520_501_1454 | 294 |
| 64 | 3300035724 | Ga0373933_0008407 | Ga0373933_0008407_2982_3935 | 294 |
| 65 | 3300036401 | Ga0373937_0020867 | Ga0373937_0020867_2235_3188 | 294 |
| 66 | 3300037312 | Ga0395899_0163810 | Ga0395899_0163810_77_1024 | 294 |
| 67 | 3300037418 | Ga0395900_0036133 | Ga0395900_0036133_570_1517 | 294 |
| 68 | 3300038443 | Ga0395901_0586606 | Ga0395901_0586606_32_979 | 294 |
| 69 | 3300039447 | Ga0436361_1113862 | Ga0436361_1113862_1784_2800 | 294 |
| 70 | 3300039453 | Ga0436362_0381210 | Ga0436362_0381210_1460_2476 | 294 |
| 71 | 3300046454 | Ga0495592_0002830 | Ga0495592_0002830_7708_8661 | 294 |
| 72 | 3300046459 | Ga0495629_0000114 | Ga0495629_0000114_12343_13296 | 294 |
| 73 | 3300046462 | Ga0495651_0013315 | Ga0495651_0013315_3303_4256 | 294 |
| 74 | 3300046511 | Ga0495608_0001813 | Ga0495608_0001813_5051_6004 | 294 |
| 75 | 3300046516 | Ga0495628_0005957 | Ga0495628_0005957_1681_2634 | 294 |
| 76 | 3300046529 | Ga0495652_0021969 | Ga0495652_0021969_1191_2144 | 294 |
| 77 | 3300046529 | Ga0495652_0165827 | Ga0495652_0165827_506_1459 | 294 |
| 78 | 3300046533 | Ga0495640_0024012 | Ga0495640_0024012_2707_3660 | 294 |
| 79 | 3300046543 | Ga0495645_0037821 | Ga0495645_0037821_447_1400 | 294 |
| 80 | 3300046559 | Ga0495667_0011318 | Ga0495667_0011318_2356_3309 | 294 |
| 81 | 3300046642 | Ga0495634_0010234 | Ga0495634_0010234_3342_4295 | 294 |
| 82 | 3300046663 | Ga0495635_0007995 | Ga0495635_0007995_3817_4770 | 294 |
| 83 | 3300046675 | Ga0495657_0002559 | Ga0495657_0002559_12370_13323 | 294 |
| 84 | 3300046678 | Ga0495599_0000489 | Ga0495599_0000489_14537_15490 | 294 |
| 85 | 3300046680 | Ga0495646_0056609 | Ga0495646_0056609_51_1004 | 294 |
| 86 | 3300046689 | Ga0495613_0044590 | Ga0495613_0044590_2290_3243 | 294 |
| 87 | 3300046809 | Ga0495600_0000883 | Ga0495600_0000883_12370_13323 | 294 |
| 88 | 3300047317 | Ga0495604_0009813 | Ga0495604_0009813_4688_5641 | 294 |
| 89 | 3300047319 | Ga0495674_0075005 | Ga0495674_0075005_1869_2822 | 294 |
| 90 | 3300047319 | Ga0495674_0133075 | Ga0495674_0133075_1018_1977 | 294 |
| 91 | 3300047322 | Ga0495680_0000944 | Ga0495680_0000944_14270_15223 | 294 |
| 92 | 3300047471 | Ga0495684_0000841 | Ga0495684_0000841_6735_7688 | 294 |
| 93 | 3300047673 | Ga0495593_0003430 | Ga0495593_0003430_1342_2295 | 294 |
| 94 | 3300048088 | Ga0495602_0013081 | Ga0495602_0013081_2666_3619 | 294 |
| 95 | 3300048918 | Ga0496115_0215224 | Ga0496115_0215224_451_1404 | 294 |
| 96 | 3300053077 | Ga0495601_0019874 | Ga0495601_0019874_3082_4035 | 294 |
| 97 | 3300053084 | Ga0495595_0015693 | Ga0495595_0015693_2234_3187 | 294 |
| 98 | 3300053085 | Ga0495619_0001975 | Ga0495619_0001975_6327_7280 | 294 |
| 99 | 3300005336 | Ga0070680_100038587 | Ga0070680_1000385872 | 295 |
| 100 | 3300005435 | Ga0070714_100070223 | Ga0070714_1000702232 | 295 |
| 101 | 3300005436 | Ga0070713_100400126 | Ga0070713_1004001261 | 295 |
| 102 | 3300005458 | Ga0070681_10168535 | Ga0070681_101685351 | 295 |
| 103 | 3300005467 | Ga0070706_100222207 | Ga0070706_1002222072 | 295 |
| 104 | 3300005530 | Ga0070679_100031365 | Ga0070679_1000313655 | 295 |
| 105 | 3300005535 | Ga0070684_100076578 | Ga0070684_1000765782 | 295 |
| 106 | 3300005536 | Ga0070697_100093960 | Ga0070697_1000939602 | 295 |
| 107 | 3300005539 | Ga0068853_100078646 | Ga0068853_1000786462 | 295 |
| 108 | 3300005547 | Ga0070693_100033785 | Ga0070693_1000337852 | 295 |
| 109 | 3300005564 | Ga0070664_100453319 | Ga0070664_1004533192 | 295 |
| 110 | 3300006173 | Ga0070716_100107027 | Ga0070716_1001070272 | 295 |
| 111 | 3300006175 | Ga0070712_100021427 | Ga0070712_1000214274 | 295 |
| 112 | 3300006914 | Ga0075436_100049211 | Ga0075436_1000492112 | 295 |
| 113 | 3300009174 | Ga0105241_10053973 | Ga0105241_100539733 | 295 |
| 114 | 3300009551 | Ga0105238_10071809 | Ga0105238_100718093 | 295 |
| 115 | 3300013105 | Ga0157369_10020808 | Ga0157369_100208086 | 295 |
| 116 | 3300013307 | Ga0157372_10176623 | Ga0157372_101766232 | 295 |
| 117 | 3300021384 | Ga0213876_10072442 | Ga0213876_100724422 | 295 |
| 118 | 3300025898 | Ga0207692_10033935 | Ga0207692_100339353 | 295 |
| 119 | 3300025910 | Ga0207684_10341995 | Ga0207684_103419951 | 295 |
| 120 | 3300025915 | Ga0207693_10004667 | Ga0207693_100046676 | 295 |
| 121 | 3300025924 | Ga0207694_10034292 | Ga0207694_100342923 | 295 |
| 122 | 3300025924 | Ga0207694_10114885 | Ga0207694_101148853 | 295 |
| 123 | 3300026041 | Ga0207639_10066332 | Ga0207639_100663322 | 295 |
| 124 | 3300026078 | Ga0207702_10527407 | Ga0207702_105274072 | 295 |
| 125 | 3300026142 | Ga0207698_10062472 | Ga0207698_100624722 | 295 |
| 126 | 3300031344 | Ga0265316_10054901 | Ga0265316_100549014 | 295 |
| 127 | 3300036401 | Ga0373937_0148560 | Ga0373937_0148560_870_1820 | 295 |
| 128 | 3300048929 | Ga0496126_0281038 | Ga0496126_0281038_247_1197 | 295 |
| 129 | 3300005336 | Ga0070680_100095507 | Ga0070680_1000955073 | 296 |
| 130 | 3300005336 | Ga0070680_100321717 | Ga0070680_1003217171 | 296 |
| 131 | 3300005435 | Ga0070714_100271799 | Ga0070714_1002717992 | 296 |
| 132 | 3300005436 | Ga0070713_100263103 | Ga0070713_1002631032 | 296 |
| 133 | 3300005536 | Ga0070697_100024702 | Ga0070697_1000247023 | 296 |
| 134 | 3300006914 | Ga0075436_100016744 | Ga0075436_1000167442 | 296 |
| 135 | 3300009093 | Ga0105240_10268135 | Ga0105240_102681352 | 296 |
| 136 | 3300009551 | Ga0105238_10003206 | Ga0105238_1000320611 | 296 |
| 137 | 3300013307 | Ga0157372_10352028 | Ga0157372_103520282 | 296 |
| 138 | 3300025913 | Ga0207695_10199900 | Ga0207695_101999002 | 296 |
| 139 | 3300025917 | Ga0207660_10091367 | Ga0207660_100913672 | 296 |
| 140 | 3300025921 | Ga0207652_10114506 | Ga0207652_101145062 | 296 |
| 141 | 3300025924 | Ga0207694_10021667 | Ga0207694_100216675 | 296 |
| 142 | 3300035695 | Ga0373927_0292754 | Ga0373927_0292754_67_1023 | 296 |
| 143 | 3300035725 | Ga0373947_0129549 | Ga0373947_0129549_583_1539 | 296 |
| 144 | 3300036401 | Ga0373937_0022555 | Ga0373937_0022555_2678_3634 | 296 |
| 145 | 3300037068 | Ga0373925_0260075 | Ga0373925_0260075_78_1034 | 296 |
| 146 | 3300037418 | Ga0395900_0164021 | Ga0395900_0164021_167_1129 | 296 |
| 147 | 3300038443 | Ga0395901_0158295 | Ga0395901_0158295_26_976 | 296 |
| 148 | 3300039447 | Ga0436361_0400746 | Ga0436361_0400746_444_1397 | 296 |
| 149 | 3300046455 | Ga0495603_0030176 | Ga0495603_0030176_1490_2446 | 296 |
| 150 | 3300046463 | Ga0495653_0044307 | Ga0495653_0044307_1672_2628 | 296 |
| 151 | 3300046472 | Ga0495580_0007433 | Ga0495580_0007433_6987_7940 | 296 |
| 152 | 3300046473 | Ga0495582_0184182 | Ga0495582_0184182_219_1175 | 296 |
| 153 | 3300046475 | Ga0495639_0004330 | Ga0495639_0004330_3649_4605 | 296 |
| 154 | 3300046476 | Ga0495662_0015082 | Ga0495662_0015082_1727_2683 | 296 |
| 155 | 3300046514 | Ga0495618_0052683 | Ga0495618_0052683_803_1759 | 296 |
| 156 | 3300046517 | Ga0495630_0010492 | Ga0495630_0010492_4072_5028 | 296 |
| 157 | 3300046526 | Ga0495666_0011108 | Ga0495666_0011108_821_1777 | 296 |
| 158 | 3300046529 | Ga0495652_0121005 | Ga0495652_0121005_346_1302 | 296 |
| 159 | 3300046533 | Ga0495640_0005128 | Ga0495640_0005128_7817_8773 | 296 |
| 160 | 3300046642 | Ga0495634_0011129 | Ga0495634_0011129_4688_5644 | 296 |
| 161 | 3300046642 | Ga0495634_0029017 | Ga0495634_0029017_1596_2552 | 296 |
| 162 | 3300046663 | Ga0495635_0019846 | Ga0495635_0019846_1672_2628 | 296 |
| 163 | 3300046674 | Ga0495588_0073670 | Ga0495588_0073670_220_1176 | 296 |
| 164 | 3300046680 | Ga0495646_0193707 | Ga0495646_0193707_67_1023 | 296 |
| 165 | 3300046683 | Ga0495658_0016799 | Ga0495658_0016799_704_1660 | 296 |
| 166 | 3300046690 | Ga0495624_0040306 | Ga0495624_0040306_617_1573 | 296 |
| 167 | 3300047317 | Ga0495604_0025971 | Ga0495604_0025971_1150_2106 | 296 |
| 168 | 3300047319 | Ga0495674_0056323 | Ga0495674_0056323_1658_2614 | 296 |
| 169 | 3300047322 | Ga0495680_0032024 | Ga0495680_0032024_1138_2094 | 296 |
| 170 | 3300047471 | Ga0495684_0007035 | Ga0495684_0007035_1661_2617 | 296 |
| 171 | 3300048914 | Ga0496111_0074297 | Ga0496111_0074297_272_1222 | 296 |
| 172 | 3300050514 | nmdc:mga08x19_4788_c1 | nmdc:mga08x19_4788_c1_5137_6090 | 296 |
| 173 | 3300053077 | Ga0495601_0014584 | Ga0495601_0014584_1134_2090 | 296 |
| 174 | 3300053085 | Ga0495619_0010245 | Ga0495619_0010245_2242_3198 | 296 |
| 175 | 3300005327 | Ga0070658_10016692 | Ga0070658_100166924 | 297 |
| 176 | 3300005329 | Ga0070683_100095544 | Ga0070683_1000955443 | 297 |
| 177 | 3300005334 | Ga0068869_100141338 | Ga0068869_1001413381 | 297 |
| 178 | 3300005336 | Ga0070680_100007540 | Ga0070680_1000075407 | 297 |
| 179 | 3300005336 | Ga0070680_100010316 | Ga0070680_1000103166 | 297 |
| 180 | 3300005336 | Ga0070680_100099517 | Ga0070680_1000995172 | 297 |
| 181 | 3300005339 | Ga0070660_100034632 | Ga0070660_1000346323 | 297 |
| 182 | 3300005339 | Ga0070660_100047315 | Ga0070660_1000473153 | 297 |
| 183 | 3300005339 | Ga0070660_100083968 | Ga0070660_1000839683 | 297 |
| 184 | 3300005344 | Ga0070661_100004970 | Ga0070661_1000049707 | 297 |
| 185 | 3300005345 | Ga0070692_10004009 | Ga0070692_100040092 | 297 |
| 186 | 3300005366 | Ga0070659_100017494 | Ga0070659_1000174943 | 297 |
| 187 | 3300005366 | Ga0070659_100106441 | Ga0070659_1001064412 | 297 |
| 188 | 3300005434 | Ga0070709_10047420 | Ga0070709_100474202 | 297 |
| 189 | 3300005435 | Ga0070714_100002138 | Ga0070714_10000213812 | 297 |
| 190 | 3300005436 | Ga0070713_100009299 | Ga0070713_1000092996 | 297 |
| 191 | 3300005437 | Ga0070710_10014721 | Ga0070710_100147215 | 297 |
| 192 | 3300005439 | Ga0070711_100045350 | Ga0070711_1000453503 | 297 |
| 193 | 3300005440 | Ga0070705_100003606 | Ga0070705_1000036063 | 297 |
| 194 | 3300005444 | Ga0070694_100033461 | Ga0070694_1000334613 | 297 |
| 195 | 3300005445 | Ga0070708_100161092 | Ga0070708_1001610922 | 297 |
| 196 | 3300005458 | Ga0070681_10028904 | Ga0070681_100289044 | 297 |
| 197 | 3300005458 | Ga0070681_10092187 | Ga0070681_100921872 | 297 |
| 198 | 3300005458 | Ga0070681_10199476 | Ga0070681_101994762 | 297 |
| 199 | 3300005468 | Ga0070707_100068680 | Ga0070707_1000686805 | 297 |
| 200 | 3300005471 | Ga0070698_100139696 | Ga0070698_1001396962 | 297 |
| 201 | 3300005518 | Ga0070699_100013662 | Ga0070699_1000136623 | 297 |
| 202 | 3300005518 | Ga0070699_100016626 | Ga0070699_1000166262 | 297 |
| 203 | 3300005530 | Ga0070679_100030659 | Ga0070679_1000306593 | 297 |
| 204 | 3300005530 | Ga0070679_100086992 | Ga0070679_1000869922 | 297 |
| 205 | 3300005536 | Ga0070697_100051116 | Ga0070697_1000511164 | 297 |
| 206 | 3300005539 | Ga0068853_100006310 | Ga0068853_1000063103 | 297 |
| 207 | 3300005539 | Ga0068853_100054551 | Ga0068853_1000545513 | 297 |
| 208 | 3300005545 | Ga0070695_100018760 | Ga0070695_1000187604 | 297 |
| 209 | 3300005546 | Ga0070696_100069654 | Ga0070696_1000696543 | 297 |
| 210 | 3300005547 | Ga0070693_100010668 | Ga0070693_1000106683 | 297 |
| 211 | 3300005549 | Ga0070704_100030514 | Ga0070704_1000305143 | 297 |
| 212 | 3300005563 | Ga0068855_100017840 | Ga0068855_1000178406 | 297 |
| 213 | 3300005563 | Ga0068855_100021639 | Ga0068855_1000216394 | 297 |
| 214 | 3300005563 | Ga0068855_100749509 | Ga0068855_1007495091 | 297 |
| 215 | 3300005564 | Ga0070664_100026248 | Ga0070664_1000262485 | 297 |
| 216 | 3300005577 | Ga0068857_100055709 | Ga0068857_1000557094 | 297 |
| 217 | 3300005578 | Ga0068854_100009175 | Ga0068854_1000091753 | 297 |
| 218 | 3300005578 | Ga0068854_100125656 | Ga0068854_1001256562 | 297 |
| 219 | 3300005614 | Ga0068856_100017680 | Ga0068856_1000176803 | 297 |
| 220 | 3300005614 | Ga0068856_100028035 | Ga0068856_1000280354 | 297 |
| 221 | 3300005616 | Ga0068852_100224561 | Ga0068852_1002245612 | 297 |
| 222 | 3300005616 | Ga0068852_100249846 | Ga0068852_1002498462 | 297 |
| 223 | 3300005834 | Ga0068851_10021741 | Ga0068851_100217413 | 297 |
| 224 | 3300006175 | Ga0070712_100000052 | Ga0070712_10000005250 | 297 |
| 225 | 3300006175 | Ga0070712_100032063 | Ga0070712_1000320632 | 297 |
| 226 | 3300006871 | Ga0075434_100014102 | Ga0075434_1000141027 | 297 |
| 227 | 3300006914 | Ga0075436_100038128 | Ga0075436_1000381283 | 297 |
| 228 | 3300006914 | Ga0075436_100151508 | Ga0075436_1001515082 | 297 |
| 229 | 3300007076 | Ga0075435_100012722 | Ga0075435_1000127224 | 297 |
| 230 | 3300009093 | Ga0105240_10026154 | Ga0105240_100261547 | 297 |
| 231 | 3300009093 | Ga0105240_10107237 | Ga0105240_101072373 | 297 |
| 232 | 3300009098 | Ga0105245_10043724 | Ga0105245_100437244 | 297 |
| 233 | 3300009545 | Ga0105237_10028324 | Ga0105237_100283243 | 297 |
| 234 | 3300009551 | Ga0105238_10042262 | Ga0105238_100422623 | 297 |
| 235 | 3300009551 | Ga0105238_10108711 | Ga0105238_101087113 | 297 |
| 236 | 3300010375 | Ga0105239_10070408 | Ga0105239_100704084 | 297 |
| 237 | 3300011119 | Ga0105246_10010340 | Ga0105246_100103402 | 297 |
| 238 | 3300011119 | Ga0105246_10181670 | Ga0105246_101816702 | 297 |
| 239 | 3300013100 | Ga0157373_10047557 | Ga0157373_100475572 | 297 |
| 240 | 3300013102 | Ga0157371_10032724 | Ga0157371_100327244 | 297 |
| 241 | 3300013104 | Ga0157370_10004982 | Ga0157370_100049829 | 297 |
| 242 | 3300013104 | Ga0157370_10018409 | Ga0157370_100184094 | 297 |
| 243 | 3300013105 | Ga0157369_10100691 | Ga0157369_101006912 | 297 |
| 244 | 3300013105 | Ga0157369_10165724 | Ga0157369_101657243 | 297 |
| 245 | 3300013296 | Ga0157374_10015897 | Ga0157374_100158973 | 297 |
| 246 | 3300013306 | Ga0163162_10323210 | Ga0163162_103232102 | 297 |
| 247 | 3300013307 | Ga0157372_10167721 | Ga0157372_101677212 | 297 |
| 248 | 3300014325 | Ga0163163_10006821 | Ga0163163_100068216 | 297 |
| 249 | 3300014745 | Ga0157377_10104914 | Ga0157377_101049142 | 297 |
| 250 | 3300021384 | Ga0213876_10085795 | Ga0213876_100857952 | 297 |
| 251 | 3300021388 | Ga0213875_10110401 | Ga0213875_101104012 | 297 |
| 252 | 3300025911 | Ga0207654_10004049 | Ga0207654_100040497 | 297 |
| 253 | 3300025912 | Ga0207707_10009475 | Ga0207707_100094757 | 297 |
| 254 | 3300025912 | Ga0207707_10072597 | Ga0207707_100725973 | 297 |
| 255 | 3300025913 | Ga0207695_10031367 | Ga0207695_100313673 | 297 |
| 256 | 3300025914 | Ga0207671_10017472 | Ga0207671_100174722 | 297 |
| 257 | 3300025915 | Ga0207693_10000915 | Ga0207693_1000091514 | 297 |
| 258 | 3300025915 | Ga0207693_10015221 | Ga0207693_100152214 | 297 |
| 259 | 3300025917 | Ga0207660_10006764 | Ga0207660_100067643 | 297 |
| 260 | 3300025917 | Ga0207660_10154327 | Ga0207660_101543272 | 297 |
| 261 | 3300025919 | Ga0207657_10005116 | Ga0207657_1000511610 | 297 |
| 262 | 3300025919 | Ga0207657_10033396 | Ga0207657_100333964 | 297 |
| 263 | 3300025919 | Ga0207657_10086551 | Ga0207657_100865512 | 297 |
| 264 | 3300025921 | Ga0207652_10005325 | Ga0207652_100053258 | 297 |
| 265 | 3300025924 | Ga0207694_10066194 | Ga0207694_100661943 | 297 |
| 266 | 3300025927 | Ga0207687_10052797 | Ga0207687_100527973 | 297 |
| 267 | 3300025928 | Ga0207700_10002466 | Ga0207700_100024667 | 297 |
| 268 | 3300025928 | Ga0207700_10004080 | Ga0207700_100040803 | 297 |
| 269 | 3300025929 | Ga0207664_10010006 | Ga0207664_100100065 | 297 |
| 270 | 3300025929 | Ga0207664_10057611 | Ga0207664_100576112 | 297 |
| 271 | 3300025932 | Ga0207690_10222899 | Ga0207690_102228992 | 297 |
| 272 | 3300025936 | Ga0207670_10395535 | Ga0207670_103955352 | 297 |
| 273 | 3300025939 | Ga0207665_10010681 | Ga0207665_100106813 | 297 |
| 274 | 3300025942 | Ga0207689_10022758 | Ga0207689_100227582 | 297 |
| 275 | 3300025945 | Ga0207679_10069056 | Ga0207679_100690563 | 297 |
| 276 | 3300025949 | Ga0207667_10037490 | Ga0207667_100374903 | 297 |
| 277 | 3300025949 | Ga0207667_10042794 | Ga0207667_100427943 | 297 |
| 278 | 3300025949 | Ga0207667_10137207 | Ga0207667_101372072 | 297 |
| 279 | 3300026041 | Ga0207639_10206147 | Ga0207639_102061472 | 297 |
| 280 | 3300026078 | Ga0207702_10142522 | Ga0207702_101425222 | 297 |
| 281 | 3300026078 | Ga0207702_10166117 | Ga0207702_101661171 | 297 |
| 282 | 3300026116 | Ga0207674_10028168 | Ga0207674_100281684 | 297 |
| 283 | 3300026142 | Ga0207698_10117825 | Ga0207698_101178253 | 297 |
| 284 | 3300028800 | Ga0265338_10026507 | Ga0265338_100265075 | 297 |
| 285 | 3300031344 | Ga0265316_10323492 | Ga0265316_103234922 | 297 |
| 286 | 3300031595 | Ga0265313_10037122 | Ga0265313_100371223 | 297 |
| 287 | 3300031711 | Ga0265314_10002422 | Ga0265314_100024224 | 297 |
| 288 | 3300031711 | Ga0265314_10141342 | Ga0265314_101413422 | 297 |
| 289 | 3300035111 | Ga0373923_0025778 | Ga0373923_0025778_649_1602 | 297 |
| 290 | 3300035113 | Ga0373936_0020223 | Ga0373936_0020223_1577_2530 | 297 |
| 291 | 3300035118 | Ga0373954_0002202 | Ga0373954_0002202_1333_2286 | 297 |
| 292 | 3300035119 | Ga0373956_0017473 | Ga0373956_0017473_293_1246 | 297 |
| 293 | 3300035120 | Ga0373957_0002485 | Ga0373957_0002485_1378_2331 | 297 |
| 294 | 3300035120 | Ga0373957_0033197 | Ga0373957_0033197_389_1342 | 297 |
| 295 | 3300035172 | Ga0373955_0017044 | Ga0373955_0017044_1367_2320 | 297 |
| 296 | 3300035172 | Ga0373955_0088402 | Ga0373955_0088402_527_1480 | 297 |
| 297 | 3300035410 | Ga0373924_0040109 | Ga0373924_0040109_393_1346 | 297 |
| 298 | 3300036401 | Ga0373937_0081300 | Ga0373937_0081300_1040_1993 | 297 |
| 299 | 3300036401 | Ga0373937_0275243 | Ga0373937_0275243_382_1350 | 297 |
| 300 | 3300037853 | Ga0436364_1279747 | Ga0436364_1279747_829_1785 | 297 |
| 301 | 3300039437 | Ga0436365_0249117 | Ga0436365_0249117_1689_2633 | 297 |
| 302 | 3300039437 | Ga0436365_0695125 | Ga0436365_0695125_525_1469 | 297 |
| 303 | 3300039437 | Ga0436365_1291261 | Ga0436365_1291261_931_1887 | 297 |
| 304 | 3300045976 | Ga0466967_0038711 | Ga0466967_0038711_1260_2213 | 297 |
| 305 | 3300046459 | Ga0495629_0235439 | Ga0495629_0235439_184_1137 | 297 |
| 306 | 3300046462 | Ga0495651_0011379 | Ga0495651_0011379_1347_2300 | 297 |
| 307 | 3300046463 | Ga0495653_0014914 | Ga0495653_0014914_4228_5181 | 297 |
| 308 | 3300046473 | Ga0495582_0135615 | Ga0495582_0135615_323_1279 | 297 |
| 309 | 3300046475 | Ga0495639_0065199 | Ga0495639_0065199_10_966 | 297 |
| 310 | 3300046511 | Ga0495608_0015230 | Ga0495608_0015230_670_1623 | 297 |
| 311 | 3300046514 | Ga0495618_0010523 | Ga0495618_0010523_4005_4958 | 297 |
| 312 | 3300046516 | Ga0495628_0039395 | Ga0495628_0039395_499_1452 | 297 |
| 313 | 3300046517 | Ga0495630_0025912 | Ga0495630_0025912_529_1482 | 297 |
| 314 | 3300046529 | Ga0495652_0059141 | Ga0495652_0059141_658_1611 | 297 |
| 315 | 3300046536 | Ga0495587_0026279 | Ga0495587_0026279_2305_3258 | 297 |
| 316 | 3300046559 | Ga0495667_0093541 | Ga0495667_0093541_701_1654 | 297 |
| 317 | 3300046663 | Ga0495635_0029696 | Ga0495635_0029696_2359_3312 | 297 |
| 318 | 3300046675 | Ga0495657_0126955 | Ga0495657_0126955_112_1065 | 297 |
| 319 | 3300046678 | Ga0495599_0032058 | Ga0495599_0032058_825_1778 | 297 |
| 320 | 3300046679 | Ga0495623_0014206 | Ga0495623_0014206_1330_2283 | 297 |
| 321 | 3300046809 | Ga0495600_0068193 | Ga0495600_0068193_43_996 | 297 |
| 322 | 3300047319 | Ga0495674_0013127 | Ga0495674_0013127_3115_4068 | 297 |
| 323 | 3300047444 | Ga0495675_0010392 | Ga0495675_0010392_1724_2677 | 297 |
| 324 | 3300048903 | Ga0496100_0094960 | Ga0496100_0094960_200_1153 | 297 |
| 325 | 3300048904 | Ga0496101_0131617 | Ga0496101_0131617_903_1856 | 297 |
| 326 | 3300048905 | Ga0496102_0005663 | Ga0496102_0005663_2771_3724 | 297 |
| 327 | 3300048905 | Ga0496102_0041542 | Ga0496102_0041542_1511_2470 | 297 |
| 328 | 3300048907 | Ga0496104_0000948 | Ga0496104_0000948_10427_11383 | 297 |
| 329 | 3300048907 | Ga0496104_0006356 | Ga0496104_0006356_3544_4497 | 297 |
| 330 | 3300048908 | Ga0496105_0007104 | Ga0496105_0007104_1998_2954 | 297 |
| 331 | 3300048909 | Ga0496106_0087261 | Ga0496106_0087261_164_1117 | 297 |
| 332 | 3300048909 | Ga0496106_0225607 | Ga0496106_0225607_57_1016 | 297 |
| 333 | 3300048910 | Ga0496107_0080409 | Ga0496107_0080409_582_1535 | 297 |
| 334 | 3300048911 | Ga0496108_0000479 | Ga0496108_0000479_7352_8308 | 297 |
| 335 | 3300048912 | Ga0496109_0009376 | Ga0496109_0009376_4948_5904 | 297 |
| 336 | 3300048914 | Ga0496111_0000112 | Ga0496111_0000112_16542_17498 | 297 |
| 337 | 3300048915 | Ga0496112_0036769 | Ga0496112_0036769_2746_3699 | 297 |
| 338 | 3300048915 | Ga0496112_0050774 | Ga0496112_0050774_1545_2501 | 297 |
| 339 | 3300048916 | Ga0496113_0036503 | Ga0496113_0036503_2124_3077 | 297 |
| 340 | 3300048918 | Ga0496115_0037865 | Ga0496115_0037865_1553_2509 | 297 |
| 341 | 3300048918 | Ga0496115_0170174 | Ga0496115_0170174_536_1489 | 297 |
| 342 | 3300048924 | Ga0496121_0008649 | Ga0496121_0008649_9945_10901 | 297 |
| 343 | 3300048929 | Ga0496126_0032055 | Ga0496126_0032055_1855_2811 | 297 |
| 344 | 3300048929 | Ga0496126_0087662 | Ga0496126_0087662_1735_2688 | 297 |
| 345 | 3300050512 | nmdc:mga0n895_12310_c1 | nmdc:mga0n895_12310_c1_6399_7358 | 297 |
| 346 | 3300050513 | nmdc:mga0rr50_258829_c1 | nmdc:mga0rr50_258829_c1_265_1224 | 297 |
| 347 | 3300050513 | nmdc:mga0rr50_9008_c1 | nmdc:mga0rr50_9008_c1_2845_3804 | 297 |
| 348 | 3300050514 | nmdc:mga08x19_240455_c1 | nmdc:mga08x19_240455_c1_228_1187 | 297 |
| 349 | 3300053077 | Ga0495601_0003938 | Ga0495601_0003938_304_1260 | 297 |
| 350 | 3300053077 | Ga0495601_0020996 | Ga0495601_0020996_2748_3701 | 297 |
| 351 | 3300053077 | Ga0495601_0197037 | Ga0495601_0197037_44_997 | 297 |
| 352 | 3300053084 | Ga0495595_0003156 | Ga0495595_0003156_3054_4007 | 297 |
| 353 | 3300053085 | Ga0495619_0004698 | Ga0495619_0004698_4769_5725 | 297 |
| 354 | 3300005330 | Ga0070690_100003720 | Ga0070690_1000037204 | 298 |
| 355 | 3300005334 | Ga0068869_100002056 | Ga0068869_1000020567 | 298 |
| 356 | 3300005336 | Ga0070680_100079888 | Ga0070680_1000798881 | 298 |
| 357 | 3300005336 | Ga0070680_100236239 | Ga0070680_1002362392 | 298 |
| 358 | 3300005338 | Ga0068868_100399502 | Ga0068868_1003995022 | 298 |
| 359 | 3300005340 | Ga0070689_100006977 | Ga0070689_1000069776 | 298 |
| 360 | 3300005355 | Ga0070671_100042208 | Ga0070671_1000422085 | 298 |
| 361 | 3300005435 | Ga0070714_100269732 | Ga0070714_1002697321 | 298 |
| 362 | 3300005436 | Ga0070713_100000065 | Ga0070713_10000006530 | 298 |
| 363 | 3300005438 | Ga0070701_10065347 | Ga0070701_100653472 | 298 |
| 364 | 3300005440 | Ga0070705_100182098 | Ga0070705_1001820982 | 298 |
| 365 | 3300005441 | Ga0070700_100001467 | Ga0070700_1000014672 | 298 |
| 366 | 3300005444 | Ga0070694_100011614 | Ga0070694_1000116144 | 298 |
| 367 | 3300005445 | Ga0070708_100533424 | Ga0070708_1005334241 | 298 |
| 368 | 3300005459 | Ga0068867_100004140 | Ga0068867_1000041404 | 298 |
| 369 | 3300005467 | Ga0070706_100164818 | Ga0070706_1001648182 | 298 |
| 370 | 3300005468 | Ga0070707_100459500 | Ga0070707_1004595002 | 298 |
| 371 | 3300005530 | Ga0070679_100021876 | Ga0070679_1000218765 | 298 |
| 372 | 3300005536 | Ga0070697_100002755 | Ga0070697_10000275511 | 298 |
| 373 | 3300005544 | Ga0070686_100006725 | Ga0070686_1000067254 | 298 |
| 374 | 3300005545 | Ga0070695_100000795 | Ga0070695_10000079512 | 298 |
| 375 | 3300005547 | Ga0070693_100015556 | Ga0070693_1000155562 | 298 |
| 376 | 3300005547 | Ga0070693_100032201 | Ga0070693_1000322014 | 298 |
| 377 | 3300005564 | Ga0070664_100385973 | Ga0070664_1003859732 | 298 |
| 378 | 3300005614 | Ga0068856_100000476 | Ga0068856_10000047615 | 298 |
| 379 | 3300005617 | Ga0068859_100040199 | Ga0068859_1000401995 | 298 |
| 380 | 3300005718 | Ga0068866_10002101 | Ga0068866_100021014 | 298 |
| 381 | 3300005841 | Ga0068863_100371758 | Ga0068863_1003717582 | 298 |
| 382 | 3300005842 | Ga0068858_100033258 | Ga0068858_1000332584 | 298 |
| 383 | 3300005844 | Ga0068862_100110905 | Ga0068862_1001109053 | 298 |
| 384 | 3300006163 | Ga0070715_10080801 | Ga0070715_100808012 | 298 |
| 385 | 3300006237 | Ga0097621_100014579 | Ga0097621_1000145794 | 298 |
| 386 | 3300006237 | Ga0097621_100312542 | Ga0097621_1003125422 | 298 |
| 387 | 3300006358 | Ga0068871_100011570 | Ga0068871_1000115704 | 298 |
| 388 | 3300006881 | Ga0068865_100004018 | Ga0068865_1000040187 | 298 |
| 389 | 3300006914 | Ga0075436_100000339 | Ga0075436_10000033916 | 298 |
| 390 | 3300006931 | Ga0097620_100040199 | Ga0097620_1000401995 | 298 |
| 391 | 3300009098 | Ga0105245_10006477 | Ga0105245_100064774 | 298 |
| 392 | 3300009098 | Ga0105245_10053683 | Ga0105245_100536832 | 298 |
| 393 | 3300009148 | Ga0105243_10037056 | Ga0105243_100370562 | 298 |
| 394 | 3300009176 | Ga0105242_10006151 | Ga0105242_100061514 | 298 |
| 395 | 3300009177 | Ga0105248_10461693 | Ga0105248_104616932 | 298 |
| 396 | 3300013105 | Ga0157369_10023064 | Ga0157369_100230642 | 298 |
| 397 | 3300013296 | Ga0157374_10029820 | Ga0157374_100298203 | 298 |
| 398 | 3300013297 | Ga0157378_10002093 | Ga0157378_100020934 | 298 |
| 399 | 3300013297 | Ga0157378_10010637 | Ga0157378_100106374 | 298 |
| 400 | 3300013308 | Ga0157375_10017330 | Ga0157375_100173304 | 298 |
| 401 | 3300014325 | Ga0163163_10014359 | Ga0163163_100143594 | 298 |
| 402 | 3300014325 | Ga0163163_10162745 | Ga0163163_101627452 | 298 |
| 403 | 3300021377 | Ga0213874_10005567 | Ga0213874_100055672 | 298 |
| 404 | 3300021384 | Ga0213876_10002788 | Ga0213876_100027885 | 298 |
| 405 | 3300025899 | Ga0207642_10031820 | Ga0207642_100318202 | 298 |
| 406 | 3300025904 | Ga0207647_10150732 | Ga0207647_101507321 | 298 |
| 407 | 3300025905 | Ga0207685_10088304 | Ga0207685_100883041 | 298 |
| 408 | 3300025908 | Ga0207643_10018881 | Ga0207643_100188813 | 298 |
| 409 | 3300025910 | Ga0207684_10056482 | Ga0207684_100564823 | 298 |
| 410 | 3300025912 | Ga0207707_10007324 | Ga0207707_100073247 | 298 |
| 411 | 3300025915 | Ga0207693_10158375 | Ga0207693_101583752 | 298 |
| 412 | 3300025917 | Ga0207660_10080858 | Ga0207660_100808582 | 298 |
| 413 | 3300025921 | Ga0207652_10062790 | Ga0207652_100627902 | 298 |
| 414 | 3300025927 | Ga0207687_10006743 | Ga0207687_100067435 | 298 |
| 415 | 3300025928 | Ga0207700_10000046 | Ga0207700_1000004647 | 298 |
| 416 | 3300025928 | Ga0207700_10044479 | Ga0207700_100444792 | 298 |
| 417 | 3300025929 | Ga0207664_10126435 | Ga0207664_101264352 | 298 |
| 418 | 3300025934 | Ga0207686_10006534 | Ga0207686_100065344 | 298 |
| 419 | 3300025935 | Ga0207709_10013178 | Ga0207709_100131782 | 298 |
| 420 | 3300025936 | Ga0207670_10010015 | Ga0207670_100100153 | 298 |
| 421 | 3300025938 | Ga0207704_10009822 | Ga0207704_100098222 | 298 |
| 422 | 3300025939 | Ga0207665_10052097 | Ga0207665_100520972 | 298 |
| 423 | 3300025939 | Ga0207665_10187583 | Ga0207665_101875831 | 298 |
| 424 | 3300025941 | Ga0207711_10211250 | Ga0207711_102112501 | 298 |
| 425 | 3300025942 | Ga0207689_10000455 | Ga0207689_1000045519 | 298 |
| 426 | 3300025944 | Ga0207661_10007889 | Ga0207661_100078893 | 298 |
| 427 | 3300025944 | Ga0207661_10473189 | Ga0207661_104731892 | 298 |
| 428 | 3300025945 | Ga0207679_10387238 | Ga0207679_103872382 | 298 |
| 429 | 3300026035 | Ga0207703_10006428 | Ga0207703_100064284 | 298 |
| 430 | 3300026035 | Ga0207703_10310881 | Ga0207703_103108812 | 298 |
| 431 | 3300026075 | Ga0207708_10000339 | Ga0207708_1000033938 | 298 |
| 432 | 3300026078 | Ga0207702_10000514 | Ga0207702_1000051434 | 298 |
| 433 | 3300026088 | Ga0207641_10370614 | Ga0207641_103706142 | 298 |
| 434 | 3300026089 | Ga0207648_10001197 | Ga0207648_1000119717 | 298 |
| 435 | 3300028577 | Ga0265318_10029464 | Ga0265318_100294642 | 298 |
| 436 | 3300031238 | Ga0265332_10004884 | Ga0265332_100048842 | 298 |
| 437 | 3300031238 | Ga0265332_10011382 | Ga0265332_100113822 | 298 |
| 438 | 3300031247 | Ga0265340_10014281 | Ga0265340_100142814 | 298 |
| 439 | 3300031247 | Ga0265340_10023667 | Ga0265340_100236672 | 298 |
| 440 | 3300031249 | Ga0265339_10004408 | Ga0265339_100044086 | 298 |
| 441 | 3300031250 | Ga0265331_10007186 | Ga0265331_100071864 | 298 |
| 442 | 3300031250 | Ga0265331_10017067 | Ga0265331_100170672 | 298 |
| 443 | 3300031251 | Ga0265327_10002824 | Ga0265327_1000282413 | 298 |
| 444 | 3300031616 | Ga0307508_10008446 | Ga0307508_100084468 | 298 |
| 445 | 3300031711 | Ga0265314_10027306 | Ga0265314_100273067 | 298 |
| 446 | 3300031711 | Ga0265314_10089609 | Ga0265314_100896092 | 298 |
| 447 | 3300031712 | Ga0265342_10000146 | Ga0265342_1000014626 | 298 |
| 448 | 3300031712 | Ga0265342_10018437 | Ga0265342_100184373 | 298 |
| 449 | 3300031712 | Ga0265342_10029041 | Ga0265342_100290414 | 298 |
| 450 | 3300035085 | Ga0373929_0005888 | Ga0373929_0005888_864_1817 | 298 |
| 451 | 3300035111 | Ga0373923_0001932 | Ga0373923_0001932_3966_4925 | 298 |
| 452 | 3300035113 | Ga0373936_0002375 | Ga0373936_0002375_789_1748 | 298 |
| 453 | 3300035117 | Ga0373953_0001993 | Ga0373953_0001993_4946_5905 | 298 |
| 454 | 3300035117 | Ga0373953_0013826 | Ga0373953_0013826_818_1771 | 298 |
| 455 | 3300035118 | Ga0373954_0011383 | Ga0373954_0011383_1304_2257 | 298 |
| 456 | 3300035118 | Ga0373954_0028738 | Ga0373954_0028738_1305_2264 | 298 |
| 457 | 3300035120 | Ga0373957_0014844 | Ga0373957_0014844_14_967 | 298 |
| 458 | 3300035170 | Ga0373943_0024272 | Ga0373943_0024272_957_1916 | 298 |
| 459 | 3300035171 | Ga0373946_0001151 | Ga0373946_0001151_3525_4484 | 298 |
| 460 | 3300035172 | Ga0373955_0001496 | Ga0373955_0001496_2163_3122 | 298 |
| 461 | 3300035172 | Ga0373955_0035179 | Ga0373955_0035179_1193_2146 | 298 |
| 462 | 3300035172 | Ga0373955_0101172 | Ga0373955_0101172_469_1428 | 298 |
| 463 | 3300035410 | Ga0373924_0000337 | Ga0373924_0000337_6993_7952 | 298 |
| 464 | 3300035691 | Ga0373931_0000221 | Ga0373931_0000221_15316_16269 | 298 |
| 465 | 3300035692 | Ga0373935_0000151 | Ga0373935_0000151_6631_7590 | 298 |
| 466 | 3300035692 | Ga0373935_0022406 | Ga0373935_0022406_2326_3279 | 298 |
| 467 | 3300035695 | Ga0373927_0047869 | Ga0373927_0047869_685_1638 | 298 |
| 468 | 3300035695 | Ga0373927_0071590 | Ga0373927_0071590_86_1045 | 298 |
| 469 | 3300035724 | Ga0373933_0001536 | Ga0373933_0001536_4997_5956 | 298 |
| 470 | 3300035725 | Ga0373947_0001986 | Ga0373947_0001986_10917_11876 | 298 |
| 471 | 3300035725 | Ga0373947_0010137 | Ga0373947_0010137_2772_3725 | 298 |
| 472 | 3300036401 | Ga0373937_0000004 | Ga0373937_0000004_126640_127599 | 298 |
| 473 | 3300036401 | Ga0373937_0112014 | Ga0373937_0112014_267_1223 | 298 |
| 474 | 3300037068 | Ga0373925_0000095 | Ga0373925_0000095_85414_86373 | 298 |
| 475 | 3300037068 | Ga0373925_0042842 | Ga0373925_0042842_1952_2911 | 298 |
| 476 | 3300037853 | Ga0436364_0488870 | Ga0436364_0488870_4934_5887 | 298 |
| 477 | 3300039437 | Ga0436365_0260170 | Ga0436365_0260170_14318_15277 | 298 |
| 478 | 3300039450 | Ga0436363_0621480 | Ga0436363_0621480_2053_3012 | 298 |
| 479 | 3300046454 | Ga0495592_0000029 | Ga0495592_0000029_87270_88229 | 298 |
| 480 | 3300046455 | Ga0495603_0140742 | Ga0495603_0140742_415_1368 | 298 |
| 481 | 3300046459 | Ga0495629_0007749 | Ga0495629_0007749_2270_3229 | 298 |
| 482 | 3300046462 | Ga0495651_0001409 | Ga0495651_0001409_2571_3530 | 298 |
| 483 | 3300046463 | Ga0495653_0000012 | Ga0495653_0000012_264425_265384 | 298 |
| 484 | 3300046472 | Ga0495580_0034346 | Ga0495580_0034346_1201_2154 | 298 |
| 485 | 3300046473 | Ga0495582_0017363 | Ga0495582_0017363_2775_3728 | 298 |
| 486 | 3300046473 | Ga0495582_0124859 | Ga0495582_0124859_451_1410 | 298 |
| 487 | 3300046475 | Ga0495639_0006366 | Ga0495639_0006366_211_1164 | 298 |
| 488 | 3300046476 | Ga0495662_0015742 | Ga0495662_0015742_2367_3326 | 298 |
| 489 | 3300046477 | Ga0495664_0000004 | Ga0495664_0000004_116934_117893 | 298 |
| 490 | 3300046477 | Ga0495664_0014315 | Ga0495664_0014315_406_1359 | 298 |
| 491 | 3300046477 | Ga0495664_0027914 | Ga0495664_0027914_1734_2687 | 298 |
| 492 | 3300046511 | Ga0495608_0000017 | Ga0495608_0000017_116921_117880 | 298 |
| 493 | 3300046514 | Ga0495618_0000006 | Ga0495618_0000006_76027_76986 | 298 |
| 494 | 3300046514 | Ga0495618_0008025 | Ga0495618_0008025_2915_3868 | 298 |
| 495 | 3300046516 | Ga0495628_0000001 | Ga0495628_0000001_116923_117882 | 298 |
| 496 | 3300046516 | Ga0495628_0057268 | Ga0495628_0057268_1296_2249 | 298 |
| 497 | 3300046517 | Ga0495630_0000947 | Ga0495630_0000947_12805_13764 | 298 |
| 498 | 3300046517 | Ga0495630_0010876 | Ga0495630_0010876_3911_4864 | 298 |
| 499 | 3300046529 | Ga0495652_0000002 | Ga0495652_0000002_331457_332416 | 298 |
| 500 | 3300046533 | Ga0495640_0000001 | Ga0495640_0000001_425461_426420 | 298 |
| 501 | 3300046533 | Ga0495640_0198621 | Ga0495640_0198621_65_1018 | 298 |
| 502 | 3300046535 | Ga0495586_0148045 | Ga0495586_0148045_234_1187 | 298 |
| 503 | 3300046536 | Ga0495587_0000008 | Ga0495587_0000008_117141_118100 | 298 |
| 504 | 3300046543 | Ga0495645_0000002 | Ga0495645_0000002_116936_117895 | 298 |
| 505 | 3300046543 | Ga0495645_0033979 | Ga0495645_0033979_2091_3044 | 298 |
| 506 | 3300046559 | Ga0495667_0000029 | Ga0495667_0000029_116932_117891 | 298 |
| 507 | 3300046559 | Ga0495667_0086148 | Ga0495667_0086148_406_1359 | 298 |
| 508 | 3300046642 | Ga0495634_0000082 | Ga0495634_0000082_71786_72745 | 298 |
| 509 | 3300046642 | Ga0495634_0013859 | Ga0495634_0013859_1970_2923 | 298 |
| 510 | 3300046663 | Ga0495635_0000002 | Ga0495635_0000002_369042_370001 | 298 |
| 511 | 3300046675 | Ga0495657_0000459 | Ga0495657_0000459_1447_2406 | 298 |
| 512 | 3300046678 | Ga0495599_0000104 | Ga0495599_0000104_38649_39608 | 298 |
| 513 | 3300046678 | Ga0495599_0058365 | Ga0495599_0058365_159_1112 | 298 |
| 514 | 3300046679 | Ga0495623_0000691 | Ga0495623_0000691_851_1810 | 298 |
| 515 | 3300046679 | Ga0495623_0080930 | Ga0495623_0080930_33_986 | 298 |
| 516 | 3300046679 | Ga0495623_0170233 | Ga0495623_0170233_153_1109 | 298 |
| 517 | 3300046680 | Ga0495646_0000064 | Ga0495646_0000064_43367_44326 | 298 |
| 518 | 3300046680 | Ga0495646_0020683 | Ga0495646_0020683_2026_2979 | 298 |
| 519 | 3300046689 | Ga0495613_0006515 | Ga0495613_0006515_6924_7883 | 298 |
| 520 | 3300046689 | Ga0495613_0053163 | Ga0495613_0053163_1199_2152 | 298 |
| 521 | 3300046809 | Ga0495600_0000010 | Ga0495600_0000010_122172_123131 | 298 |
| 522 | 3300047315 | Ga0495581_0009913 | Ga0495581_0009913_3090_4049 | 298 |
| 523 | 3300047317 | Ga0495604_0000009 | Ga0495604_0000009_208410_209369 | 298 |
| 524 | 3300047319 | Ga0495674_0000002 | Ga0495674_0000002_116924_117883 | 298 |
| 525 | 3300047322 | Ga0495680_0000752 | Ga0495680_0000752_34347_35306 | 298 |
| 526 | 3300047444 | Ga0495675_0000517 | Ga0495675_0000517_14131_15090 | 298 |
| 527 | 3300047471 | Ga0495684_0000006 | Ga0495684_0000006_116883_117842 | 298 |
| 528 | 3300047673 | Ga0495593_0034416 | Ga0495593_0034416_643_1602 | 298 |
| 529 | 3300047673 | Ga0495593_0076280 | Ga0495593_0076280_101_1054 | 298 |
| 530 | 3300048088 | Ga0495602_0000005 | Ga0495602_0000005_227791_228750 | 298 |
| 531 | 3300048904 | Ga0496101_0327935 | Ga0496101_0327935_164_1117 | 298 |
| 532 | 3300048905 | Ga0496102_0024139 | Ga0496102_0024139_486_1439 | 298 |
| 533 | 3300048905 | Ga0496102_0042326 | Ga0496102_0042326_1607_2563 | 298 |
| 534 | 3300048905 | Ga0496102_0063150 | Ga0496102_0063150_1027_1980 | 298 |
| 535 | 3300048906 | Ga0496103_0058010 | Ga0496103_0058010_992_1948 | 298 |
| 536 | 3300048907 | Ga0496104_0009285 | Ga0496104_0009285_1519_2472 | 298 |
| 537 | 3300048907 | Ga0496104_0014451 | Ga0496104_0014451_4439_5395 | 298 |
| 538 | 3300048907 | Ga0496104_0038722 | Ga0496104_0038722_1589_2542 | 298 |
| 539 | 3300048908 | Ga0496105_0014038 | Ga0496105_0014038_1737_2693 | 298 |
| 540 | 3300048908 | Ga0496105_0033884 | Ga0496105_0033884_1717_2670 | 298 |
| 541 | 3300048911 | Ga0496108_0012829 | Ga0496108_0012829_4268_5224 | 298 |
| 542 | 3300048911 | Ga0496108_0024393 | Ga0496108_0024393_674_1627 | 298 |
| 543 | 3300048912 | Ga0496109_0006681 | Ga0496109_0006681_6901_7854 | 298 |
| 544 | 3300048912 | Ga0496109_0018409 | Ga0496109_0018409_3567_4523 | 298 |
| 545 | 3300048912 | Ga0496109_0020910 | Ga0496109_0020910_1625_2578 | 298 |
| 546 | 3300048913 | Ga0496110_0001819 | Ga0496110_0001819_192_1145 | 298 |
| 547 | 3300048913 | Ga0496110_0011940 | Ga0496110_0011940_3964_4920 | 298 |
| 548 | 3300048913 | Ga0496110_0050354 | Ga0496110_0050354_2416_3369 | 298 |
| 549 | 3300048914 | Ga0496111_0021445 | Ga0496111_0021445_1950_2906 | 298 |
| 550 | 3300048914 | Ga0496111_0040428 | Ga0496111_0040428_2230_3183 | 298 |
| 551 | 3300048915 | Ga0496112_0000979 | Ga0496112_0000979_1587_2543 | 298 |
| 552 | 3300048915 | Ga0496112_0060945 | Ga0496112_0060945_2423_3376 | 298 |
| 553 | 3300048916 | Ga0496113_0010030 | Ga0496113_0010030_663_1616 | 298 |
| 554 | 3300048916 | Ga0496113_0015988 | Ga0496113_0015988_1417_2373 | 298 |
| 555 | 3300048918 | Ga0496115_0080961 | Ga0496115_0080961_86_1039 | 298 |
| 556 | 3300050513 | nmdc:mga0rr50_19152_c1 | nmdc:mga0rr50_19152_c1_3423_4379 | 298 |
| 557 | 3300050514 | nmdc:mga08x19_24_c1 | nmdc:mga08x19_24_c1_218645_219601 | 298 |
| 558 | 3300053077 | Ga0495601_0000002 | Ga0495601_0000002_193579_194538 | 298 |
| 559 | 3300053078 | Ga0495612_0000010 | Ga0495612_0000010_129467_130426 | 298 |
| 560 | 3300053078 | Ga0495612_0024650 | Ga0495612_0024650_955_1908 | 298 |
| 561 | 3300053078 | Ga0495612_0028435 | Ga0495612_0028435_1120_2073 | 298 |
| 562 | 3300053080 | Ga0500635_0002728 | Ga0500635_0002728_2932_3885 | 298 |
| 563 | 3300053084 | Ga0495595_0001077 | Ga0495595_0001077_1095_2054 | 298 |
| 564 | 3300053085 | Ga0495619_0000019 | Ga0495619_0000019_152915_153874 | 298 |
| 565 | 3300053085 | Ga0495619_0021717 | Ga0495619_0021717_3036_3989 | 298 |
| 566 | 3300053085 | Ga0495619_0076522 | Ga0495619_0076522_718_1671 | 298 |
| 567 | 3300053102 | Ga0500554_004224 | Ga0500554_004224_1517_2470 | 298 |
| 568 | 3300053150 | Ga0500603_000117 | Ga0500603_000117_13579_14532 | 298 |
| 569 | 3300053178 | Ga0500637_0005039 | Ga0500637_0005039_247_1200 | 298 |
| 570 | iso_pu_bacteria | 2858688981 | 2858698379 | 298 |
| 571 | 3300005344 | Ga0070661_100028320 | Ga0070661_1000283202 | 299 |
| 572 | 3300005471 | Ga0070698_100112606 | Ga0070698_1001126062 | 299 |
| 573 | 3300005577 | Ga0068857_100438020 | Ga0068857_1004380201 | 299 |
| 574 | 3300005578 | Ga0068854_100048773 | Ga0068854_1000487732 | 299 |
| 575 | 3300006914 | Ga0075436_100015236 | Ga0075436_1000152365 | 299 |
| 576 | 3300009545 | Ga0105237_10174010 | Ga0105237_101740102 | 299 |
| 577 | 3300013105 | Ga0157369_10488664 | Ga0157369_104886641 | 299 |
| 578 | 3300014969 | Ga0157376_10007767 | Ga0157376_100077675 | 299 |
| 579 | 3300021384 | Ga0213876_10040212 | Ga0213876_100402123 | 299 |
| 580 | 3300021441 | Ga0213871_10046988 | Ga0213871_100469881 | 299 |
| 581 | 3300025915 | Ga0207693_10229152 | Ga0207693_102291522 | 299 |
| 582 | 3300025933 | Ga0207706_10149903 | Ga0207706_101499032 | 299 |
| 583 | 3300025944 | Ga0207661_10273255 | Ga0207661_102732552 | 299 |
| 584 | 3300025949 | Ga0207667_10174121 | Ga0207667_101741212 | 299 |
| 585 | 3300026078 | Ga0207702_10573768 | Ga0207702_105737681 | 299 |
| 586 | 3300026142 | Ga0207698_10249347 | Ga0207698_102493472 | 299 |
| 587 | 3300028556 | Ga0265337_1000530 | Ga0265337_100053016 | 299 |
| 588 | 3300035114 | Ga0373939_0008062 | Ga0373939_0008062_430_1389 | 299 |
| 589 | 3300036401 | Ga0373937_0006604 | Ga0373937_0006604_3865_4824 | 299 |
| 590 | 3300037853 | Ga0436364_0329188 | Ga0436364_0329188_13137_14096 | 299 |
| 591 | 3300039437 | Ga0436365_0190362 | Ga0436365_0190362_10813_11772 | 299 |
| 592 | 3300039438 | Ga0436360_0651368 | Ga0436360_0651368_78_1040 | 299 |
| 593 | 3300039438 | Ga0436360_1161538 | Ga0436360_1161538_442_1401 | 299 |
| 594 | 3300039450 | Ga0436363_0242104 | Ga0436363_0242104_4179_5132 | 299 |
| 595 | 3300039450 | Ga0436363_0981994 | Ga0436363_0981994_212_1171 | 299 |
| 596 | 3300039453 | Ga0436362_0204855 | Ga0436362_0204855_13539_14498 | 299 |
| 597 | 3300044694 | Ga0466963_0008212 | Ga0466963_0008212_3348_4328 | 299 |
| 598 | 3300044719 | Ga0466971_0018688 | Ga0466971_0018688_1217_2170 | 299 |
| 599 | 3300044842 | Ga0466957_0094565 | Ga0466957_0094565_754_1707 | 299 |
| 600 | 3300045976 | Ga0466967_0043726 | Ga0466967_0043726_325_1305 | 299 |
| 601 | 3300046559 | Ga0495667_0018573 | Ga0495667_0018573_2640_3599 | 299 |
| 602 | 3300046675 | Ga0495657_0026469 | Ga0495657_0026469_962_1921 | 299 |
| 603 | 3300046809 | Ga0495600_0040429 | Ga0495600_0040429_269_1228 | 299 |
| 604 | 3300047317 | Ga0495604_0069786 | Ga0495604_0069786_1649_2608 | 299 |
| 605 | 3300047322 | Ga0495680_0043785 | Ga0495680_0043785_28_987 | 299 |
| 606 | 3300048088 | Ga0495602_0200878 | Ga0495602_0200878_526_1485 | 299 |
| 607 | 3300048909 | Ga0496106_0284735 | Ga0496106_0284735_239_1192 | 299 |
| 608 | 3300048910 | Ga0496107_0032136 | Ga0496107_0032136_2625_3578 | 299 |
| 609 | 3300048915 | Ga0496112_0005973 | Ga0496112_0005973_8695_9648 | 299 |
| 610 | 3300053077 | Ga0495601_0019493 | Ga0495601_0019493_1620_2579 | 299 |
| 611 | 3300053078 | Ga0495612_0048112 | Ga0495612_0048112_321_1280 | 299 |
| 612 | 3300053084 | Ga0495595_0124433 | Ga0495595_0124433_77_1036 | 299 |
| 613 | 3300053085 | Ga0495619_0005347 | Ga0495619_0005347_1315_2274 | 299 |
| 614 | 3300005329 | Ga0070683_100147953 | Ga0070683_1001479533 | 300 |
| 615 | 3300005331 | Ga0070670_100011727 | Ga0070670_1000117276 | 300 |
| 616 | 3300005335 | Ga0070666_10220353 | Ga0070666_102203532 | 300 |
| 617 | 3300005340 | Ga0070689_100013029 | Ga0070689_1000130295 | 300 |
| 618 | 3300005439 | Ga0070711_100019808 | Ga0070711_1000198082 | 300 |
| 619 | 3300005455 | Ga0070663_100013409 | Ga0070663_1000134092 | 300 |
| 620 | 3300005468 | Ga0070707_100177400 | Ga0070707_1001774002 | 300 |
| 621 | 3300005616 | Ga0068852_100114443 | Ga0068852_1001144433 | 300 |
| 622 | 3300009093 | Ga0105240_10178313 | Ga0105240_101783132 | 300 |
| 623 | 3300009098 | Ga0105245_10151080 | Ga0105245_101510803 | 300 |
| 624 | 3300009177 | Ga0105248_10075361 | Ga0105248_100753615 | 300 |
| 625 | 3300009551 | Ga0105238_10263085 | Ga0105238_102630852 | 300 |
| 626 | 3300013100 | Ga0157373_10195093 | Ga0157373_101950932 | 300 |
| 627 | 3300013105 | Ga0157369_10135780 | Ga0157369_101357803 | 300 |
| 628 | 3300014325 | Ga0163163_10084903 | Ga0163163_100849033 | 300 |
| 629 | 3300014497 | Ga0182008_10089019 | Ga0182008_100890192 | 300 |
| 630 | 3300014968 | Ga0157379_10193985 | Ga0157379_101939852 | 300 |
| 631 | 3300025903 | Ga0207680_10142553 | Ga0207680_101425532 | 300 |
| 632 | 3300025913 | Ga0207695_10028695 | Ga0207695_100286954 | 300 |
| 633 | 3300025916 | Ga0207663_10127639 | Ga0207663_101276392 | 300 |
| 634 | 3300025922 | Ga0207646_10235966 | Ga0207646_102359662 | 300 |
| 635 | 3300025925 | Ga0207650_10005625 | Ga0207650_100056253 | 300 |
| 636 | 3300025926 | Ga0207659_10120276 | Ga0207659_101202762 | 300 |
| 637 | 3300025928 | Ga0207700_10186926 | Ga0207700_101869262 | 300 |
| 638 | 3300025931 | Ga0207644_10001557 | Ga0207644_1000155713 | 300 |
| 639 | 3300025932 | Ga0207690_10005073 | Ga0207690_100050739 | 300 |
| 640 | 3300025932 | Ga0207690_10097558 | Ga0207690_100975582 | 300 |
| 641 | 3300025936 | Ga0207670_10013168 | Ga0207670_100131684 | 300 |
| 642 | 3300025944 | Ga0207661_10004929 | Ga0207661_100049292 | 300 |
| 643 | 3300026067 | Ga0207678_10079624 | Ga0207678_100796242 | 300 |
| 644 | 3300026078 | Ga0207702_10426829 | Ga0207702_104268292 | 300 |
| 645 | 3300026116 | Ga0207674_10166840 | Ga0207674_101668402 | 300 |
| 646 | 3300026142 | Ga0207698_10034168 | Ga0207698_100341683 | 300 |
| 647 | 3300035089 | Ga0373944_0000531 | Ga0373944_0000531_5787_6758 | 300 |
| 648 | 3300035111 | Ga0373923_0022134 | Ga0373923_0022134_1312_2265 | 300 |
| 649 | 3300035170 | Ga0373943_0000284 | Ga0373943_0000284_15565_16536 | 300 |
| 650 | 3300035170 | Ga0373943_0004873 | Ga0373943_0004873_1053_2006 | 300 |
| 651 | 3300035171 | Ga0373946_0000993 | Ga0373946_0000993_3738_4709 | 300 |
| 652 | 3300035171 | Ga0373946_0011943 | Ga0373946_0011943_1148_2101 | 300 |
| 653 | 3300035172 | Ga0373955_0018376 | Ga0373955_0018376_252_1205 | 300 |
| 654 | 3300035692 | Ga0373935_0003583 | Ga0373935_0003583_3717_4688 | 300 |
| 655 | 3300035692 | Ga0373935_0007237 | Ga0373935_0007237_2483_3436 | 300 |
| 656 | 3300035695 | Ga0373927_0001879 | Ga0373927_0001879_13671_14624 | 300 |
| 657 | 3300035695 | Ga0373927_0004424 | Ga0373927_0004424_6062_7033 | 300 |
| 658 | 3300035725 | Ga0373947_0002343 | Ga0373947_0002343_6037_7008 | 300 |
| 659 | 3300035725 | Ga0373947_0006664 | Ga0373947_0006664_2039_2992 | 300 |
| 660 | 3300036401 | Ga0373937_0018911 | Ga0373937_0018911_3725_4678 | 300 |
| 661 | 3300037068 | Ga0373925_0001023 | Ga0373925_0001023_6094_7065 | 300 |
| 662 | 3300037068 | Ga0373925_0067102 | Ga0373925_0067102_869_1822 | 300 |
| 663 | 3300037312 | Ga0395899_0007698 | Ga0395899_0007698_2209_3186 | 300 |
| 664 | 3300037418 | Ga0395900_0009613 | Ga0395900_0009613_2634_3587 | 300 |
| 665 | 3300037418 | Ga0395900_0011548 | Ga0395900_0011548_20_997 | 300 |
| 666 | 3300037418 | Ga0395900_0027919 | Ga0395900_0027919_3073_4026 | 300 |
| 667 | 3300037466 | Ga0395898_0008544 | Ga0395898_0008544_7730_8707 | 300 |
| 668 | 3300037466 | Ga0395898_0038553 | Ga0395898_0038553_1695_2648 | 300 |
| 669 | 3300038443 | Ga0395901_0007299 | Ga0395901_0007299_7898_8875 | 300 |
| 670 | 3300038443 | Ga0395901_0013071 | Ga0395901_0013071_1479_2432 | 300 |
| 671 | 3300038443 | Ga0395901_0576617 | Ga0395901_0576617_120_1073 | 300 |
| 672 | 3300039437 | Ga0436365_1183719 | Ga0436365_1183719_430_1386 | 300 |
| 673 | 3300039447 | Ga0436361_0522444 | Ga0436361_0522444_688_1641 | 300 |
| 674 | 3300046454 | Ga0495592_0036029 | Ga0495592_0036029_518_1471 | 300 |
| 675 | 3300046455 | Ga0495603_0000351 | Ga0495603_0000351_9081_10034 | 300 |
| 676 | 3300046459 | Ga0495629_0000250 | Ga0495629_0000250_1663_2616 | 300 |
| 677 | 3300046459 | Ga0495629_0008760 | Ga0495629_0008760_2438_3409 | 300 |
| 678 | 3300046461 | Ga0495641_0014632 | Ga0495641_0014632_974_1927 | 300 |
| 679 | 3300046462 | Ga0495651_0132999 | Ga0495651_0132999_624_1577 | 300 |
| 680 | 3300046463 | Ga0495653_0077552 | Ga0495653_0077552_616_1569 | 300 |
| 681 | 3300046463 | Ga0495653_0231853 | Ga0495653_0231853_221_1192 | 300 |
| 682 | 3300046472 | Ga0495580_0000536 | Ga0495580_0000536_4718_5671 | 300 |
| 683 | 3300046472 | Ga0495580_0017120 | Ga0495580_0017120_1936_2907 | 300 |
| 684 | 3300046473 | Ga0495582_0000021 | Ga0495582_0000021_80729_81682 | 300 |
| 685 | 3300046475 | Ga0495639_0000030 | Ga0495639_0000030_1054_2007 | 300 |
| 686 | 3300046476 | Ga0495662_0000399 | Ga0495662_0000399_5307_6260 | 300 |
| 687 | 3300046477 | Ga0495664_0016703 | Ga0495664_0016703_919_1872 | 300 |
| 688 | 3300046499 | Ga0495594_0000153 | Ga0495594_0000153_11328_12281 | 300 |
| 689 | 3300046511 | Ga0495608_0071822 | Ga0495608_0071822_827_1798 | 300 |
| 690 | 3300046514 | Ga0495618_0044730 | Ga0495618_0044730_1340_2311 | 300 |
| 691 | 3300046514 | Ga0495618_0139890 | Ga0495618_0139890_158_1111 | 300 |
| 692 | 3300046516 | Ga0495628_0072036 | Ga0495628_0072036_1147_2100 | 300 |
| 693 | 3300046517 | Ga0495630_0093130 | Ga0495630_0093130_391_1344 | 300 |
| 694 | 3300046526 | Ga0495666_0004324 | Ga0495666_0004324_4662_5633 | 300 |
| 695 | 3300046526 | Ga0495666_0033401 | Ga0495666_0033401_1368_2321 | 300 |
| 696 | 3300046529 | Ga0495652_0108045 | Ga0495652_0108045_328_1281 | 300 |
| 697 | 3300046531 | Ga0495665_0000932 | Ga0495665_0000932_13324_14277 | 300 |
| 698 | 3300046531 | Ga0495665_0002715 | Ga0495665_0002715_3976_4947 | 300 |
| 699 | 3300046533 | Ga0495640_0002049 | Ga0495640_0002049_13278_14231 | 300 |
| 700 | 3300046533 | Ga0495640_0025921 | Ga0495640_0025921_3103_4074 | 300 |
| 701 | 3300046559 | Ga0495667_0017281 | Ga0495667_0017281_800_1753 | 300 |
| 702 | 3300046642 | Ga0495634_0001430 | Ga0495634_0001430_19967_20920 | 300 |
| 703 | 3300046642 | Ga0495634_0005270 | Ga0495634_0005270_3499_4470 | 300 |
| 704 | 3300046663 | Ga0495635_0001998 | Ga0495635_0001998_8415_9386 | 300 |
| 705 | 3300046663 | Ga0495635_0005162 | Ga0495635_0005162_3377_4330 | 300 |
| 706 | 3300046674 | Ga0495588_0000909 | Ga0495588_0000909_9643_10596 | 300 |
| 707 | 3300046675 | Ga0495657_0121297 | Ga0495657_0121297_350_1321 | 300 |
| 708 | 3300046680 | Ga0495646_0044324 | Ga0495646_0044324_1556_2509 | 300 |
| 709 | 3300046681 | Ga0495647_0000795 | Ga0495647_0000795_2983_3936 | 300 |
| 710 | 3300046681 | Ga0495647_0033717 | Ga0495647_0033717_383_1354 | 300 |
| 711 | 3300046683 | Ga0495658_0000400 | Ga0495658_0000400_14535_15488 | 300 |
| 712 | 3300046689 | Ga0495613_0001829 | Ga0495613_0001829_10491_11462 | 300 |
| 713 | 3300046689 | Ga0495613_0005697 | Ga0495613_0005697_4590_5543 | 300 |
| 714 | 3300046690 | Ga0495624_0000736 | Ga0495624_0000736_1054_2007 | 300 |
| 715 | 3300046690 | Ga0495624_0004952 | Ga0495624_0004952_8401_9372 | 300 |
| 716 | 3300046809 | Ga0495600_0061453 | Ga0495600_0061453_304_1257 | 300 |
| 717 | 3300046809 | Ga0495600_0125121 | Ga0495600_0125121_521_1492 | 300 |
| 718 | 3300047315 | Ga0495581_0000047 | Ga0495581_0000047_36740_37693 | 300 |
| 719 | 3300047319 | Ga0495674_0000101 | Ga0495674_0000101_57658_58611 | 300 |
| 720 | 3300047321 | Ga0495676_0010355 | Ga0495676_0010355_3636_4607 | 300 |
| 721 | 3300047471 | Ga0495684_0028735 | Ga0495684_0028735_2168_3121 | 300 |
| 722 | 3300047673 | Ga0495593_0000483 | Ga0495593_0000483_17630_18583 | 300 |
| 723 | 3300047673 | Ga0495593_0013064 | Ga0495593_0013064_1104_2075 | 300 |
| 724 | 3300048903 | Ga0496100_0117948 | Ga0496100_0117948_540_1514 | 300 |
| 725 | 3300048915 | Ga0496112_0044005 | Ga0496112_0044005_168_1142 | 300 |
| 726 | 3300048916 | Ga0496113_0033714 | Ga0496113_0033714_1889_2863 | 300 |
| 727 | 3300048929 | Ga0496126_0009299 | Ga0496126_0009299_9249_10202 | 300 |
| 728 | 3300048929 | Ga0496126_0123675 | Ga0496126_0123675_1245_2198 | 300 |
| 729 | 3300053085 | Ga0495619_0005973 | Ga0495619_0005973_2558_3529 | 300 |
| 730 | 3300053085 | Ga0495619_0094576 | Ga0495619_0094576_697_1650 | 300 |
| 731 | iso_pu_bacteria | 2791355137 | 2792833460 | 300 |
| 732 | iso_pu_bacteria | 2904615490 | 2904622176 | 300 |
| 733 | 3300024227 | Ga0228598_1000253 | Ga0228598_10002539 | 301 |
| 734 | 3300025915 | Ga0207693_10252385 | Ga0207693_102523852 | 301 |
| 735 | 3300035118 | Ga0373954_0028821 | Ga0373954_0028821_1562_2533 | 301 |
| 736 | 3300035172 | Ga0373955_0020477 | Ga0373955_0020477_455_1426 | 301 |
| 737 | 3300035410 | Ga0373924_0023187 | Ga0373924_0023187_1170_2141 | 301 |
| 738 | 3300036401 | Ga0373937_0284820 | Ga0373937_0284820_560_1537 | 301 |
| 739 | 3300037312 | Ga0395899_0028963 | Ga0395899_0028963_714_1694 | 301 |
| 740 | 3300037418 | Ga0395900_0002181 | Ga0395900_0002181_11784_12764 | 301 |
| 741 | 3300038443 | Ga0395901_0004745 | Ga0395901_0004745_956_1936 | 301 |
| 742 | 3300045049 | Ga0466959_0033591 | Ga0466959_0033591_1245_2201 | 301 |
| 743 | 3300046454 | Ga0495592_0094362 | Ga0495592_0094362_174_1145 | 301 |
| 744 | 3300046462 | Ga0495651_0034944 | Ga0495651_0034944_961_1932 | 301 |
| 745 | 3300046463 | Ga0495653_0046364 | Ga0495653_0046364_1999_2970 | 301 |
| 746 | 3300046473 | Ga0495582_0155844 | Ga0495582_0155844_75_1046 | 301 |
| 747 | 3300046529 | Ga0495652_0170400 | Ga0495652_0170400_270_1262 | 301 |
| 748 | 3300046533 | Ga0495640_0193816 | Ga0495640_0193816_195_1166 | 301 |
| 749 | 3300046536 | Ga0495587_0050833 | Ga0495587_0050833_1363_2334 | 301 |
| 750 | 3300046678 | Ga0495599_0012063 | Ga0495599_0012063_2493_3464 | 301 |
| 751 | 3300046678 | Ga0495599_0138546 | Ga0495599_0138546_278_1270 | 301 |
| 752 | 3300046679 | Ga0495623_0033849 | Ga0495623_0033849_22_993 | 301 |
| 753 | 3300047317 | Ga0495604_0041003 | Ga0495604_0041003_574_1545 | 301 |
| 754 | 3300047322 | Ga0495680_0037213 | Ga0495680_0037213_1355_2326 | 301 |
| 755 | 3300047444 | Ga0495675_0033606 | Ga0495675_0033606_245_1216 | 301 |
| 756 | 3300048088 | Ga0495602_0054210 | Ga0495602_0054210_2126_3097 | 301 |
| 757 | 3300048904 | Ga0496101_0026338 | Ga0496101_0026338_650_1648 | 301 |
| 758 | 3300048907 | Ga0496104_0068699 | Ga0496104_0068699_1939_2937 | 301 |
| 759 | 3300048909 | Ga0496106_0062041 | Ga0496106_0062041_230_1228 | 301 |
| 760 | 3300048911 | Ga0496108_0099668 | Ga0496108_0099668_802_1800 | 301 |
| 761 | 3300053077 | Ga0495601_0051588 | Ga0495601_0051588_684_1676 | 301 |
| 762 | 3300053078 | Ga0495612_0097979 | Ga0495612_0097979_27_998 | 301 |
| 763 | 3300053084 | Ga0495595_0002209 | Ga0495595_0002209_4736_5728 | 301 |
| 764 | 3300053085 | Ga0495619_0017762 | Ga0495619_0017762_2553_3545 | 301 |
| 765 | 3300053085 | Ga0495619_0101361 | Ga0495619_0101361_113_1084 | 301 |
| 766 | 3300005536 | Ga0070697_100279858 | Ga0070697_1002798582 | 302 |
| 767 | 3300005548 | Ga0070665_100211366 | Ga0070665_1002113662 | 302 |
| 768 | 3300006871 | Ga0075434_100212903 | Ga0075434_1002129032 | 302 |
| 769 | 3300050512 | nmdc:mga0n895_31651_c1 | nmdc:mga0n895_31651_c1_1082_2041 | 302 |
| 770 | 3300005577 | Ga0068857_100023092 | Ga0068857_1000230922 | 303 |
| 771 | 3300005937 | Ga0081455_10001982 | Ga0081455_1000198220 | 303 |
| 772 | 3300009093 | Ga0105240_10003221 | Ga0105240_1000322114 | 303 |
| 773 | 3300009545 | Ga0105237_10261905 | Ga0105237_102619052 | 303 |
| 774 | 3300021388 | Ga0213875_10002629 | Ga0213875_100026294 | 303 |
| 775 | 3300026116 | Ga0207674_10027845 | Ga0207674_100278453 | 303 |
| 776 | 3300037418 | Ga0395900_0090074 | Ga0395900_0090074_832_1809 | 303 |
| 777 | 3300037466 | Ga0395898_0021759 | Ga0395898_0021759_709_1686 | 303 |
| 778 | 3300037853 | Ga0436364_0229137 | Ga0436364_0229137_7032_8048 | 303 |
| 779 | 3300005355 | Ga0070671_100006289 | Ga0070671_1000062892 | 306 |
| 780 | 3300009177 | Ga0105248_10027250 | Ga0105248_100272504 | 306 |
| 781 | 3300021388 | Ga0213875_10009158 | Ga0213875_100091583 | 306 |
| 782 | 3300025931 | Ga0207644_10005689 | Ga0207644_100056894 | 306 |
| 783 | 3300025941 | Ga0207711_10048325 | Ga0207711_100483253 | 306 |
| 784 | 3300037853 | Ga0436364_0787255 | Ga0436364_0787255_1252_2235 | 306 |
| 785 | 3300048912 | Ga0496109_0073852 | Ga0496109_0073852_952_1968 | 306 |
| 786 | 3300048916 | Ga0496113_0072730 | Ga0496113_0072730_1500_2516 | 306 |
| 787 | 3300021388 | Ga0213875_10005169 | Ga0213875_100051694 | 307 |
| 788 | 3300037853 | Ga0436364_1358002 | Ga0436364_1358002_9995_10978 | 307 |
| 789 | 3300048929 | Ga0496126_0115195 | Ga0496126_0115195_188_1171 | 307 |
| 790 | 3300005445 | Ga0070708_100189092 | Ga0070708_1001890922 | 308 |
| 791 | 3300005467 | Ga0070706_100059063 | Ga0070706_1000590632 | 308 |
| 792 | 3300005518 | Ga0070699_100075570 | Ga0070699_1000755703 | 308 |
| 793 | 3300005536 | Ga0070697_100039824 | Ga0070697_1000398242 | 308 |
| 794 | 3300035691 | Ga0373931_0082587 | Ga0373931_0082587_195_1175 | 308 |
| 795 | 3300036401 | Ga0373937_0044033 | Ga0373937_0044033_603_1580 | 308 |
| 796 | 3300037853 | Ga0436364_1329714 | Ga0436364_1329714_39046_40101 | 308 |
| 797 | 3300039437 | Ga0436365_1165568 | Ga0436365_1165568_1483_2562 | 308 |
| 798 | 3300039447 | Ga0436361_0520146 | Ga0436361_0520146_170_1153 | 308 |
| 799 | 3300039453 | Ga0436362_0849335 | Ga0436362_0849335_658_1635 | 308 |
| 800 | 3300049574 | Ga0501038_0146473 | Ga0501038_0146473_214_1197 | 308 |
| 801 | 3300037853 | Ga0436364_0560002 | Ga0436364_0560002_68789_69877 | 310 |
| 802 | 3300038443 | Ga0395901_0031794 | Ga0395901_0031794_2519_3496 | 310 |
| 803 | 3300005327 | Ga0070658_10001212 | Ga0070658_1000121213 | 313 |
| 804 | 3300005336 | Ga0070680_100005766 | Ga0070680_1000057663 | 313 |
| 805 | 3300005339 | Ga0070660_100102218 | Ga0070660_1001022181 | 313 |
| 806 | 3300005341 | Ga0070691_10006751 | Ga0070691_100067514 | 313 |
| 807 | 3300005458 | Ga0070681_10003586 | Ga0070681_1000358612 | 313 |
| 808 | 3300005530 | Ga0070679_100003590 | Ga0070679_1000035904 | 313 |
| 809 | 3300005563 | Ga0068855_100007073 | Ga0068855_1000070738 | 313 |
| 810 | 3300025912 | Ga0207707_10021345 | Ga0207707_100213454 | 313 |
| 811 | 3300025913 | Ga0207695_10069421 | Ga0207695_100694212 | 313 |
| 812 | 3300025917 | Ga0207660_10047433 | Ga0207660_100474332 | 313 |
| 813 | 3300025919 | Ga0207657_10039615 | Ga0207657_100396153 | 313 |
| 814 | 3300025949 | Ga0207667_10174756 | Ga0207667_101747562 | 313 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7kyp-assembly4.cif.gz_N | psabc from streptococcus pneumoniae in complex with fab | 0.4973 | 43 | 296 |
| 7kyp-assembly4.cif.gz_N | psabc from streptococcus pneumoniae in complex with fab | 0.4574 | 43 | 296 |
| 7kyo-assembly1.cif.gz_C-2 | psabc from streptococcus pneumoniae in complex with fab | 0.4316 | 43 | 295 |
| 7kyo-assembly1.cif.gz_C-2 | psabc from streptococcus pneumoniae in complex with fab | 0.4151 | 43 | 295 |
| 2nq2-assembly1.cif.gz_B | an inward-facing conformation of a putative metal-chelate type abc transporter. | 0.3763 | 43 | 309 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58666_4_320_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.74 | 43 | 298 | 1.10.3470.10 |
| af_P39328_55_321_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.6969 | 43 | 295 | 1.10.3470.10 |
| af_P0AE26_50_315_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.6754 | 41 | 296 | 1.10.3470.10 |
| af_P39328_55_321_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.6622 | 43 | 295 | 1.10.3470.10 |
| af_P0AEX7_11_292_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.66 | 43 | 297 | 1.10.3470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5E4UUL1-F1-model_v4 | Inner-membrane translocator | 0.9118 | 16 | 313 |
GO:0005886
GO:0015658 |
| AF-A0A850HTY6-F1-model_v4 | deleted | 0.9099 | 43 | 310 |
|
| AF-A0A522TNS8-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9079 | 23 | 310 |
GO:0005886
GO:0015658 |
| AF-A0A1J5DGU4-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9023 | 17 | 313 |
GO:0005886
GO:0015658 |
| AF-D6V7Q8-F1-model_v4 | Inner-membrane translocator | 0.8943 | 29 | 308 |
GO:0005886
GO:0015658 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar