F481931

General Info

Members Datasets Scaffolds Average Seq Length
813 262 703 436

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10001530|Ga0105244_100015304
Length 463
Sequence VGRQKNLLKTKGAITMRVMKWSAIALAVTAASAQMATAAPFVSDQADAKGFVEGSTLDLKLRNYYFNRDKKNNPAPGGRSDKDWTQGIWANFSTGYTQGTIGVGVEAFGYGGLRLWGLDKYSGSGNLVTDANGDNEATQGKLGGAVKFRVSKTELKIGDMQPTSPVFAVGGSRLLPQTASGLSLQSSEIAGLDLEAGHFYSGTSQDDTSHDGSIWATYANGFNGLKASSADFVGGKYAVTDGLGVAFYAAKLEDIWDQYYGNVNYALPLGNDQSLAFDVNLYRTLDEGSAKAGSINNTTYSASAAYSFLAAHTITVAYQKVDGDTPFDYIGIGDNNRGGDSIFLANSVQYSDFNGPGEKSWQVRYDLNMTPYGVPGLSFMTRYLNGDNIDGTKVDASSAYANMYGADGKHHETNLEAKYVVQTGPAKDLSFRMRQAWHRGNDAQADGDVNEFRLIVDYPISIL

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231006 Pseudomonas sp. GM17 Isolate Nodule
5 2511231007 Pseudomonas sp. GM18 Isolate Nodule
6 2511231011 Pseudomonas sp. GM30 Isolate Nodule
7 2511231012 Pseudomonas sp. GM33 Isolate Nodule
8 2511231014 Pseudomonas sp. GM48 Isolate Nodule
9 2511231015 Pseudomonas sp. GM49 Isolate Nodule
10 2511231017 Pseudomonas sp. GM55 Isolate Nodule
11 2511231020 Pseudomonas sp. GM74 Isolate Nodule
12 2511231022 Pseudomonas sp. GM79 Isolate Nodule
13 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
14 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
15 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
16 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
17 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
18 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
19 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
20 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
21 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
22 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
23 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
24 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
25 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
26 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
27 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
28 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
29 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
30 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
31 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
32 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
33 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
34 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
35 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
36 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
37 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
38 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
39 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
40 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
41 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
42 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
43 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
44 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
45 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
46 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
47 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
48 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
49 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
50 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
51 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
52 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
53 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
54 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
55 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
56 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
57 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
58 2773857670 Pseudomonas sp. 478 Isolate Unclassified
59 2773857673 Pseudomonas sp. 443 Isolate Unclassified
60 2784132072 Pseudomonas sp. 460 Isolate Unclassified
61 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
62 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
63 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
64 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
65 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
66 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
67 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
68 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
69 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
70 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
71 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
72 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
73 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
74 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
75 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
76 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
77 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
78 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
79 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
80 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
81 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
82 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
83 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
84 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
85 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
86 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
87 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
88 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
89 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
90 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
91 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
92 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
93 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
94 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
95 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
96 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
99 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
100 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
101 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
114 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
115 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
136 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
137 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
138 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
139 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
140 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
141 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
142 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
143 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
144 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
145 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
146 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
147 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
148 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
149 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
150 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
151 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
152 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
153 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
154 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
155 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
156 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
157 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
158 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
161 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
162 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
165 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
166 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
167 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
168 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
169 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
170 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
171 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
172 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
173 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
174 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
175 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
176 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
179 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
180 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
181 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
182 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
183 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
184 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
185 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
186 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
187 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
188 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
189 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
190 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
193 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
194 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
195 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
196 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
197 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
198 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
201 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
202 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
203 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
204 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
205 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
206 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
207 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
208 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
209 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
210 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
211 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
212 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
213 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
214 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
215 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
216 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
217 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
218 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
219 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
220 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
221 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
222 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
223 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
224 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
225 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
226 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
227 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
228 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
229 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
230 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
235 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
236 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
237 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
238 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
239 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
240 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
241 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
242 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
243 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
244 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
245 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
246 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
247 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
249 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
250 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
251 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
252 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
255 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
256 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
257 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
258 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
259 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
260 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
261 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
262 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.98
Metatranscriptomes 0.49
Isolates 13.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.09
Nodule 2.83
Rhizoplane 4.31
Rhizosphere 79.09
Stem 0
Stem Tuber 0
Unclassified 11.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_392 2124908027 Bacteria 2985
2 SwRhRL2b_contig_98336 2162886007 Bacteria 6727
3 Ga0006562J51391_1002207 3300003578 Bacteria 2020
4 Ga0055536_1002325 3300003781 Bacteria 10752
5 Ga0055536_1002700 3300003781 Bacteria 9845
6 Ga0055530_10002793 3300003791 Bacteria 10752
7 Ga0055530_10009743 3300003791 Bacteria 3643
8 Ga0055540_1002152 3300003792 Bacteria 10736
9 Ga0055540_1021383 3300003792 Bacteria 1682
10 Ga0065714_10013074 3300005288 Bacteria 2280
11 Ga0065714_10065181 3300005288 Bacteria 12146
12 Ga0065714_10065183 3300005288 Bacteria 12142
13 Ga0065714_10067025 3300005288 Bacteria 5982
14 Ga0065714_10073498 3300005288 Bacteria 3176
15 Ga0065714_10114276 3300005288 Bacteria 1420
16 Ga0065704_10000858 3300005289 Bacteria 11648
17 Ga0065704_10097119 3300005289 Bacteria 2408
18 Ga0065712_10068617 3300005290 Bacteria 9641
19 Ga0065712_10073928 3300005290 Bacteria 4239
20 Ga0065712_10128938 3300005290 Bacteria 1573
21 Ga0070661_100003049 3300005344 Bacteria 11527
22 Ga0070669_100006310 3300005353 Bacteria 8549
23 Ga0068853_100036743 3300005539 Bacteria 4166
24 Ga0070664_100002357 3300005564 Bacteria 15173
25 Ga0075432_10001067 3300006058 Bacteria 8705
26 Ga0075432_10002018 3300006058 Bacteria 6747
27 Ga0075432_10017991 3300006058 Bacteria 2410
28 Ga0075436_100046986 3300006914 Bacteria 2977
29 Ga0075436_100058508 3300006914 Bacteria 2661
30 Ga0075436_100149473 3300006914 Bacteria 1643
31 Ga0079104_1000068 3300006946 Bacteria 154984
32 Ga0079104_1001875 3300006946 Bacteria 12732
33 Ga0079104_1012806 3300006946 Bacteria 2613
34 Ga0079104_1017455 3300006946 Bacteria 2062
35 Ga0105251_10000928 3300009011 Bacteria 26272
36 Ga0105251_10001627 3300009011 Bacteria 19033
37 Ga0105251_10003557 3300009011 Bacteria 11244
38 Ga0105251_10045513 3300009011 Bacteria 2115
39 Ga0105251_10083940 3300009011 Bacteria 1470
40 Ga0105251_10085812 3300009011 Bacteria 1450
41 Ga0105251_10087905 3300009011 Bacteria 1430
42 Ga0105244_10000457 3300009036 Bacteria 37377
43 Ga0105244_10001530 3300009036 Bacteria 18463
44 Ga0105244_10014163 3300009036 Bacteria 4623
45 Ga0105244_10014303 3300009036 Bacteria 4595
46 Ga0105244_10020147 3300009036 Bacteria 3708
47 Ga0105244_10025054 3300009036 Bacteria 3247
48 Ga0105244_10033038 3300009036 Bacteria 2732
49 Ga0105250_10015796 3300009092 Bacteria 3088
50 Ga0105250_10020880 3300009092 Bacteria 2644
51 Ga0105250_10028051 3300009092 Bacteria 2268
52 Ga0105250_10034606 3300009092 Bacteria 2027
53 Ga0105250_10049720 3300009092 Bacteria 1682
54 Ga0105242_10001214 3300009176 Bacteria 20319
55 Ga0105237_10000937 3300009545 Bacteria 39281
56 Ga0105246_10013579 3300011119 Bacteria 5109
57 Ga0105246_10163478 3300011119 Bacteria 1698
58 Ga0157345_1000120 3300012498 Bacteria 15343
59 Ga0157373_10000854 3300013100 Bacteria 23667
60 Ga0157373_10003808 3300013100 Bacteria 11406
61 Ga0157373_10008868 3300013100 Bacteria 7445
62 Ga0157373_10009997 3300013100 Bacteria 6992
63 Ga0157373_10014413 3300013100 Bacteria 5795
64 Ga0157371_10017480 3300013102 Bacteria 5326
65 Ga0157370_10013951 3300013104 Bacteria 8251
66 Ga0157370_10071997 3300013104 Bacteria 3261
67 Ga0157370_10079253 3300013104 Bacteria 3093
68 Ga0157370_10185787 3300013104 Bacteria 1930
69 Ga0157370_10241520 3300013104 Bacteria 1671
70 Ga0157370_10287252 3300013104 Bacteria 1519
71 Ga0157370_10292656 3300013104 Bacteria 1504
72 Ga0157369_10000251 3300013105 Bacteria 73814
73 Ga0157369_10000627 3300013105 Bacteria 45796
74 Ga0157369_10001667 3300013105 Bacteria 27075
75 Ga0157369_10101713 3300013105 Bacteria 3062
76 Ga0157369_10265159 3300013105 Bacteria 1791
77 Ga0163162_10095603 3300013306 Bacteria 3058
78 Ga0157375_10000100 3300013308 Bacteria 87522
79 Ga0157375_10003324 3300013308 Bacteria 13926
80 Ga0157375_10080610 3300013308 Bacteria 3294
81 Ga0157375_10227132 3300013308 Bacteria 2025
82 Ga0182008_10003723 3300014497 Bacteria 9093
83 Ga0182008_10008830 3300014497 Bacteria 5471
84 Ga0182008_10025928 3300014497 Bacteria 2974
85 Ga0182006_1001026 3300015261 Bacteria 18245
86 Ga0182006_1056090 3300015261 Bacteria 1501
87 Ga0182007_10000638 3300015262 Bacteria 20273
88 Ga0182007_10003456 3300015262 Bacteria 7441
89 Ga0182005_1001192 3300015265 Bacteria 10755
90 Ga0163161_10010884 3300017792 Bacteria 6306
91 Ga0163161_10055664 3300017792 Bacteria 2871
92 Ga0163161_10222197 3300017792 Bacteria 1463
93 Ga0209676_1000006 3300025292 Bacteria 1039588
94 Ga0209676_1000365 3300025292 Bacteria 84690
95 Ga0209676_1001728 3300025292 Bacteria 18725
96 Ga0209050_1000065 3300025298 Bacteria 313668
97 Ga0209050_1000155 3300025298 Bacteria 159095
98 Ga0209050_1001519 3300025298 Bacteria 24484
99 Ga0209051_1000189 3300025303 Bacteria 109144
100 Ga0209051_1012292 3300025303 Bacteria 4150
101 Ga0207696_1005471 3300025711 Bacteria 5267
102 Ga0207696_1012020 3300025711 Bacteria 3084
103 Ga0207696_1027600 3300025711 Bacteria 1749
104 Ga0207655_1000070 3300025728 Bacteria 239196
105 Ga0207655_1001724 3300025728 Bacteria 19211
106 Ga0207655_1002101 3300025728 Bacteria 16694
107 Ga0207655_1003225 3300025728 Bacteria 12258
108 Ga0207655_1011267 3300025728 Bacteria 5338
109 Ga0207655_1018927 3300025728 Bacteria 3627
110 Ga0207655_1020730 3300025728 Bacteria 3366
111 Ga0207655_1037171 3300025728 Bacteria 2147
112 Ga0207713_1000098 3300025735 Bacteria 143900
113 Ga0207713_1001591 3300025735 Bacteria 17767
114 Ga0207713_1002769 3300025735 Bacteria 12413
115 Ga0207713_1023384 3300025735 Bacteria 2909
116 Ga0207671_10004289 3300025914 Bacteria 13717
117 Ga0207649_10000010 3300025920 Bacteria 284354
118 Ga0207681_10005059 3300025923 Bacteria 8105
119 Ga0207679_10000022 3300025945 Bacteria 219036
120 Ga0207640_10096730 3300025981 Bacteria 2059
121 Ga0207639_10027868 3300026041 Bacteria 4119
122 Ga0209281_1000049 3300027111 Bacteria 322274
123 Ga0209281_1000168 3300027111 Bacteria 155116
124 Ga0209281_1010936 3300027111 Bacteria 2051
125 Ga0209281_1012760 3300027111 Bacteria 1833
126 Ga0207428_10028107 3300027907 Bacteria 4676
127 Ga0207428_10037917 3300027907 Bacteria 3921
128 Ga0207428_10047684 3300027907 Bacteria 3440
129 Ga0207428_10048158 3300027907 Bacteria 3421
130 Ga0207428_10072359 3300027907 Bacteria 2706
131 Ga0207428_10162253 3300027907 Bacteria 1697
132 Ga0316178_1104093 3300030735 Bacteria 3292
133 Ga0307408_100000047 3300031548 Bacteria 166310
134 Ga0307408_100009850 3300031548 Bacteria 6300
135 Ga0307408_100113170 3300031548 Bacteria 2088
136 Ga0307408_100128826 3300031548 Bacteria 1971
137 Ga0307405_10012847 3300031731 Bacteria 4449
138 Ga0307411_10094065 3300032005 Bacteria 2100
139 Ga0307510_10005747 3300033180 Bacteria 14785
140 Ga0237819_01198 3300038705 Bacteria 7260
141 Ga0439438_001729 3300041405 Bacteria 9602
142 Ga0439438_005582 3300041405 Bacteria 4593
143 Ga0439447_007752 3300041407 Bacteria 3377
144 Ga0439447_008131 3300041407 Bacteria 3270
145 Ga0439447_011845 3300041407 Bacteria 2527
146 Ga0439447_021675 3300041407 Bacteria 1690
147 Ga0439466_0003469 3300041411 Bacteria 6109
148 Ga0439466_0007414 3300041411 Bacteria 4155
149 Ga0439466_0011220 3300041411 Bacteria 3316
150 Ga0439432_012521 3300042006 Bacteria 2900
151 Ga0439432_031454 3300042006 Bacteria 1716
152 Ga0439432_034377 3300042006 Bacteria 1627
153 Ga0439451_000668 3300042009 Bacteria 6501
154 Ga0439451_008873 3300042009 Bacteria 2037
155 Ga0439451_009868 3300042009 Bacteria 1926
156 Ga0439451_017446 3300042009 Bacteria 1447
157 Ga0439452_001820 3300042010 Bacteria 8275
158 Ga0439452_003627 3300042010 Bacteria 5369
159 Ga0439452_010058 3300042010 Bacteria 2765
160 Ga0439452_016633 3300042010 Bacteria 1994
161 Ga0439456_005399 3300042013 Bacteria 2592
162 Ga0439456_005765 3300042013 Bacteria 2518
163 Ga0439456_011967 3300042013 Bacteria 1797
164 Ga0439456_013760 3300042013 Bacteria 1685
165 Ga0439463_000229 3300042016 Bacteria 15483
166 Ga0439463_001182 3300042016 Bacteria 6983
167 Ga0439463_021884 3300042016 Bacteria 1598
168 Ga0450911_000389 3300042115 Bacteria 14539
169 Ga0450922_001678 3300042124 Bacteria 2170
170 Ga0450897_001383 3300042128 Bacteria 1648
171 Ga0450898_000297 3300042134 Bacteria 5591
172 Ga0450899_001041 3300042135 Bacteria 3150
173 Ga0450900_003031 3300042136 Bacteria 1833
174 Ga0439464_0009692 3300042439 Bacteria 2537
175 Ga0439460_0001493 3300042461 Bacteria 5518
176 Ga0439440_0010080 3300042993 Bacteria 1967
177 Ga0495617_000237 3300046452 Bacteria 32979
178 Ga0495617_001297 3300046452 Bacteria 11132
179 Ga0495617_001377 3300046452 Bacteria 10721
180 Ga0495617_002328 3300046452 Bacteria 7634
181 Ga0495617_003777 3300046452 Bacteria 5607
182 Ga0495627_000263 3300046453 Bacteria 53912
183 Ga0495627_000968 3300046453 Bacteria 19605
184 Ga0495627_003613 3300046453 Bacteria 6733
185 Ga0495627_007547 3300046453 Bacteria 4159
186 Ga0495627_022180 3300046453 Bacteria 2092
187 Ga0495603_0059377 3300046455 Bacteria 2261
188 Ga0495590_0002404 3300046457 Bacteria 7752
189 Ga0495590_0003405 3300046457 Bacteria 6503
190 Ga0495590_0005554 3300046457 Bacteria 4989
191 Ga0495590_0006663 3300046457 Bacteria 4501
192 Ga0495590_0012785 3300046457 Bacteria 3105
193 Ga0495591_000056 3300046458 Bacteria 132582
194 Ga0495591_000195 3300046458 Bacteria 61722
195 Ga0495591_000208 3300046458 Bacteria 59856
196 Ga0495591_000224 3300046458 Bacteria 56456
197 Ga0495591_000233 3300046458 Bacteria 54353
198 Ga0495591_000768 3300046458 Bacteria 23178
199 Ga0495591_000941 3300046458 Bacteria 19944
200 Ga0495591_001977 3300046458 Bacteria 11970
201 Ga0495591_002280 3300046458 Bacteria 10884
202 Ga0495591_004840 3300046458 Bacteria 6418
203 Ga0495591_006007 3300046458 Bacteria 5475
204 Ga0495591_008536 3300046458 Bacteria 4187
205 Ga0495591_013221 3300046458 Bacteria 3033
206 Ga0495591_015905 3300046458 Bacteria 2640
207 Ga0495591_017357 3300046458 Bacteria 2473
208 Ga0495629_0004528 3300046459 Bacteria 10399
209 Ga0495638_0005852 3300046460 Bacteria 9041
210 Ga0495638_0013804 3300046460 Bacteria 5484
211 Ga0495638_0014293 3300046460 Bacteria 5373
212 Ga0495638_0018993 3300046460 Bacteria 4553
213 Ga0495638_0023019 3300046460 Bacteria 4080
214 Ga0495638_0056805 3300046460 Bacteria 2428
215 Ga0495638_0066451 3300046460 Bacteria 2216
216 Ga0495653_0021286 3300046463 Bacteria 5253
217 Ga0495653_0036079 3300046463 Bacteria 3897
218 Ga0495653_0117458 3300046463 Bacteria 1900
219 Ga0495650_0000405 3300046471 Bacteria 71148
220 Ga0495650_0001890 3300046471 Bacteria 18580
221 Ga0495650_0004001 3300046471 Bacteria 10347
222 Ga0495650_0004507 3300046471 Bacteria 9514
223 Ga0495650_0009010 3300046471 Bacteria 5733
224 Ga0495650_0011047 3300046471 Bacteria 4983
225 Ga0495650_0014703 3300046471 Bacteria 4051
226 Ga0495650_0029593 3300046471 Bacteria 2493
227 Ga0495582_0007225 3300046473 Bacteria 6160
228 Ga0495605_0000036 3300046474 Bacteria 203902
229 Ga0495605_0000341 3300046474 Bacteria 46186
230 Ga0495605_0000991 3300046474 Bacteria 19262
231 Ga0495605_0001790 3300046474 Bacteria 13787
232 Ga0495605_0002526 3300046474 Bacteria 11274
233 Ga0495605_0003376 3300046474 Bacteria 9532
234 Ga0495605_0003479 3300046474 Bacteria 9366
235 Ga0495605_0004863 3300046474 Bacteria 7851
236 Ga0495605_0015602 3300046474 Bacteria 4127
237 Ga0495605_0028197 3300046474 Bacteria 2900
238 Ga0495605_0044523 3300046474 Bacteria 2194
239 Ga0495639_0000543 3300046475 Bacteria 17590
240 Ga0495639_0001026 3300046475 Bacteria 12605
241 Ga0495639_0001755 3300046475 Bacteria 9624
242 Ga0495664_0108597 3300046477 Bacteria 1674
243 Ga0495584_0005487 3300046491 Bacteria 6717
244 Ga0495584_0007445 3300046491 Bacteria 5708
245 Ga0495584_0021378 3300046491 Bacteria 3287
246 Ga0495584_0031331 3300046491 Bacteria 2692
247 Ga0495584_0033536 3300046491 Bacteria 2597
248 Ga0495584_0038945 3300046491 Bacteria 2402
249 Ga0495584_0048166 3300046491 Bacteria 2149
250 Ga0495584_0049752 3300046491 Bacteria 2111
251 Ga0495585_0006731 3300046492 Bacteria 7089
252 Ga0495585_0008032 3300046492 Bacteria 6415
253 Ga0495585_0047253 3300046492 Bacteria 2397
254 Ga0495594_0000437 3300046499 Bacteria 21010
255 Ga0495594_0004233 3300046499 Bacteria 7368
256 Ga0495594_0005886 3300046499 Bacteria 6301
257 Ga0495594_0013959 3300046499 Bacteria 4205
258 Ga0495594_0112392 3300046499 Bacteria 1536
259 Ga0495596_0000112 3300046500 Bacteria 56343
260 Ga0495596_0008319 3300046500 Bacteria 4624
261 Ga0495607_0000031 3300046501 Bacteria 153964
262 Ga0495607_0000318 3300046501 Bacteria 50045
263 Ga0495607_0001676 3300046501 Bacteria 19154
264 Ga0495607_0001826 3300046501 Bacteria 18146
265 Ga0495607_0002911 3300046501 Bacteria 13497
266 Ga0495607_0002993 3300046501 Bacteria 13207
267 Ga0495607_0003888 3300046501 Bacteria 11252
268 Ga0495607_0004357 3300046501 Bacteria 10436
269 Ga0495607_0011546 3300046501 Bacteria 5874
270 Ga0495607_0013098 3300046501 Bacteria 5446
271 Ga0495607_0019309 3300046501 Bacteria 4332
272 Ga0495607_0021263 3300046501 Bacteria 4084
273 Ga0495607_0021934 3300046501 Bacteria 4016
274 Ga0495607_0030275 3300046501 Bacteria 3324
275 Ga0495607_0033988 3300046501 Bacteria 3098
276 Ga0495607_0061681 3300046501 Bacteria 2129
277 Ga0495607_0069250 3300046501 Bacteria 1975
278 Ga0495607_0076417 3300046501 Bacteria 1852
279 Ga0495607_0094796 3300046501 Bacteria 1609
280 Ga0495607_0095000 3300046501 Bacteria 1607
281 Ga0495607_0148054 3300046501 Bacteria 1204
282 Ga0495583_0000028 3300046506 Bacteria 255787
283 Ga0495583_0000086 3300046506 Bacteria 165176
284 Ga0495583_0000334 3300046506 Bacteria 74547
285 Ga0495583_0000637 3300046506 Bacteria 46489
286 Ga0495583_0001677 3300046506 Bacteria 21430
287 Ga0495583_0002723 3300046506 Bacteria 14632
288 Ga0495583_0003809 3300046506 Bacteria 11195
289 Ga0495583_0004112 3300046506 Bacteria 10670
290 Ga0495583_0004200 3300046506 Bacteria 10485
291 Ga0495583_0005243 3300046506 Bacteria 8889
292 Ga0495583_0013507 3300046506 Bacteria 4552
293 Ga0495583_0023236 3300046506 Bacteria 3141
294 Ga0495583_0055736 3300046506 Bacteria 1785
295 Ga0495606_0000168 3300046507 Bacteria 115473
296 Ga0495606_0002465 3300046507 Bacteria 21444
297 Ga0495606_0003969 3300046507 Bacteria 15175
298 Ga0495606_0008855 3300046507 Bacteria 8624
299 Ga0495606_0008889 3300046507 Bacteria 8605
300 Ga0495606_0019606 3300046507 Bacteria 5022
301 Ga0495606_0026430 3300046507 Bacteria 4138
302 Ga0495606_0055969 3300046507 Bacteria 2548
303 Ga0495606_0092002 3300046507 Bacteria 1863
304 Ga0495606_0099322 3300046507 Bacteria 1774
305 Ga0495610_0003593 3300046512 Bacteria 11982
306 Ga0495610_0003822 3300046512 Bacteria 11482
307 Ga0495610_0004819 3300046512 Bacteria 9844
308 Ga0495610_0005851 3300046512 Bacteria 8635
309 Ga0495610_0006128 3300046512 Bacteria 8382
310 Ga0495610_0011606 3300046512 Bacteria 5371
311 Ga0495610_0016686 3300046512 Bacteria 4217
312 Ga0495610_0019150 3300046512 Bacteria 3838
313 Ga0495610_0023458 3300046512 Bacteria 3353
314 Ga0495610_0035396 3300046512 Bacteria 2564
315 Ga0495610_0049679 3300046512 Bacteria 2052
316 Ga0495616_0003492 3300046513 Bacteria 10054
317 Ga0495616_0008068 3300046513 Bacteria 6269
318 Ga0495616_0008301 3300046513 Bacteria 6162
319 Ga0495616_0049513 3300046513 Bacteria 2105
320 Ga0495616_0091191 3300046513 Bacteria 1442
321 Ga0495620_0000151 3300046515 Bacteria 56368
322 Ga0495620_0000767 3300046515 Bacteria 19681
323 Ga0495620_0005592 3300046515 Bacteria 6998
324 Ga0495620_0012525 3300046515 Bacteria 4374
325 Ga0495620_0023907 3300046515 Bacteria 2913
326 Ga0495620_0044491 3300046515 Bacteria 1929
327 Ga0495620_0053697 3300046515 Bacteria 1705
328 Ga0495620_0055185 3300046515 Bacteria 1675
329 Ga0495630_0003351 3300046517 Bacteria 11156
330 Ga0495631_0000652 3300046518 Bacteria 22506
331 Ga0495631_0001105 3300046518 Bacteria 16745
332 Ga0495631_0001863 3300046518 Bacteria 12450
333 Ga0495631_0008660 3300046518 Bacteria 5119
334 Ga0495631_0013321 3300046518 Bacteria 3993
335 Ga0495631_0057613 3300046518 Bacteria 1690
336 Ga0495632_0000355 3300046519 Bacteria 43544
337 Ga0495632_0002110 3300046519 Bacteria 15546
338 Ga0495632_0002200 3300046519 Bacteria 15045
339 Ga0495632_0003356 3300046519 Bacteria 11406
340 Ga0495632_0004642 3300046519 Bacteria 9286
341 Ga0495632_0010559 3300046519 Bacteria 5453
342 Ga0495632_0011128 3300046519 Bacteria 5270
343 Ga0495632_0018661 3300046519 Bacteria 3801
344 Ga0495632_0031616 3300046519 Bacteria 2733
345 Ga0495632_0074615 3300046519 Bacteria 1624
346 Ga0495637_0000082 3300046520 Bacteria 73771
347 Ga0495637_0000128 3300046520 Bacteria 56514
348 Ga0495637_0000446 3300046520 Bacteria 30145
349 Ga0495637_0000481 3300046520 Bacteria 29112
350 Ga0495637_0002617 3300046520 Bacteria 9869
351 Ga0495637_0004528 3300046520 Bacteria 7194
352 Ga0495637_0005315 3300046520 Bacteria 6585
353 Ga0495637_0017834 3300046520 Bacteria 3299
354 Ga0495637_0022350 3300046520 Bacteria 2885
355 Ga0495637_0025435 3300046520 Bacteria 2667
356 Ga0495637_0043769 3300046520 Bacteria 1909
357 Ga0495637_0049093 3300046520 Bacteria 1774
358 Ga0495637_0051220 3300046520 Bacteria 1729
359 Ga0495637_0070369 3300046520 Bacteria 1413
360 Ga0495643_0012488 3300046522 Bacteria 5123
361 Ga0495643_0028392 3300046522 Bacteria 3137
362 Ga0495643_0031171 3300046522 Bacteria 2969
363 Ga0495643_0052192 3300046522 Bacteria 2196
364 Ga0495643_0082955 3300046522 Bacteria 1664
365 Ga0495643_0082965 3300046522 Bacteria 1664
366 Ga0495644_0000960 3300046523 Bacteria 11930
367 Ga0495644_0001011 3300046523 Bacteria 11719
368 Ga0495644_0001805 3300046523 Bacteria 8641
369 Ga0495644_0025331 3300046523 Bacteria 2252
370 Ga0495644_0063358 3300046523 Bacteria 1389
371 Ga0495648_0000437 3300046524 Bacteria 45321
372 Ga0495648_0002701 3300046524 Bacteria 16027
373 Ga0495648_0004099 3300046524 Bacteria 12570
374 Ga0495648_0007510 3300046524 Bacteria 8718
375 Ga0495648_0009851 3300046524 Bacteria 7344
376 Ga0495648_0011394 3300046524 Bacteria 6699
377 Ga0495648_0012111 3300046524 Bacteria 6456
378 Ga0495648_0037770 3300046524 Bacteria 3098
379 Ga0495648_0038771 3300046524 Bacteria 3041
380 Ga0495648_0040478 3300046524 Bacteria 2954
381 Ga0495648_0112193 3300046524 Bacteria 1481
382 Ga0495666_0002608 3300046526 Bacteria 8970
383 Ga0495666_0005234 3300046526 Bacteria 6549
384 Ga0495666_0062623 3300046526 Bacteria 1776
385 Ga0495642_0000037 3300046528 Bacteria 79709
386 Ga0495642_0001335 3300046528 Bacteria 11041
387 Ga0495642_0001573 3300046528 Bacteria 10015
388 Ga0495642_0002000 3300046528 Bacteria 8528
389 Ga0495642_0040932 3300046528 Bacteria 1884
390 Ga0495654_0000117 3300046530 Bacteria 89307
391 Ga0495654_0000597 3300046530 Bacteria 28840
392 Ga0495654_0000667 3300046530 Bacteria 27049
393 Ga0495654_0001114 3300046530 Bacteria 19384
394 Ga0495654_0002744 3300046530 Bacteria 11101
395 Ga0495654_0005617 3300046530 Bacteria 7260
396 Ga0495654_0007069 3300046530 Bacteria 6316
397 Ga0495654_0008372 3300046530 Bacteria 5716
398 Ga0495654_0009206 3300046530 Bacteria 5414
399 Ga0495654_0015846 3300046530 Bacteria 3995
400 Ga0495654_0018712 3300046530 Bacteria 3626
401 Ga0495654_0019703 3300046530 Bacteria 3527
402 Ga0495654_0023113 3300046530 Bacteria 3221
403 Ga0495654_0025419 3300046530 Bacteria 3050
404 Ga0495654_0026413 3300046530 Bacteria 2984
405 Ga0495654_0045137 3300046530 Bacteria 2175
406 Ga0495654_0054973 3300046530 Bacteria 1929
407 Ga0495654_0055208 3300046530 Bacteria 1923
408 Ga0495654_0065997 3300046530 Bacteria 1726
409 Ga0495586_0012513 3300046535 Bacteria 4502
410 Ga0495587_0005380 3300046536 Bacteria 8376
411 Ga0495609_0000043 3300046538 Bacteria 166590
412 Ga0495609_0000081 3300046538 Bacteria 116100
413 Ga0495609_0000210 3300046538 Bacteria 58516
414 Ga0495609_0000280 3300046538 Bacteria 47305
415 Ga0495609_0001260 3300046538 Bacteria 17357
416 Ga0495609_0002677 3300046538 Bacteria 10776
417 Ga0495609_0002981 3300046538 Bacteria 10004
418 Ga0495609_0003095 3300046538 Bacteria 9754
419 Ga0495609_0005136 3300046538 Bacteria 6971
420 Ga0495609_0064330 3300046538 Bacteria 1618
421 Ga0495597_0000012 3300046542 Bacteria 212005
422 Ga0495597_0005643 3300046542 Bacteria 6593
423 Ga0495597_0005780 3300046542 Bacteria 6490
424 Ga0495597_0010535 3300046542 Bacteria 4512
425 Ga0495597_0019577 3300046542 Bacteria 3164
426 Ga0495597_0036180 3300046542 Bacteria 2224
427 Ga0495597_0042814 3300046542 Bacteria 2017
428 Ga0495597_0044868 3300046542 Bacteria 1964
429 Ga0495597_0078645 3300046542 Bacteria 1412
430 Ga0495645_0014828 3300046543 Bacteria 5538
431 Ga0495622_0002640 3300046557 Bacteria 8627
432 Ga0495622_0003422 3300046557 Bacteria 7479
433 Ga0495622_0005124 3300046557 Bacteria 6071
434 Ga0495622_0005681 3300046557 Bacteria 5784
435 Ga0495622_0006267 3300046557 Bacteria 5520
436 Ga0495622_0007808 3300046557 Bacteria 4967
437 Ga0495633_0000300 3300046558 Bacteria 56356
438 Ga0495656_0019223 3300046615 Bacteria 2635
439 Ga0495656_0040511 3300046615 Bacteria 1941
440 Ga0495656_0052948 3300046615 Bacteria 1742
441 Ga0495668_0000674 3300046616 Bacteria 41154
442 Ga0495668_0004804 3300046616 Bacteria 9407
443 Ga0495668_0010936 3300046616 Bacteria 5464
444 Ga0495668_0018864 3300046616 Bacteria 3985
445 Ga0495668_0027108 3300046616 Bacteria 3246
446 Ga0495668_0034772 3300046616 Bacteria 2825
447 Ga0495634_0028784 3300046642 Bacteria 3853
448 Ga0495611_0000356 3300046648 Bacteria 29864
449 Ga0495611_0002040 3300046648 Bacteria 9534
450 Ga0495611_0002312 3300046648 Bacteria 8816
451 Ga0495611_0002646 3300046648 Bacteria 8100
452 Ga0495611_0004296 3300046648 Bacteria 6188
453 Ga0495611_0004862 3300046648 Bacteria 5771
454 Ga0495611_0089676 3300046648 Bacteria 1420
455 Ga0495625_0000101 3300046660 Bacteria 139139
456 Ga0495625_0000185 3300046660 Bacteria 97863
457 Ga0495625_0005833 3300046660 Bacteria 11103
458 Ga0495625_0008967 3300046660 Bacteria 8447
459 Ga0495625_0014231 3300046660 Bacteria 6359
460 Ga0495635_0000365 3300046663 Bacteria 28843
461 Ga0495659_0000614 3300046664 Bacteria 13131
462 Ga0495659_0001403 3300046664 Bacteria 8208
463 Ga0495659_0002189 3300046664 Bacteria 6372
464 Ga0495661_0000043 3300046665 Bacteria 149067
465 Ga0495661_0000940 3300046665 Bacteria 26501
466 Ga0495661_0001462 3300046665 Bacteria 19789
467 Ga0495661_0001540 3300046665 Bacteria 19072
468 Ga0495661_0002098 3300046665 Bacteria 15648
469 Ga0495661_0014713 3300046665 Bacteria 5238
470 Ga0495661_0015729 3300046665 Bacteria 5041
471 Ga0495661_0030355 3300046665 Bacteria 3442
472 Ga0495588_0024494 3300046674 Bacteria 2998
473 Ga0495588_0058139 3300046674 Bacteria 1998
474 Ga0495588_0060891 3300046674 Bacteria 1954
475 Ga0495657_0099958 3300046675 Bacteria 1849
476 Ga0495623_0007323 3300046679 Bacteria 7159
477 Ga0495623_0015448 3300046679 Bacteria 4935
478 Ga0495646_0007905 3300046680 Bacteria 6754
479 Ga0495669_0001327 3300046684 Bacteria 10226
480 Ga0495613_0018229 3300046689 Bacteria 5235
481 Ga0495670_0001163 3300046691 Bacteria 12777
482 Ga0495670_0004375 3300046691 Bacteria 6926
483 Ga0495670_0007036 3300046691 Bacteria 5538
484 Ga0495670_0011790 3300046691 Bacteria 4302
485 Ga0495670_0039453 3300046691 Bacteria 2355
486 Ga0495670_0047058 3300046691 Bacteria 2155
487 Ga0495670_0050282 3300046691 Bacteria 2086
488 Ga0495670_0051411 3300046691 Bacteria 2062
489 Ga0495670_0054716 3300046691 Bacteria 2000
490 Ga0495670_0078044 3300046691 Bacteria 1684
491 Ga0495671_0001455 3300046692 Bacteria 15900
492 Ga0495671_0001973 3300046692 Bacteria 13178
493 Ga0495671_0006111 3300046692 Bacteria 6989
494 Ga0495671_0013895 3300046692 Bacteria 4344
495 Ga0495671_0018487 3300046692 Bacteria 3698
496 Ga0495671_0037229 3300046692 Bacteria 2461
497 Ga0495671_0044287 3300046692 Bacteria 2232
498 Ga0495671_0057756 3300046692 Bacteria 1920
499 Ga0495671_0070014 3300046692 Bacteria 1723
500 Ga0495649_0005116 3300046694 Bacteria 8416
501 Ga0495649_0007257 3300046694 Bacteria 6783
502 Ga0495649_0011672 3300046694 Bacteria 5144
503 Ga0495649_0018020 3300046694 Bacteria 3978
504 Ga0495649_0026259 3300046694 Bacteria 3241
505 Ga0495649_0056239 3300046694 Bacteria 2124
506 Ga0495649_0057159 3300046694 Bacteria 2104
507 Ga0495649_0057233 3300046694 Bacteria 2103
508 Ga0495649_0066215 3300046694 Bacteria 1938
509 Ga0495589_0004416 3300046794 Bacteria 7493
510 Ga0495589_0005384 3300046794 Bacteria 6754
511 Ga0495589_0005848 3300046794 Bacteria 6492
512 Ga0495589_0007378 3300046794 Bacteria 5757
513 Ga0495589_0043693 3300046794 Bacteria 2229
514 Ga0495600_0021855 3300046809 Bacteria 4102
515 Ga0495660_0001049 3300046810 Bacteria 20024
516 Ga0495660_0001181 3300046810 Bacteria 18415
517 Ga0495660_0001215 3300046810 Bacteria 18005
518 Ga0495660_0002476 3300046810 Bacteria 11773
519 Ga0495660_0002874 3300046810 Bacteria 10825
520 Ga0495660_0011944 3300046810 Bacteria 5037
521 Ga0495660_0012400 3300046810 Bacteria 4946
522 Ga0495660_0013178 3300046810 Bacteria 4790
523 Ga0495660_0032913 3300046810 Bacteria 2909
524 Ga0495660_0040431 3300046810 Bacteria 2584
525 Ga0495660_0051911 3300046810 Bacteria 2229
526 Ga0495660_0061565 3300046810 Bacteria 2013
527 Ga0495660_0070398 3300046810 Bacteria 1856
528 Ga0495660_0084711 3300046810 Bacteria 1657
529 Ga0495581_0010397 3300047315 Bacteria 5383
530 Ga0495581_0011286 3300047315 Bacteria 5166
531 Ga0495604_0008986 3300047317 Bacteria 7903
532 Ga0495604_0016327 3300047317 Bacteria 5934
533 Ga0495636_0002173 3300047318 Bacteria 7520
534 Ga0495636_0005957 3300047318 Bacteria 4787
535 Ga0495636_0013261 3300047318 Bacteria 3270
536 Ga0495672_0001779 3300047320 Bacteria 20703
537 Ga0495672_0002808 3300047320 Bacteria 15536
538 Ga0495672_0005482 3300047320 Bacteria 10057
539 Ga0495672_0005643 3300047320 Bacteria 9876
540 Ga0495672_0010823 3300047320 Bacteria 6473
541 Ga0495672_0013026 3300047320 Bacteria 5756
542 Ga0495672_0014692 3300047320 Bacteria 5346
543 Ga0495672_0022197 3300047320 Bacteria 4130
544 Ga0495672_0028931 3300047320 Bacteria 3497
545 Ga0495672_0032814 3300047320 Bacteria 3223
546 Ga0495672_0033227 3300047320 Bacteria 3198
547 Ga0495672_0070380 3300047320 Bacteria 1982
548 Ga0495676_0000071 3300047321 Bacteria 76592
549 Ga0495676_0000126 3300047321 Bacteria 58187
550 Ga0495680_0005206 3300047322 Bacteria 12273
551 Ga0495680_0014313 3300047322 Bacteria 6877
552 Ga0495683_0000266 3300047323 Bacteria 46529
553 Ga0495683_0000297 3300047323 Bacteria 42535
554 Ga0495683_0003562 3300047323 Bacteria 9052
555 Ga0495683_0006946 3300047323 Bacteria 6146
556 Ga0495683_0012672 3300047323 Bacteria 4427
557 Ga0495683_0015474 3300047323 Bacteria 3969
558 Ga0495683_0028974 3300047323 Bacteria 2829
559 Ga0495687_000399 3300047443 Bacteria 54034
560 Ga0495687_002218 3300047443 Bacteria 16046
561 Ga0495687_004790 3300047443 Bacteria 8926
562 Ga0495687_008075 3300047443 Bacteria 6081
563 Ga0495687_009135 3300047443 Bacteria 5583
564 Ga0495687_014621 3300047443 Bacteria 4027
565 Ga0495687_014925 3300047443 Bacteria 3970
566 Ga0495675_0026264 3300047444 Bacteria 3713
567 Ga0495677_0005199 3300047445 Bacteria 4950
568 Ga0495679_000798 3300047446 Bacteria 20006
569 Ga0495679_000810 3300047446 Bacteria 19850
570 Ga0495679_000862 3300047446 Bacteria 19181
571 Ga0495679_000866 3300047446 Bacteria 19121
572 Ga0495679_001949 3300047446 Bacteria 11019
573 Ga0495679_012525 3300047446 Bacteria 3222
574 Ga0495673_0000665 3300047469 Bacteria 33816
575 Ga0495673_0002096 3300047469 Bacteria 14527
576 Ga0495673_0002516 3300047469 Bacteria 12818
577 Ga0495673_0004302 3300047469 Bacteria 8969
578 Ga0495673_0004646 3300047469 Bacteria 8536
579 Ga0495673_0004853 3300047469 Bacteria 8311
580 Ga0495673_0005075 3300047469 Bacteria 8057
581 Ga0495673_0005898 3300047469 Bacteria 7315
582 Ga0495673_0006531 3300047469 Bacteria 6844
583 Ga0495673_0007630 3300047469 Bacteria 6191
584 Ga0495673_0009599 3300047469 Bacteria 5339
585 Ga0495673_0011860 3300047469 Bacteria 4657
586 Ga0495673_0025049 3300047469 Bacteria 2871
587 Ga0495673_0036239 3300047469 Bacteria 2265
588 Ga0495673_0063499 3300047469 Bacteria 1574
589 Ga0495673_0074466 3300047469 Bacteria 1420
590 Ga0495681_0001328 3300047470 Bacteria 18712
591 Ga0495681_0003613 3300047470 Bacteria 10758
592 Ga0495681_0007325 3300047470 Bacteria 7068
593 Ga0495681_0007427 3300047470 Bacteria 7006
594 Ga0495681_0009559 3300047470 Bacteria 5957
595 Ga0495681_0017216 3300047470 Bacteria 4022
596 Ga0495681_0042568 3300047470 Bacteria 2196
597 Ga0495681_0087627 3300047470 Bacteria 1379
598 Ga0495684_0185690 3300047471 Bacteria 1539
599 Ga0495686_0015046 3300047472 Bacteria 5301
600 Ga0495686_0022017 3300047472 Bacteria 4221
601 Ga0495686_0036332 3300047472 Bacteria 3161
602 Ga0495686_0040125 3300047472 Bacteria 2987
603 Ga0495593_0004042 3300047673 Bacteria 8739
604 Ga0495626_0000045 3300048091 Bacteria 164931
605 Ga0495626_0000125 3300048091 Bacteria 99451
606 Ga0495626_0000192 3300048091 Bacteria 74170
607 Ga0495626_0000634 3300048091 Bacteria 34070
608 Ga0495626_0001216 3300048091 Bacteria 21211
609 Ga0495626_0002378 3300048091 Bacteria 13138
610 Ga0495626_0003918 3300048091 Bacteria 9324
611 Ga0495626_0021761 3300048091 Bacteria 3175
612 Ga0495626_0049701 3300048091 Bacteria 1941
613 Ga0495626_0054889 3300048091 Bacteria 1828
614 Ga0495626_0064214 3300048091 Bacteria 1663
615 Ga0495626_0072773 3300048091 Bacteria 1540
616 Ga0496105_0059302 3300048908 Bacteria 3158
617 Ga0496105_0069663 3300048908 Bacteria 2907
618 Ga0496110_0022528 3300048913 Bacteria 5350
619 Ga0496112_0268365 3300048915 Bacteria 1655
620 Ga0496116_0005287 3300048919 Bacteria 12042
621 Ga0496116_0005980 3300048919 Bacteria 11158
622 Ga0496116_0011263 3300048919 Bacteria 7422
623 Ga0496117_0002004 3300048920 Bacteria 26986
624 Ga0496117_0009651 3300048920 Bacteria 8930
625 Ga0496117_0065245 3300048920 Bacteria 2476
626 Ga0496117_0068190 3300048920 Bacteria 2403
627 Ga0496117_0074153 3300048920 Bacteria 2267
628 Ga0496117_0098903 3300048920 Bacteria 1853
629 Ga0496117_0100646 3300048920 Bacteria 1830
630 Ga0496118_0002067 3300048921 Bacteria 28277
631 Ga0496118_0025950 3300048921 Bacteria 5008
632 Ga0496118_0062352 3300048921 Bacteria 2753
633 Ga0496118_0062826 3300048921 Bacteria 2737
634 Ga0496118_0071188 3300048921 Bacteria 2505
635 Ga0496118_0092225 3300048921 Bacteria 2079
636 Ga0496119_0008433 3300048922 Bacteria 9052
637 Ga0496120_0006324 3300048923 Bacteria 9114
638 Ga0496120_0011570 3300048923 Bacteria 6060
639 Ga0496121_0001665 3300048924 Bacteria 36652
640 Ga0496121_0004002 3300048924 Bacteria 20309
641 Ga0496121_0005786 3300048924 Bacteria 15687
642 Ga0496121_0026633 3300048924 Bacteria 5438
643 Ga0496121_0042137 3300048924 Bacteria 3977
644 Ga0496122_0006870 3300048925 Bacteria 12884
645 Ga0496122_0007144 3300048925 Bacteria 12519
646 Ga0496122_0009102 3300048925 Bacteria 10528
647 Ga0496122_0011042 3300048925 Bacteria 9219
648 Ga0496122_0015524 3300048925 Bacteria 7273
649 Ga0496122_0016306 3300048925 Bacteria 7045
650 Ga0496122_0020060 3300048925 Bacteria 6068
651 Ga0496122_0027663 3300048925 Bacteria 4840
652 Ga0496122_0084377 3300048925 Bacteria 2197
653 Ga0496123_0002977 3300048926 Bacteria 19678
654 Ga0496123_0003765 3300048926 Bacteria 16624
655 Ga0496123_0008376 3300048926 Bacteria 9505
656 Ga0496123_0008800 3300048926 Bacteria 9205
657 Ga0496123_0011805 3300048926 Bacteria 7523
658 Ga0496123_0025244 3300048926 Bacteria 4486
659 Ga0496124_0000132 3300048927 Bacteria 155405
660 Ga0496124_0006958 3300048927 Bacteria 12151
661 Ga0496124_0007096 3300048927 Bacteria 12003
662 Ga0496124_0012316 3300048927 Bacteria 8448
663 Ga0496124_0020715 3300048927 Bacteria 6069
664 Ga0496124_0029838 3300048927 Bacteria 4851
665 Ga0496124_0062443 3300048927 Bacteria 3117
666 Ga0496124_0120656 3300048927 Bacteria 2095
667 Ga0496124_0202631 3300048927 Bacteria 1507
668 Ga0496124_0224973 3300048927 Bacteria 1408
669 Ga0496125_0000410 3300048928 Bacteria 80395
670 Ga0496125_0001914 3300048928 Bacteria 28499
671 Ga0496125_0003318 3300048928 Bacteria 19669
672 Ga0496125_0010948 3300048928 Bacteria 9114
673 Ga0496125_0101076 3300048928 Bacteria 2123
674 Ga0496125_0115482 3300048928 Bacteria 1930
675 Ga0496126_0036546 3300048929 Bacteria 4591
676 Ga0495678_000020 3300049459 Bacteria 253654
677 Ga0495678_000380 3300049459 Bacteria 45107
678 Ga0495678_000852 3300049459 Bacteria 27240
679 Ga0495678_001107 3300049459 Bacteria 22605
680 Ga0495678_001815 3300049459 Bacteria 15698
681 Ga0495678_002734 3300049459 Bacteria 11594
682 Ga0495678_004507 3300049459 Bacteria 8031
683 Ga0495678_005011 3300049459 Bacteria 7462
684 Ga0495678_005409 3300049459 Bacteria 7056
685 Ga0495678_011702 3300049459 Bacteria 4189
686 Ga0495678_023048 3300049459 Bacteria 2713
687 Ga0495678_024254 3300049459 Bacteria 2621
688 Ga0495678_026653 3300049459 Bacteria 2463
689 Ga0495678_034694 3300049459 Bacteria 2073
690 Ga0495678_040472 3300049459 Bacteria 1873
691 Ga0495678_052552 3300049459 Bacteria 1568
692 Ga0495682_0001059 3300049460 Bacteria 16229
693 Ga0495682_0025074 3300049460 Bacteria 2220
694 Ga0495682_0029199 3300049460 Bacteria 2042
695 Ga0495682_0033415 3300049460 Bacteria 1898
696 Ga0501034_0047682 3300049571 Bacteria 4325
697 Ga0501227_000306 3300049665 Bacteria 10191
698 nmdc:mga03683_7918_c1 3300050489 Bacteria 3712
699 Ga0500618_002883 3300053125 Bacteria 6162
700 Ga0500634_0000390 3300053161 Bacteria 14077
701 Ga0587070_003461 3300059491 Bacteria 1901
702 Ga0587070_008379 3300059491 Bacteria 1464
703 Ga0587068_003935 3300059641 Bacteria 1934

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048924 Ga0496121_0026633 Ga0496121_0026633_4344_5426 352
2 3300046515 Ga0495620_0055185 Ga0495620_0055185_20_1102 360
3 3300046501 Ga0495607_0148054 Ga0495607_0148054_13_1140 364
4 3300046542 Ga0495597_0078645 Ga0495597_0078645_261_1379 372
5 3300046810 Ga0495660_0061565 Ga0495660_0061565_30_1148 372
6 3300047323 Ga0495683_0028974 Ga0495683_0028974_1678_2796 372
7 3300047470 Ga0495681_0042568 Ga0495681_0042568_1049_2167 372
8 3300047470 Ga0495681_0087627 Ga0495681_0087627_14_1132 372
9 3300042006 Ga0439432_031454 Ga0439432_031454_386_1690 386
10 iso_pu_bacteria 2738541294 2738812348 393
11 iso_pu_bacteria 2738541309 2738899708 393
12 iso_pu_bacteria 2738541294 2738811902 395
13 iso_pu_bacteria 2738541309 2738899262 395
14 3300046501 Ga0495607_0000318 Ga0495607_0000318_39562_40932 396
15 3300041407 Ga0439447_021675 Ga0439447_021675_157_1404 398
16 3300049665 Ga0501227_000306 Ga0501227_000306_2977_4332 401
17 3300006946 Ga0079104_1012806 Ga0079104_10128061 405
18 3300013104 Ga0157370_10292656 Ga0157370_102926562 405
19 3300027111 Ga0209281_1012760 Ga0209281_10127602 405
20 3300031548 Ga0307408_100128826 Ga0307408_1001288262 405
21 3300046615 Ga0495656_0019223 Ga0495656_0019223_12_1319 405
22 3300046615 Ga0495656_0040511 Ga0495656_0040511_623_1930 405
23 3300047469 Ga0495673_0004302 Ga0495673_0004302_7639_8958 405
24 3300009011 Ga0105251_10085812 Ga0105251_100858121 406
25 3300013308 Ga0157375_10227132 Ga0157375_102271322 406
26 3300046492 Ga0495585_0047253 Ga0495585_0047253_593_1861 406
27 3300046501 Ga0495607_0061681 Ga0495607_0061681_847_2112 406
28 3300046501 Ga0495607_0095000 Ga0495607_0095000_316_1584 406
29 3300046506 Ga0495583_0004112 Ga0495583_0004112_8344_9612 406
30 3300046507 Ga0495606_0002465 Ga0495606_0002465_16890_18158 406
31 3300046520 Ga0495637_0000481 Ga0495637_0000481_20882_22150 406
32 3300046530 Ga0495654_0018712 Ga0495654_0018712_2320_3588 406
33 3300046538 Ga0495609_0000043 Ga0495609_0000043_150964_152232 406
34 3300046616 Ga0495668_0010936 Ga0495668_0010936_3757_5025 406
35 3300046810 Ga0495660_0002874 Ga0495660_0002874_9513_10781 406
36 3300047323 Ga0495683_0015474 Ga0495683_0015474_288_1556 406
37 3300047446 Ga0495679_000798 Ga0495679_000798_14160_15428 406
38 3300047469 Ga0495673_0005898 Ga0495673_0005898_5000_6268 406
39 3300047469 Ga0495673_0025049 Ga0495673_0025049_492_1760 406
40 3300048091 Ga0495626_0000045 Ga0495626_0000045_14183_15451 406
41 3300048913 Ga0496110_0022528 Ga0496110_0022528_1978_3246 406
42 3300048927 Ga0496124_0020715 Ga0496124_0020715_3627_4895 406
43 3300048927 Ga0496124_0224973 Ga0496124_0224973_99_1394 406
44 3300049459 Ga0495678_001107 Ga0495678_001107_6771_8039 406
45 3300046458 Ga0495591_000056 Ga0495591_000056_100738_101988 407
46 3300046501 Ga0495607_0000031 Ga0495607_0000031_21675_22925 407
47 3300046506 Ga0495583_0055736 Ga0495583_0055736_480_1763 407
48 3300046513 Ga0495616_0091191 Ga0495616_0091191_161_1432 407
49 3300046520 Ga0495637_0002617 Ga0495637_0002617_3504_4754 407
50 3300046520 Ga0495637_0070369 Ga0495637_0070369_104_1402 407
51 3300046542 Ga0495597_0000012 Ga0495597_0000012_186255_187505 407
52 3300046810 Ga0495660_0001049 Ga0495660_0001049_5973_7223 407
53 3300006058 Ga0075432_10017991 Ga0075432_100179913 408
54 3300027907 Ga0207428_10072359 Ga0207428_100723592 408
55 3300048091 Ga0495626_0064214 Ga0495626_0064214_34_1398 408
56 iso_pu_bacteria 2511231015 2511321486 408
57 3300046501 Ga0495607_0001676 Ga0495607_0001676_13415_14728 409
58 3300046520 Ga0495637_0051220 Ga0495637_0051220_11_1309 409
59 3300049460 Ga0495682_0033415 Ga0495682_0033415_12_1307 409
60 3300046452 Ga0495617_001377 Ga0495617_001377_9361_10689 411
61 3300046457 Ga0495590_0005554 Ga0495590_0005554_3629_4957 411
62 3300046458 Ga0495591_008536 Ga0495591_008536_1911_3239 411
63 3300046460 Ga0495638_0014293 Ga0495638_0014293_24_1352 411
64 3300046460 Ga0495638_0018993 Ga0495638_0018993_105_1433 411
65 3300046471 Ga0495650_0029593 Ga0495650_0029593_385_1713 411
66 3300046474 Ga0495605_0002526 Ga0495605_0002526_1861_3189 411
67 3300046474 Ga0495605_0003479 Ga0495605_0003479_3589_4917 411
68 3300046492 Ga0495585_0008032 Ga0495585_0008032_1307_2635 411
69 3300046501 Ga0495607_0069250 Ga0495607_0069250_575_1903 411
70 3300046506 Ga0495583_0002723 Ga0495583_0002723_11004_12332 411
71 3300046507 Ga0495606_0019606 Ga0495606_0019606_25_1353 411
72 3300046512 Ga0495610_0011606 Ga0495610_0011606_852_2180 411
73 3300046515 Ga0495620_0023907 Ga0495620_0023907_1516_2844 411
74 3300046518 Ga0495631_0000652 Ga0495631_0000652_9873_11213 411
75 3300046519 Ga0495632_0002200 Ga0495632_0002200_5016_6344 411
76 3300046524 Ga0495648_0011394 Ga0495648_0011394_1556_2884 411
77 3300046528 Ga0495642_0001573 Ga0495642_0001573_8655_9983 411
78 3300046528 Ga0495642_0002000 Ga0495642_0002000_33_1361 411
79 3300046530 Ga0495654_0055208 Ga0495654_0055208_33_1361 411
80 3300046538 Ga0495609_0003095 Ga0495609_0003095_6147_7475 411
81 3300046542 Ga0495597_0044868 Ga0495597_0044868_73_1401 411
82 3300046616 Ga0495668_0034772 Ga0495668_0034772_425_1753 411
83 3300046664 Ga0495659_0001403 Ga0495659_0001403_4449_5777 411
84 3300046665 Ga0495661_0015729 Ga0495661_0015729_3102_4430 411
85 3300046674 Ga0495588_0058139 Ga0495588_0058139_602_1930 411
86 3300046684 Ga0495669_0001327 Ga0495669_0001327_3198_4526 411
87 3300046691 Ga0495670_0039453 Ga0495670_0039453_33_1361 411
88 3300046691 Ga0495670_0047058 Ga0495670_0047058_33_1361 411
89 3300046794 Ga0495589_0007378 Ga0495589_0007378_1263_2591 411
90 3300046810 Ga0495660_0011944 Ga0495660_0011944_2432_3760 411
91 3300047318 Ga0495636_0013261 Ga0495636_0013261_551_1879 411
92 3300047443 Ga0495687_002218 Ga0495687_002218_10393_11721 411
93 3300047445 Ga0495677_0005199 Ga0495677_0005199_70_1398 411
94 3300048091 Ga0495626_0003918 Ga0495626_0003918_2952_4280 411
95 3300048927 Ga0496124_0202631 Ga0496124_0202631_68_1396 411
96 3300049459 Ga0495678_026653 Ga0495678_026653_1100_2428 411
97 3300005290 Ga0065712_10128938 Ga0065712_101289381 412
98 3300025728 Ga0207655_1020730 Ga0207655_10207302 412
99 3300025735 Ga0207713_1002769 Ga0207713_10027698 412
100 3300046692 Ga0495671_0018487 Ga0495671_0018487_2099_3442 412
101 iso_pu_bacteria 2511231004 2511257874 412
102 3300003781 Ga0055536_1002700 Ga0055536_10027001 413
103 3300006946 Ga0079104_1017455 Ga0079104_10174551 413
104 3300013102 Ga0157371_10017480 Ga0157371_100174805 413
105 3300013104 Ga0157370_10185787 Ga0157370_101857872 413
106 3300013105 Ga0157369_10101713 Ga0157369_101017133 413
107 3300025292 Ga0209676_1000365 Ga0209676_100036518 413
108 3300027111 Ga0209281_1010936 Ga0209281_10109361 413
109 3300030735 Ga0316178_1104093 Ga0316178_11040932 413
110 3300042016 Ga0439463_021884 Ga0439463_021884_221_1570 413
111 3300046474 Ga0495605_0003376 Ga0495605_0003376_4659_5984 413
112 3300015261 Ga0182006_1056090 Ga0182006_10560901 414
113 3300031731 Ga0307405_10012847 Ga0307405_100128472 414
114 3300041411 Ga0439466_0003469 Ga0439466_0003469_4483_5826 414
115 3300042993 Ga0439440_0010080 Ga0439440_0010080_544_1896 414
116 3300046471 Ga0495650_0004001 Ga0495650_0004001_7286_8650 414
117 3300046491 Ga0495584_0038945 Ga0495584_0038945_36_1364 414
118 3300046501 Ga0495607_0003888 Ga0495607_0003888_18_1382 414
119 3300046512 Ga0495610_0019150 Ga0495610_0019150_636_1964 414
120 3300046513 Ga0495616_0003492 Ga0495616_0003492_737_2101 414
121 3300046520 Ga0495637_0025435 Ga0495637_0025435_1315_2643 414
122 3300047470 Ga0495681_0003613 Ga0495681_0003613_21_1385 414
123 3300047470 Ga0495681_0009559 Ga0495681_0009559_1361_2689 414
124 3300048925 Ga0496122_0011042 Ga0496122_0011042_2482_3804 414
125 3300048926 Ga0496123_0008800 Ga0496123_0008800_2480_3802 414
126 3300048928 Ga0496125_0003318 Ga0496125_0003318_11246_12568 414
127 3300049460 Ga0495682_0029199 Ga0495682_0029199_18_1382 414
128 3300042009 Ga0439451_017446 Ga0439451_017446_60_1418 415
129 3300042013 Ga0439456_013760 Ga0439456_013760_297_1655 415
130 3300046474 Ga0495605_0000991 Ga0495605_0000991_13520_14833 415
131 3300046538 Ga0495609_0000210 Ga0495609_0000210_43716_45029 415
132 3300003781 Ga0055536_1002325 Ga0055536_10023251 417
133 3300003791 Ga0055530_10002793 Ga0055530_100027931 417
134 3300003792 Ga0055540_1002152 Ga0055540_100215210 417
135 3300003792 Ga0055540_1021383 Ga0055540_10213831 417
136 3300009092 Ga0105250_10028051 Ga0105250_100280512 417
137 3300013104 Ga0157370_10241520 Ga0157370_102415201 417
138 3300013105 Ga0157369_10265159 Ga0157369_102651592 417
139 3300025292 Ga0209676_1000006 Ga0209676_1000006534 417
140 3300025298 Ga0209050_1000065 Ga0209050_100006516 417
141 3300025303 Ga0209051_1000189 Ga0209051_100018916 417
142 3300046457 Ga0495590_0012785 Ga0495590_0012785_545_1852 417
143 3300009011 Ga0105251_10003557 Ga0105251_100035579 418
144 3300009092 Ga0105250_10049720 Ga0105250_100497202 418
145 3300041405 Ga0439438_001729 Ga0439438_001729_7149_8405 418
146 3300041407 Ga0439447_011845 Ga0439447_011845_12_1268 418
147 3300041411 Ga0439466_0011220 Ga0439466_0011220_1000_2256 418
148 3300042006 Ga0439432_012521 Ga0439432_012521_798_2054 418
149 3300042009 Ga0439451_009868 Ga0439451_009868_591_1916 418
150 3300046457 Ga0495590_0006663 Ga0495590_0006663_997_2253 418
151 3300046458 Ga0495591_004840 Ga0495591_004840_919_2175 418
152 3300046519 Ga0495632_0074615 Ga0495632_0074615_224_1480 418
153 3300046530 Ga0495654_0065997 Ga0495654_0065997_142_1398 418
154 3300046542 Ga0495597_0036180 Ga0495597_0036180_938_2194 418
155 3300046616 Ga0495668_0018864 Ga0495668_0018864_2037_3359 418
156 3300046648 Ga0495611_0004296 Ga0495611_0004296_1016_2272 418
157 3300046692 Ga0495671_0037229 Ga0495671_0037229_65_1321 418
158 3300046694 Ga0495649_0007257 Ga0495649_0007257_4520_5776 418
159 3300047320 Ga0495672_0005643 Ga0495672_0005643_6049_7305 418
160 3300047469 Ga0495673_0005075 Ga0495673_0005075_65_1321 418
161 3300048927 Ga0496124_0007096 Ga0496124_0007096_6018_7274 418
162 3300049459 Ga0495678_000852 Ga0495678_000852_11454_12776 418
163 3300049459 Ga0495678_023048 Ga0495678_023048_149_1405 418
164 3300046501 Ga0495607_0013098 Ga0495607_0013098_576_1895 419
165 3300047323 Ga0495683_0000297 Ga0495683_0000297_9045_10364 419
166 3300048091 Ga0495626_0049701 Ga0495626_0049701_621_1931 419
167 iso_pu_bacteria 2599185167 2599398312 419
168 iso_pu_bacteria 2599185179 2599450325 419
169 iso_pu_bacteria 2599185190 2599512816 419
170 iso_pu_bacteria 2599185191 2599521271 419
171 iso_pu_bacteria 2599185288 2599881372 419
172 iso_pu_bacteria 2599185290 2599891493 419
173 iso_pu_bacteria 2599185303 2599946597 419
174 iso_pu_bacteria 2675903420 2677896618 419
175 iso_pu_bacteria 2738541294 2738806889 419
176 iso_pu_bacteria 2738541309 2738894249 419
177 iso_pu_bacteria 2834028612 2834029872 419
178 iso_pu_bacteria 2908446538 2908449682 419
179 iso_pu_bacteria 2931390751 2931394022 419
180 iso_pu_bacteria 2946006987 2946009806 419
181 iso_pu_bacteria 8055817908 8055821072 419
182 3300009092 Ga0105250_10015796 Ga0105250_100157962 420
183 3300046458 Ga0495591_001977 Ga0495591_001977_6871_8193 420
184 3300046474 Ga0495605_0000036 Ga0495605_0000036_183543_184865 420
185 3300046499 Ga0495594_0000437 Ga0495594_0000437_12442_13764 420
186 3300046506 Ga0495583_0000028 Ga0495583_0000028_198819_200141 420
187 3300046512 Ga0495610_0023458 Ga0495610_0023458_1859_3181 420
188 3300046518 Ga0495631_0057613 Ga0495631_0057613_95_1417 420
189 3300046530 Ga0495654_0001114 Ga0495654_0001114_5036_6358 420
190 3300046538 Ga0495609_0000081 Ga0495609_0000081_55791_57113 420
191 3300046542 Ga0495597_0005643 Ga0495597_0005643_233_1555 420
192 3300046648 Ga0495611_0002040 Ga0495611_0002040_4682_6004 420
193 3300046691 Ga0495670_0001163 Ga0495670_0001163_4277_5599 420
194 3300046810 Ga0495660_0001181 Ga0495660_0001181_5072_6394 420
195 3300047446 Ga0495679_001949 Ga0495679_001949_3232_4554 420
196 3300047469 Ga0495673_0002516 Ga0495673_0002516_7966_9288 420
197 3300049459 Ga0495678_000020 Ga0495678_000020_196955_198277 420
198 3300053125 Ga0500618_002883 Ga0500618_002883_4302_5624 420
199 iso_pu_bacteria 2511231012 2511303297 420
200 iso_pu_bacteria 2511231020 2511351992 420
201 iso_pu_bacteria 2597489887 2597859782 420
202 iso_pu_bacteria 2599185185 2599482611 420
203 iso_pu_bacteria 2599185302 2599944797 420
204 iso_pu_bacteria 2599185304 2599956533 420
205 iso_pu_bacteria 2599185306 2599969665 420
206 iso_pu_bacteria 2599185308 2599981163 420
207 iso_pu_bacteria 2599185309 2599983668 420
208 iso_pu_bacteria 2599185310 2599990075 420
209 iso_pu_bacteria 2599185312 2600000553 420
210 iso_pu_bacteria 2599185314 2600014991 420
211 iso_pu_bacteria 2599185320 2600047615 420
212 iso_pu_bacteria 2643221589 2643955198 420
213 iso_pu_bacteria 2643221602 2644023552 420
214 iso_pu_bacteria 2773857670 2774122259 420
215 iso_pu_bacteria 2784132072 2784317466 420
216 iso_pu_bacteria 3007395558 3007397684 420
217 iso_pu_bacteria 8011350971 8011354974 420
218 iso_pu_bacteria 8015687852 8015692497 420
219 iso_pu_bacteria 8056125926 8056130673 420
220 iso_pu_bacteria 2511231014 2511315995 421
221 iso_pu_bacteria 2511231017 2511329958 421
222 iso_pu_bacteria 2511231022 2511363517 421
223 iso_pu_bacteria 2512047018 2512327399 421
224 iso_pu_bacteria 2582580891 2583794194 421
225 iso_pu_bacteria 2599185155 2599328508 421
226 iso_pu_bacteria 2599185257 2599803668 421
227 iso_pu_bacteria 2599185307 2599973969 421
228 iso_pu_bacteria 2600255283 2601626474 421
229 iso_pu_bacteria 2623620446 2624490572 421
230 iso_pu_bacteria 2671180172 2671770764 421
231 iso_pu_bacteria 2713897149 2715755218 421
232 iso_pu_bacteria 2738541271 2738689997 421
233 iso_pu_bacteria 2738543015 2739257687 421
234 iso_pu_bacteria 2738543016 2739265771 421
235 iso_pu_bacteria 2808606382 2808958664 421
236 iso_pu_bacteria 2826581358 2826584274 421
237 iso_pu_bacteria 2842849001 2842849551 421
238 iso_pu_bacteria 2860339153 2860341245 421
239 iso_pu_bacteria 2919456309 2919459338 421
240 iso_pu_bacteria 2919697872 2919701767 421
241 iso_pu_bacteria 2931396565 2931396980 421
242 iso_pu_bacteria 2984286254 2984287762 421
243 iso_pu_bacteria 8019775933 8019780710 421
244 3300013100 Ga0157373_10003808 Ga0157373_100038087 422
245 3300046453 Ga0495627_007547 Ga0495627_007547_345_1664 422
246 3300046453 Ga0495627_022180 Ga0495627_022180_225_1538 422
247 3300046458 Ga0495591_000224 Ga0495591_000224_7290_8618 422
248 3300046458 Ga0495591_000941 Ga0495591_000941_5326_6639 422
249 3300046458 Ga0495591_002280 Ga0495591_002280_4443_5756 422
250 3300046458 Ga0495591_006007 Ga0495591_006007_1568_2887 422
251 3300046471 Ga0495650_0001890 Ga0495650_0001890_15985_17298 422
252 3300046471 Ga0495650_0004507 Ga0495650_0004507_4401_5714 422
253 3300046474 Ga0495605_0000341 Ga0495605_0000341_4486_5805 422
254 3300046474 Ga0495605_0028197 Ga0495605_0028197_222_1538 422
255 3300046492 Ga0495585_0006731 Ga0495585_0006731_4912_6225 422
256 3300046499 Ga0495594_0005886 Ga0495594_0005886_3874_5193 422
257 3300046500 Ga0495596_0008319 Ga0495596_0008319_2320_3633 422
258 3300046501 Ga0495607_0094796 Ga0495607_0094796_57_1370 422
259 3300046506 Ga0495583_0000637 Ga0495583_0000637_40692_42011 422
260 3300046506 Ga0495583_0004200 Ga0495583_0004200_4413_5726 422
261 3300046506 Ga0495583_0023236 Ga0495583_0023236_108_1421 422
262 3300046507 Ga0495606_0003969 Ga0495606_0003969_4351_5664 422
263 3300046507 Ga0495606_0008855 Ga0495606_0008855_4312_5625 422
264 3300046512 Ga0495610_0003593 Ga0495610_0003593_4333_5646 422
265 3300046512 Ga0495610_0049679 Ga0495610_0049679_345_1664 422
266 3300046515 Ga0495620_0000767 Ga0495620_0000767_4485_5804 422
267 3300046515 Ga0495620_0053697 Ga0495620_0053697_39_1352 422
268 3300046518 Ga0495631_0013321 Ga0495631_0013321_1496_2809 422
269 3300046519 Ga0495632_0002110 Ga0495632_0002110_4413_5726 422
270 3300046519 Ga0495632_0004642 Ga0495632_0004642_3651_4964 422
271 3300046519 Ga0495632_0018661 Ga0495632_0018661_2475_3788 422
272 3300046520 Ga0495637_0000446 Ga0495637_0000446_28700_30013 422
273 3300046520 Ga0495637_0022350 Ga0495637_0022350_1471_2784 422
274 3300046522 Ga0495643_0082955 Ga0495643_0082955_108_1421 422
275 3300046522 Ga0495643_0082965 Ga0495643_0082965_108_1421 422
276 3300046523 Ga0495644_0001805 Ga0495644_0001805_4089_5402 422
277 3300046524 Ga0495648_0009851 Ga0495648_0009851_1444_2763 422
278 3300046524 Ga0495648_0040478 Ga0495648_0040478_1556_2869 422
279 3300046524 Ga0495648_0112193 Ga0495648_0112193_80_1396 422
280 3300046530 Ga0495654_0000667 Ga0495654_0000667_12176_13495 422
281 3300046530 Ga0495654_0005617 Ga0495654_0005617_4405_5718 422
282 3300046530 Ga0495654_0009206 Ga0495654_0009206_198_1511 422
283 3300046538 Ga0495609_0000280 Ga0495609_0000280_4457_5776 422
284 3300046538 Ga0495609_0002677 Ga0495609_0002677_5127_6440 422
285 3300046542 Ga0495597_0005780 Ga0495597_0005780_342_1661 422
286 3300046557 Ga0495622_0007808 Ga0495622_0007808_1277_2590 422
287 3300046558 Ga0495633_0000300 Ga0495633_0000300_13758_15077 422
288 3300046616 Ga0495668_0027108 Ga0495668_0027108_1076_2389 422
289 3300046648 Ga0495611_0000356 Ga0495611_0000356_23173_24486 422
290 3300046648 Ga0495611_0004862 Ga0495611_0004862_1745_3064 422
291 3300046660 Ga0495625_0000185 Ga0495625_0000185_24594_25910 422
292 3300046665 Ga0495661_0000940 Ga0495661_0000940_11802_13115 422
293 3300046665 Ga0495661_0001462 Ga0495661_0001462_13990_15309 422
294 3300046665 Ga0495661_0001540 Ga0495661_0001540_4334_5647 422
295 3300046691 Ga0495670_0050282 Ga0495670_0050282_750_2069 422
296 3300046692 Ga0495671_0001973 Ga0495671_0001973_7951_9264 422
297 3300046692 Ga0495671_0006111 Ga0495671_0006111_5022_6335 422
298 3300046794 Ga0495589_0005384 Ga0495589_0005384_4802_6121 422
299 3300046810 Ga0495660_0001215 Ga0495660_0001215_11972_13285 422
300 3300046810 Ga0495660_0002476 Ga0495660_0002476_9682_11001 422
301 3300046810 Ga0495660_0032913 Ga0495660_0032913_108_1421 422
302 3300046810 Ga0495660_0084711 Ga0495660_0084711_108_1424 422
303 3300047320 Ga0495672_0028931 Ga0495672_0028931_848_2161 422
304 3300047320 Ga0495672_0033227 Ga0495672_0033227_1795_3108 422
305 3300047321 Ga0495676_0000126 Ga0495676_0000126_43453_44766 422
306 3300047323 Ga0495683_0000266 Ga0495683_0000266_4482_5801 422
307 3300047323 Ga0495683_0006946 Ga0495683_0006946_4562_5875 422
308 3300047446 Ga0495679_000810 Ga0495679_000810_4657_5976 422
309 3300047446 Ga0495679_000862 Ga0495679_000862_4414_5727 422
310 3300047469 Ga0495673_0004853 Ga0495673_0004853_5075_6385 422
311 3300047469 Ga0495673_0007630 Ga0495673_0007630_551_1864 422
312 3300047469 Ga0495673_0063499 Ga0495673_0063499_202_1518 422
313 3300047469 Ga0495673_0074466 Ga0495673_0074466_69_1382 422
314 3300047470 Ga0495681_0007325 Ga0495681_0007325_692_2005 422
315 3300047470 Ga0495681_0007427 Ga0495681_0007427_112_1431 422
316 3300047472 Ga0495686_0022017 Ga0495686_0022017_794_2107 422
317 3300048091 Ga0495626_0000125 Ga0495626_0000125_93801_95114 422
318 3300048915 Ga0496112_0268365 Ga0496112_0268365_110_1423 422
319 3300048920 Ga0496117_0074153 Ga0496117_0074153_708_2021 422
320 3300048921 Ga0496118_0062826 Ga0496118_0062826_595_1908 422
321 3300048925 Ga0496122_0009102 Ga0496122_0009102_4875_6188 422
322 3300048925 Ga0496122_0020060 Ga0496122_0020060_3443_4762 422
323 3300048926 Ga0496123_0002977 Ga0496123_0002977_13365_14678 422
324 3300048926 Ga0496123_0008376 Ga0496123_0008376_5117_6436 422
325 3300048927 Ga0496124_0000132 Ga0496124_0000132_43154_44467 422
326 3300048927 Ga0496124_0006958 Ga0496124_0006958_9278_10591 422
327 3300049459 Ga0495678_000380 Ga0495678_000380_4481_5800 422
328 3300049459 Ga0495678_001815 Ga0495678_001815_10045_11361 422
329 3300049459 Ga0495678_004507 Ga0495678_004507_5308_6621 422
330 3300049459 Ga0495678_052552 Ga0495678_052552_199_1512 422
331 iso_pu_bacteria 2511231006 2511268278 422
332 iso_pu_bacteria 2511231007 2511269251 422
333 iso_pu_bacteria 2599185316 2600025630 422
334 iso_pu_bacteria 2599185317 2600028731 422
335 iso_pu_bacteria 2599185318 2600033601 422
336 iso_pu_bacteria 2599185325 2600077147 422
337 iso_pu_bacteria 2600254930 2600357899 422
338 iso_pu_bacteria 2600254931 2600365068 422
339 iso_pu_bacteria 2643221633 2644186333 422
340 iso_pu_bacteria 2713897148 2715750390 422
341 iso_pu_bacteria 2740892503 2743739322 422
342 iso_pu_bacteria 2842815866 2842817959 422
343 iso_pu_bacteria 2842843487 2842845044 422
344 iso_pu_bacteria 2919487758 2919490286 422
345 iso_pu_bacteria 2923153595 2923158406 422
346 iso_pu_bacteria 2974289157 2974289532 422
347 iso_pu_bacteria 8029995093 8029996498 422
348 iso_pu_bacteria 8055770955 8055775716 422
349 iso_pu_bacteria 8056166840 8056166881 422
350 iso_pu_bacteria 8056569372 8056572456 422
351 2162886007 SwRhRL2b_contig_98336 SwRhRL2b_0201.00000180 423
352 3300005288 Ga0065714_10065183 Ga0065714_1006518311 423
353 3300005289 Ga0065704_10000858 Ga0065704_100008582 423
354 3300005290 Ga0065712_10073928 Ga0065712_100739282 423
355 3300005344 Ga0070661_100003049 Ga0070661_1000030493 423
356 3300005564 Ga0070664_100002357 Ga0070664_1000023579 423
357 3300009011 Ga0105251_10045513 Ga0105251_100455132 423
358 3300009036 Ga0105244_10000457 Ga0105244_1000045729 423
359 3300009036 Ga0105244_10020147 Ga0105244_100201472 423
360 3300009176 Ga0105242_10001214 Ga0105242_1000121416 423
361 3300009545 Ga0105237_10000937 Ga0105237_100009374 423
362 3300013100 Ga0157373_10000854 Ga0157373_1000085418 423
363 3300013100 Ga0157373_10008868 Ga0157373_100088686 423
364 3300013100 Ga0157373_10009997 Ga0157373_100099971 423
365 3300013100 Ga0157373_10014413 Ga0157373_100144133 423
366 3300013105 Ga0157369_10000251 Ga0157369_1000025110 423
367 3300013105 Ga0157369_10000627 Ga0157369_100006276 423
368 3300013105 Ga0157369_10001667 Ga0157369_1000166721 423
369 3300013306 Ga0163162_10095603 Ga0163162_100956032 423
370 3300013308 Ga0157375_10000100 Ga0157375_1000010028 423
371 3300013308 Ga0157375_10003324 Ga0157375_100033248 423
372 3300013308 Ga0157375_10080610 Ga0157375_100806103 423
373 3300015262 Ga0182007_10003456 Ga0182007_100034566 423
374 3300017792 Ga0163161_10010884 Ga0163161_100108842 423
375 3300017792 Ga0163161_10055664 Ga0163161_100556642 423
376 3300025728 Ga0207655_1000070 Ga0207655_1000070147 423
377 3300025728 Ga0207655_1018927 Ga0207655_10189273 423
378 3300025735 Ga0207713_1001591 Ga0207713_100159110 423
379 3300025914 Ga0207671_10004289 Ga0207671_100042899 423
380 3300025920 Ga0207649_10000010 Ga0207649_1000001091 423
381 3300025923 Ga0207681_10005059 Ga0207681_100050593 423
382 3300025945 Ga0207679_10000022 Ga0207679_100000228 423
383 3300026041 Ga0207639_10027868 Ga0207639_100278681 423
384 3300042128 Ga0450897_001383 Ga0450897_001383_167_1489 423
385 3300042134 Ga0450898_000297 Ga0450898_000297_1649_2971 423
386 3300042135 Ga0450899_001041 Ga0450899_001041_1339_2661 423
387 3300046453 Ga0495627_000968 Ga0495627_000968_13836_15158 423
388 3300046458 Ga0495591_013221 Ga0495591_013221_355_1677 423
389 3300046460 Ga0495638_0056805 Ga0495638_0056805_1074_2399 423
390 3300046501 Ga0495607_0002911 Ga0495607_0002911_1508_2839 423
391 3300046506 Ga0495583_0000086 Ga0495583_0000086_56091_57413 423
392 3300046507 Ga0495606_0000168 Ga0495606_0000168_111784_113106 423
393 3300046507 Ga0495606_0055969 Ga0495606_0055969_650_1972 423
394 3300046512 Ga0495610_0003822 Ga0495610_0003822_6165_7487 423
395 3300046512 Ga0495610_0016686 Ga0495610_0016686_2644_3966 423
396 3300046518 Ga0495631_0001863 Ga0495631_0001863_7161_8483 423
397 3300046520 Ga0495637_0005315 Ga0495637_0005315_4884_6206 423
398 3300046520 Ga0495637_0049093 Ga0495637_0049093_387_1703 423
399 3300046524 Ga0495648_0004099 Ga0495648_0004099_3962_5284 423
400 3300046530 Ga0495654_0000117 Ga0495654_0000117_2959_4281 423
401 3300046530 Ga0495654_0002744 Ga0495654_0002744_396_1718 423
402 3300046530 Ga0495654_0025419 Ga0495654_0025419_521_1843 423
403 3300046665 Ga0495661_0002098 Ga0495661_0002098_4596_5918 423
404 3300046692 Ga0495671_0057756 Ga0495671_0057756_527_1849 423
405 3300046694 Ga0495649_0026259 Ga0495649_0026259_1405_2727 423
406 3300047320 Ga0495672_0010823 Ga0495672_0010823_87_1427 423
407 3300047320 Ga0495672_0070380 Ga0495672_0070380_304_1626 423
408 3300047446 Ga0495679_000866 Ga0495679_000866_13317_14639 423
409 3300047446 Ga0495679_012525 Ga0495679_012525_1344_2666 423
410 3300048920 Ga0496117_0002004 Ga0496117_0002004_874_2196 423
411 3300048920 Ga0496117_0009651 Ga0496117_0009651_3422_4744 423
412 3300048920 Ga0496117_0065245 Ga0496117_0065245_726_2048 423
413 3300048921 Ga0496118_0002067 Ga0496118_0002067_870_2192 423
414 3300048921 Ga0496118_0071188 Ga0496118_0071188_622_1944 423
415 3300048923 Ga0496120_0011570 Ga0496120_0011570_2107_3429 423
416 3300048924 Ga0496121_0001665 Ga0496121_0001665_3924_5246 423
417 3300048924 Ga0496121_0004002 Ga0496121_0004002_5070_6392 423
418 3300048924 Ga0496121_0005786 Ga0496121_0005786_12576_13907 423
419 3300048925 Ga0496122_0007144 Ga0496122_0007144_385_1707 423
420 3300048925 Ga0496122_0027663 Ga0496122_0027663_1166_2488 423
421 3300048925 Ga0496122_0084377 Ga0496122_0084377_390_1721 423
422 3300048926 Ga0496123_0003765 Ga0496123_0003765_697_2019 423
423 3300048926 Ga0496123_0011805 Ga0496123_0011805_4257_5579 423
424 3300048927 Ga0496124_0029838 Ga0496124_0029838_2152_3474 423
425 3300048927 Ga0496124_0120656 Ga0496124_0120656_557_1879 423
426 3300048928 Ga0496125_0000410 Ga0496125_0000410_2025_3347 423
427 3300048928 Ga0496125_0001914 Ga0496125_0001914_26505_27827 423
428 3300048928 Ga0496125_0010948 Ga0496125_0010948_3469_4791 423
429 3300048928 Ga0496125_0101076 Ga0496125_0101076_217_1539 423
430 3300048928 Ga0496125_0115482 Ga0496125_0115482_128_1450 423
431 3300048929 Ga0496126_0036546 Ga0496126_0036546_874_2196 423
432 3300049460 Ga0495682_0001059 Ga0495682_0001059_1488_2819 423
433 3300053161 Ga0500634_0000390 Ga0500634_0000390_4588_5910 423
434 iso_pu_bacteria 2511231011 2511294168 423
435 iso_pu_bacteria 2773857673 2774133273 423
436 iso_pu_bacteria 2842832357 2842837247 423
437 iso_pu_bacteria 2969304461 2969309098 423
438 3300005288 Ga0065714_10073498 Ga0065714_100734982 424
439 3300005288 Ga0065714_10114276 Ga0065714_101142761 424
440 3300005353 Ga0070669_100006310 Ga0070669_1000063104 424
441 3300005539 Ga0068853_100036743 Ga0068853_1000367431 424
442 3300006946 Ga0079104_1001875 Ga0079104_10018751 424
443 3300009011 Ga0105251_10000928 Ga0105251_1000092815 424
444 3300011119 Ga0105246_10013579 Ga0105246_100135791 424
445 3300013104 Ga0157370_10287252 Ga0157370_102872521 424
446 3300014497 Ga0182008_10003723 Ga0182008_100037234 424
447 3300017792 Ga0163161_10222197 Ga0163161_102221971 424
448 3300025298 Ga0209050_1001519 Ga0209050_100151918 424
449 3300025711 Ga0207696_1012020 Ga0207696_10120203 424
450 3300025735 Ga0207713_1023384 Ga0207713_10233841 424
451 3300027111 Ga0209281_1000049 Ga0209281_1000049120 424
452 3300027907 Ga0207428_10048158 Ga0207428_100481585 424
453 3300031548 Ga0307408_100113170 Ga0307408_1001131701 424
454 3300042010 Ga0439452_003627 Ga0439452_003627_2670_4019 424
455 3300042016 Ga0439463_001182 Ga0439463_001182_4119_5462 424
456 3300042439 Ga0439464_0009692 Ga0439464_0009692_762_2090 424
457 3300042461 Ga0439460_0001493 Ga0439460_0001493_568_1896 424
458 3300046453 Ga0495627_000263 Ga0495627_000263_21954_23279 424
459 3300046458 Ga0495591_000208 Ga0495591_000208_43782_45107 424
460 3300046458 Ga0495591_000233 Ga0495591_000233_23962_25287 424
461 3300046458 Ga0495591_000768 Ga0495591_000768_12898_14223 424
462 3300046458 Ga0495591_017357 Ga0495591_017357_570_1898 424
463 3300046471 Ga0495650_0000405 Ga0495650_0000405_5690_7015 424
464 3300046471 Ga0495650_0014703 Ga0495650_0014703_1247_2581 424
465 3300046474 Ga0495605_0004863 Ga0495605_0004863_2426_3760 424
466 3300046474 Ga0495605_0015602 Ga0495605_0015602_1617_2942 424
467 3300046491 Ga0495584_0049752 Ga0495584_0049752_578_1903 424
468 3300046501 Ga0495607_0002993 Ga0495607_0002993_3656_4981 424
469 3300046501 Ga0495607_0004357 Ga0495607_0004357_6457_7785 424
470 3300046501 Ga0495607_0011546 Ga0495607_0011546_4194_5519 424
471 3300046501 Ga0495607_0030275 Ga0495607_0030275_1107_2432 424
472 3300046506 Ga0495583_0000334 Ga0495583_0000334_14574_15899 424
473 3300046506 Ga0495583_0003809 Ga0495583_0003809_4113_5447 424
474 3300046506 Ga0495583_0005243 Ga0495583_0005243_7550_8878 424
475 3300046507 Ga0495606_0008889 Ga0495606_0008889_2525_3853 424
476 3300046512 Ga0495610_0005851 Ga0495610_0005851_6286_7611 424
477 3300046513 Ga0495616_0008068 Ga0495616_0008068_3890_5215 424
478 3300046515 Ga0495620_0000151 Ga0495620_0000151_10595_11920 424
479 3300046519 Ga0495632_0000355 Ga0495632_0000355_40550_41875 424
480 3300046519 Ga0495632_0010559 Ga0495632_0010559_3127_4452 424
481 3300046520 Ga0495637_0000082 Ga0495637_0000082_14106_15431 424
482 3300046520 Ga0495637_0043769 Ga0495637_0043769_36_1364 424
483 3300046522 Ga0495643_0028392 Ga0495643_0028392_263_1588 424
484 3300046524 Ga0495648_0037770 Ga0495648_0037770_68_1396 424
485 3300046530 Ga0495654_0019703 Ga0495654_0019703_1939_3264 424
486 3300046530 Ga0495654_0045137 Ga0495654_0045137_11_1339 424
487 3300046530 Ga0495654_0054973 Ga0495654_0054973_545_1873 424
488 3300046538 Ga0495609_0001260 Ga0495609_0001260_261_1595 424
489 3300046542 Ga0495597_0019577 Ga0495597_0019577_535_1863 424
490 3300046557 Ga0495622_0006267 Ga0495622_0006267_1138_2463 424
491 3300046648 Ga0495611_0002646 Ga0495611_0002646_3774_5099 424
492 3300046660 Ga0495625_0000101 Ga0495625_0000101_94241_95566 424
493 3300046660 Ga0495625_0008967 Ga0495625_0008967_4527_5855 424
494 3300046665 Ga0495661_0000043 Ga0495661_0000043_21579_22904 424
495 3300046665 Ga0495661_0030355 Ga0495661_0030355_166_1491 424
496 3300046692 Ga0495671_0070014 Ga0495671_0070014_360_1685 424
497 3300046794 Ga0495589_0043693 Ga0495589_0043693_51_1379 424
498 3300046810 Ga0495660_0013178 Ga0495660_0013178_3158_4483 424
499 3300046810 Ga0495660_0051911 Ga0495660_0051911_645_1973 424
500 3300047320 Ga0495672_0013026 Ga0495672_0013026_1578_2906 424
501 3300047321 Ga0495676_0000071 Ga0495676_0000071_14374_15699 424
502 3300047323 Ga0495683_0003562 Ga0495683_0003562_7671_8999 424
503 3300047469 Ga0495673_0036239 Ga0495673_0036239_761_2095 424
504 3300047470 Ga0495681_0017216 Ga0495681_0017216_1649_2977 424
505 3300047472 Ga0495686_0040125 Ga0495686_0040125_54_1382 424
506 3300048091 Ga0495626_0072773 Ga0495626_0072773_61_1389 424
507 3300048922 Ga0496119_0008433 Ga0496119_0008433_4213_5598 424
508 3300048923 Ga0496120_0006324 Ga0496120_0006324_3469_4854 424
509 3300048925 Ga0496122_0015524 Ga0496122_0015524_3887_5272 424
510 3300048927 Ga0496124_0062443 Ga0496124_0062443_17_1345 424
511 3300049459 Ga0495678_024254 Ga0495678_024254_501_1829 424
512 3300049459 Ga0495678_034694 Ga0495678_034694_235_1560 424
513 3300049571 Ga0501034_0047682 Ga0501034_0047682_2019_3350 424
514 3300003578 Ga0006562J51391_1002207 Ga0006562J51391_10022071 425
515 3300005288 Ga0065714_10013074 Ga0065714_100130742 425
516 3300005290 Ga0065712_10068617 Ga0065712_100686176 425
517 3300006058 Ga0075432_10002018 Ga0075432_100020183 425
518 3300009011 Ga0105251_10001627 Ga0105251_1000162717 425
519 3300009011 Ga0105251_10087905 Ga0105251_100879051 425
520 3300009036 Ga0105244_10014303 Ga0105244_100143034 425
521 3300009036 Ga0105244_10025054 Ga0105244_100250544 425
522 3300013104 Ga0157370_10079253 Ga0157370_100792532 425
523 3300025711 Ga0207696_1005471 Ga0207696_10054711 425
524 3300025728 Ga0207655_1001724 Ga0207655_100172418 425
525 3300025728 Ga0207655_1003225 Ga0207655_100322510 425
526 3300025728 Ga0207655_1011267 Ga0207655_10112674 425
527 3300025735 Ga0207713_1000098 Ga0207713_1000098107 425
528 3300025981 Ga0207640_10096730 Ga0207640_100967302 425
529 3300027907 Ga0207428_10037917 Ga0207428_100379174 425
530 3300038705 Ga0237819_01198 Ga0237819_01198_3401_4747 425
531 3300046475 Ga0495639_0000543 Ga0495639_0000543_8806_10134 425
532 3300046491 Ga0495584_0005487 Ga0495584_0005487_3249_4607 425
533 3300046499 Ga0495594_0013959 Ga0495594_0013959_1196_2524 425
534 3300046499 Ga0495594_0112392 Ga0495594_0112392_147_1505 425
535 3300046501 Ga0495607_0021263 Ga0495607_0021263_1727_3085 425
536 3300046506 Ga0495583_0013507 Ga0495583_0013507_1884_3212 425
537 3300046515 Ga0495620_0012525 Ga0495620_0012525_3015_4343 425
538 3300046520 Ga0495637_0017834 Ga0495637_0017834_1418_2776 425
539 3300046526 Ga0495666_0002608 Ga0495666_0002608_7613_8941 425
540 3300046557 Ga0495622_0002640 Ga0495622_0002640_207_1562 425
541 3300046557 Ga0495622_0003422 Ga0495622_0003422_1581_2909 425
542 3300046664 Ga0495659_0002189 Ga0495659_0002189_3586_4914 425
543 3300046674 Ga0495588_0024494 Ga0495588_0024494_547_1905 425
544 3300046679 Ga0495623_0015448 Ga0495623_0015448_3537_4865 425
545 3300046691 Ga0495670_0004375 Ga0495670_0004375_4060_5418 425
546 3300046692 Ga0495671_0001455 Ga0495671_0001455_11276_12634 425
547 3300046694 Ga0495649_0056239 Ga0495649_0056239_90_1418 425
548 3300047322 Ga0495680_0014313 Ga0495680_0014313_1092_2420 425
549 3300047443 Ga0495687_014621 Ga0495687_014621_1126_2454 425
550 3300048091 Ga0495626_0002378 Ga0495626_0002378_7569_8897 425
551 3300048908 Ga0496105_0069663 Ga0496105_0069663_1433_2761 425
552 3300048919 Ga0496116_0005287 Ga0496116_0005287_3232_4560 425
553 3300048920 Ga0496117_0100646 Ga0496117_0100646_475_1803 425
554 3300048921 Ga0496118_0025950 Ga0496118_0025950_252_1574 425
555 3300048921 Ga0496118_0092225 Ga0496118_0092225_35_1363 425
556 3300048924 Ga0496121_0042137 Ga0496121_0042137_99_1427 425
557 3300048925 Ga0496122_0016306 Ga0496122_0016306_4154_5482 425
558 3300059491 Ga0587070_003461 Ga0587070_003461_22_1350 425
559 3300059491 Ga0587070_008379 Ga0587070_008379_22_1350 425
560 3300059641 Ga0587068_003935 Ga0587068_003935_585_1913 425
561 3300009036 Ga0105244_10033038 Ga0105244_100330383 426
562 3300031548 Ga0307408_100009850 Ga0307408_1000098502 426
563 3300032005 Ga0307411_10094065 Ga0307411_100940652 426
564 3300033180 Ga0307510_10005747 Ga0307510_1000574710 426
565 3300041405 Ga0439438_005582 Ga0439438_005582_1083_2432 426
566 3300042006 Ga0439432_034377 Ga0439432_034377_86_1435 426
567 3300042009 Ga0439451_008873 Ga0439451_008873_646_1995 426
568 3300042013 Ga0439456_005765 Ga0439456_005765_972_2321 426
569 3300042115 Ga0450911_000389 Ga0450911_000389_4077_5426 426
570 3300042136 Ga0450900_003031 Ga0450900_003031_429_1778 426
571 3300046452 Ga0495617_002328 Ga0495617_002328_4701_6032 426
572 3300046491 Ga0495584_0048166 Ga0495584_0048166_323_1672 426
573 3300046501 Ga0495607_0033988 Ga0495607_0033988_1213_2541 426
574 3300046507 Ga0495606_0099322 Ga0495606_0099322_38_1387 426
575 3300046519 Ga0495632_0011128 Ga0495632_0011128_10_1341 426
576 3300046528 Ga0495642_0040932 Ga0495642_0040932_529_1860 426
577 3300046538 Ga0495609_0002981 Ga0495609_0002981_7136_8467 426
578 3300046648 Ga0495611_0089676 Ga0495611_0089676_12_1343 426
579 3300046694 Ga0495649_0005116 Ga0495649_0005116_3986_5317 426
580 3300047318 Ga0495636_0002173 Ga0495636_0002173_4925_6256 426
581 3300047320 Ga0495672_0001779 Ga0495672_0001779_8792_10123 426
582 3300047443 Ga0495687_014925 Ga0495687_014925_484_1815 426
583 3300047469 Ga0495673_0002096 Ga0495673_0002096_7766_9097 426
584 3300047472 Ga0495686_0015046 Ga0495686_0015046_2396_3745 426
585 3300048919 Ga0496116_0005980 Ga0496116_0005980_9758_11107 426
586 3300049459 Ga0495678_005011 Ga0495678_005011_3861_5192 426
587 3300049459 Ga0495678_040472 Ga0495678_040472_491_1840 426
588 3300009036 Ga0105244_10001530 Ga0105244_100015304 427
589 3300012498 Ga0157345_1000120 Ga0157345_100012010 427
590 3300025711 Ga0207696_1027600 Ga0207696_10276002 427
591 3300025728 Ga0207655_1002101 Ga0207655_100210118 427
592 3300041407 Ga0439447_007752 Ga0439447_007752_1802_3166 427
593 3300041407 Ga0439447_008131 Ga0439447_008131_827_2143 427
594 3300041411 Ga0439466_0007414 Ga0439466_0007414_130_1446 427
595 3300042009 Ga0439451_000668 Ga0439451_000668_524_1840 427
596 3300042010 Ga0439452_010058 Ga0439452_010058_503_1819 427
597 3300042013 Ga0439456_005399 Ga0439456_005399_738_2054 427
598 3300042124 Ga0450922_001678 Ga0450922_001678_495_1811 427
599 3300046459 Ga0495629_0004528 Ga0495629_0004528_3827_5140 427
600 3300046463 Ga0495653_0021286 Ga0495653_0021286_2618_3931 427
601 3300046473 Ga0495582_0007225 Ga0495582_0007225_276_1589 427
602 3300046475 Ga0495639_0001755 Ga0495639_0001755_483_1796 427
603 3300046477 Ga0495664_0108597 Ga0495664_0108597_186_1499 427
604 3300046501 Ga0495607_0076417 Ga0495607_0076417_186_1550 427
605 3300046507 Ga0495606_0026430 Ga0495606_0026430_1051_2415 427
606 3300046513 Ga0495616_0049513 Ga0495616_0049513_30_1394 427
607 3300046515 Ga0495620_0044491 Ga0495620_0044491_526_1890 427
608 3300046517 Ga0495630_0003351 Ga0495630_0003351_5975_7288 427
609 3300046518 Ga0495631_0001105 Ga0495631_0001105_4071_5435 427
610 3300046535 Ga0495586_0012513 Ga0495586_0012513_1051_2364 427
611 3300046536 Ga0495587_0005380 Ga0495587_0005380_3990_5303 427
612 3300046542 Ga0495597_0042814 Ga0495597_0042814_629_1993 427
613 3300046543 Ga0495645_0014828 Ga0495645_0014828_3753_5066 427
614 3300046557 Ga0495622_0005124 Ga0495622_0005124_647_2011 427
615 3300046642 Ga0495634_0028784 Ga0495634_0028784_2424_3737 427
616 3300046663 Ga0495635_0000365 Ga0495635_0000365_25041_26354 427
617 3300046680 Ga0495646_0007905 Ga0495646_0007905_3712_5025 427
618 3300046689 Ga0495613_0018229 Ga0495613_0018229_189_1502 427
619 3300046810 Ga0495660_0070398 Ga0495660_0070398_107_1471 427
620 3300047315 Ga0495581_0010397 Ga0495581_0010397_98_1411 427
621 3300047317 Ga0495604_0016327 Ga0495604_0016327_4478_5791 427
622 3300047320 Ga0495672_0002808 Ga0495672_0002808_8245_9609 427
623 3300047322 Ga0495680_0005206 Ga0495680_0005206_10899_12212 427
624 3300047444 Ga0495675_0026264 Ga0495675_0026264_2339_3652 427
625 3300047469 Ga0495673_0009599 Ga0495673_0009599_1339_2703 427
626 3300048091 Ga0495626_0054889 Ga0495626_0054889_385_1749 427
627 3300049459 Ga0495678_005409 Ga0495678_005409_4069_5433 427
628 3300046463 Ga0495653_0117458 Ga0495653_0117458_497_1855 428
629 iso_pu_bacteria 2811994881 2812366068 431
630 iso_pu_bacteria 2923519811 2923520090 431
631 iso_pu_bacteria 2511231007 2511272368 433
632 iso_pu_bacteria 2511231012 2511299835 433
633 iso_pu_bacteria 2511231014 2511315072 433
634 iso_pu_bacteria 2511231015 2511318108 433
635 iso_pu_bacteria 2511231020 2511348346 433
636 iso_pu_bacteria 2597489887 2597855944 433
637 iso_pu_bacteria 2599185185 2599487725 433
638 iso_pu_bacteria 2599185257 2599805700 433
639 iso_pu_bacteria 2623620446 2624493559 433
640 iso_pu_bacteria 2643221589 2643953402 433
641 iso_pu_bacteria 2643221602 2644021144 433
642 iso_pu_bacteria 2671180172 2671767564 433
643 iso_pu_bacteria 2738543004 2739200178 433
644 iso_pu_bacteria 2738543015 2739258521 433
645 iso_pu_bacteria 2904550169 2904550778 433
646 iso_pu_bacteria 2919697872 2919702860 433
647 iso_pu_bacteria 3007511990 3007512016 433
648 iso_pu_bacteria 8019775933 8019780259 433
649 3300031548 Ga0307408_100000047 Ga0307408_10000004745 434
650 3300046463 Ga0495653_0036079 Ga0495653_0036079_2524_3834 436
651 3300046524 Ga0495648_0000437 Ga0495648_0000437_31409_32719 436
652 3300046526 Ga0495666_0005234 Ga0495666_0005234_440_1750 436
653 3300046675 Ga0495657_0099958 Ga0495657_0099958_298_1608 436
654 3300046679 Ga0495623_0007323 Ga0495623_0007323_2047_3357 436
655 3300046809 Ga0495600_0021855 Ga0495600_0021855_1010_2320 436
656 3300047317 Ga0495604_0008986 Ga0495604_0008986_2787_4097 436
657 3300047471 Ga0495684_0185690 Ga0495684_0185690_87_1397 436
658 3300047673 Ga0495593_0004042 Ga0495593_0004042_7175_8485 436
659 2124908027 MRS2a_Contig_392 MRS2a_00282010 437
660 3300003791 Ga0055530_10009743 Ga0055530_100097432 437
661 3300005288 Ga0065714_10065181 Ga0065714_100651812 437
662 3300005288 Ga0065714_10067025 Ga0065714_100670252 437
663 3300005289 Ga0065704_10097119 Ga0065704_100971192 437
664 3300006058 Ga0075432_10001067 Ga0075432_100010674 437
665 3300006914 Ga0075436_100046986 Ga0075436_1000469862 437
666 3300006914 Ga0075436_100058508 Ga0075436_1000585082 437
667 3300006914 Ga0075436_100149473 Ga0075436_1001494732 437
668 3300006946 Ga0079104_1000068 Ga0079104_100006889 437
669 3300009011 Ga0105251_10083940 Ga0105251_100839402 437
670 3300009036 Ga0105244_10014163 Ga0105244_100141634 437
671 3300009092 Ga0105250_10020880 Ga0105250_100208802 437
672 3300009092 Ga0105250_10034606 Ga0105250_100346062 437
673 3300011119 Ga0105246_10163478 Ga0105246_101634782 437
674 3300013104 Ga0157370_10013951 Ga0157370_100139513 437
675 3300013104 Ga0157370_10071997 Ga0157370_100719973 437
676 3300014497 Ga0182008_10008830 Ga0182008_100088304 437
677 3300014497 Ga0182008_10025928 Ga0182008_100259282 437
678 3300015261 Ga0182006_1001026 Ga0182006_100102612 437
679 3300015262 Ga0182007_10000638 Ga0182007_100006388 437
680 3300015265 Ga0182005_1001192 Ga0182005_10011928 437
681 3300025292 Ga0209676_1001728 Ga0209676_10017283 437
682 3300025298 Ga0209050_1000155 Ga0209050_100015532 437
683 3300025303 Ga0209051_1012292 Ga0209051_10122923 437
684 3300025728 Ga0207655_1037171 Ga0207655_10371711 437
685 3300027111 Ga0209281_1000168 Ga0209281_100016872 437
686 3300027907 Ga0207428_10028107 Ga0207428_100281074 437
687 3300027907 Ga0207428_10047684 Ga0207428_100476841 437
688 3300027907 Ga0207428_10162253 Ga0207428_101622532 437
689 3300042010 Ga0439452_001820 Ga0439452_001820_3823_5136 437
690 3300042010 Ga0439452_016633 Ga0439452_016633_574_1887 437
691 3300042013 Ga0439456_011967 Ga0439456_011967_117_1430 437
692 3300042016 Ga0439463_000229 Ga0439463_000229_4085_5398 437
693 3300046452 Ga0495617_000237 Ga0495617_000237_9715_11028 437
694 3300046452 Ga0495617_001297 Ga0495617_001297_2129_3442 437
695 3300046452 Ga0495617_003777 Ga0495617_003777_886_2199 437
696 3300046453 Ga0495627_003613 Ga0495627_003613_4360_5673 437
697 3300046455 Ga0495603_0059377 Ga0495603_0059377_653_1966 437
698 3300046457 Ga0495590_0002404 Ga0495590_0002404_1523_2836 437
699 3300046457 Ga0495590_0003405 Ga0495590_0003405_295_1608 437
700 3300046458 Ga0495591_000195 Ga0495591_000195_37161_38474 437
701 3300046458 Ga0495591_015905 Ga0495591_015905_871_2184 437
702 3300046460 Ga0495638_0005852 Ga0495638_0005852_3029_4342 437
703 3300046460 Ga0495638_0013804 Ga0495638_0013804_3690_5003 437
704 3300046460 Ga0495638_0023019 Ga0495638_0023019_2396_3709 437
705 3300046460 Ga0495638_0066451 Ga0495638_0066451_783_2096 437
706 3300046471 Ga0495650_0009010 Ga0495650_0009010_1598_2911 437
707 3300046471 Ga0495650_0011047 Ga0495650_0011047_1689_3002 437
708 3300046474 Ga0495605_0001790 Ga0495605_0001790_5553_6866 437
709 3300046474 Ga0495605_0044523 Ga0495605_0044523_637_1950 437
710 3300046475 Ga0495639_0001026 Ga0495639_0001026_3992_5305 437
711 3300046491 Ga0495584_0007445 Ga0495584_0007445_4101_5414 437
712 3300046491 Ga0495584_0021378 Ga0495584_0021378_1292_2605 437
713 3300046491 Ga0495584_0031331 Ga0495584_0031331_1064_2377 437
714 3300046491 Ga0495584_0033536 Ga0495584_0033536_65_1378 437
715 3300046499 Ga0495594_0004233 Ga0495594_0004233_4319_5632 437
716 3300046500 Ga0495596_0000112 Ga0495596_0000112_23199_24512 437
717 3300046501 Ga0495607_0001826 Ga0495607_0001826_10986_12299 437
718 3300046501 Ga0495607_0019309 Ga0495607_0019309_2525_3838 437
719 3300046501 Ga0495607_0021934 Ga0495607_0021934_1945_3258 437
720 3300046506 Ga0495583_0001677 Ga0495583_0001677_480_1793 437
721 3300046507 Ga0495606_0092002 Ga0495606_0092002_372_1685 437
722 3300046512 Ga0495610_0004819 Ga0495610_0004819_4607_5920 437
723 3300046512 Ga0495610_0006128 Ga0495610_0006128_2527_3840 437
724 3300046512 Ga0495610_0035396 Ga0495610_0035396_1071_2384 437
725 3300046513 Ga0495616_0008301 Ga0495616_0008301_4129_5442 437
726 3300046515 Ga0495620_0005592 Ga0495620_0005592_3776_5089 437
727 3300046518 Ga0495631_0008660 Ga0495631_0008660_2407_3720 437
728 3300046519 Ga0495632_0003356 Ga0495632_0003356_2220_3533 437
729 3300046519 Ga0495632_0031616 Ga0495632_0031616_1049_2362 437
730 3300046520 Ga0495637_0000128 Ga0495637_0000128_23223_24536 437
731 3300046520 Ga0495637_0004528 Ga0495637_0004528_1732_3045 437
732 3300046522 Ga0495643_0012488 Ga0495643_0012488_594_1907 437
733 3300046522 Ga0495643_0031171 Ga0495643_0031171_1528_2841 437
734 3300046522 Ga0495643_0052192 Ga0495643_0052192_745_2058 437
735 3300046523 Ga0495644_0000960 Ga0495644_0000960_6481_7794 437
736 3300046523 Ga0495644_0001011 Ga0495644_0001011_5785_7098 437
737 3300046523 Ga0495644_0025331 Ga0495644_0025331_129_1442 437
738 3300046523 Ga0495644_0063358 Ga0495644_0063358_25_1338 437
739 3300046524 Ga0495648_0002701 Ga0495648_0002701_5034_6347 437
740 3300046524 Ga0495648_0007510 Ga0495648_0007510_2715_4028 437
741 3300046524 Ga0495648_0012111 Ga0495648_0012111_1613_2926 437
742 3300046524 Ga0495648_0038771 Ga0495648_0038771_237_1550 437
743 3300046526 Ga0495666_0062623 Ga0495666_0062623_153_1466 437
744 3300046528 Ga0495642_0000037 Ga0495642_0000037_29468_30781 437
745 3300046528 Ga0495642_0001335 Ga0495642_0001335_7685_8998 437
746 3300046530 Ga0495654_0000597 Ga0495654_0000597_17452_18765 437
747 3300046530 Ga0495654_0007069 Ga0495654_0007069_4442_5755 437
748 3300046530 Ga0495654_0008372 Ga0495654_0008372_199_1512 437
749 3300046530 Ga0495654_0015846 Ga0495654_0015846_652_1965 437
750 3300046530 Ga0495654_0023113 Ga0495654_0023113_1049_2362 437
751 3300046530 Ga0495654_0026413 Ga0495654_0026413_1341_2654 437
752 3300046538 Ga0495609_0005136 Ga0495609_0005136_3635_4948 437
753 3300046538 Ga0495609_0064330 Ga0495609_0064330_35_1348 437
754 3300046542 Ga0495597_0010535 Ga0495597_0010535_1692_3005 437
755 3300046557 Ga0495622_0005681 Ga0495622_0005681_4352_5665 437
756 3300046615 Ga0495656_0052948 Ga0495656_0052948_331_1644 437
757 3300046616 Ga0495668_0000674 Ga0495668_0000674_30380_31693 437
758 3300046616 Ga0495668_0004804 Ga0495668_0004804_4818_6131 437
759 3300046648 Ga0495611_0002312 Ga0495611_0002312_191_1504 437
760 3300046660 Ga0495625_0005833 Ga0495625_0005833_9446_10759 437
761 3300046660 Ga0495625_0014231 Ga0495625_0014231_3988_5301 437
762 3300046664 Ga0495659_0000614 Ga0495659_0000614_4200_5513 437
763 3300046665 Ga0495661_0014713 Ga0495661_0014713_3798_5111 437
764 3300046674 Ga0495588_0060891 Ga0495588_0060891_436_1749 437
765 3300046691 Ga0495670_0007036 Ga0495670_0007036_1074_2387 437
766 3300046691 Ga0495670_0011790 Ga0495670_0011790_2522_3835 437
767 3300046691 Ga0495670_0051411 Ga0495670_0051411_317_1630 437
768 3300046691 Ga0495670_0054716 Ga0495670_0054716_69_1382 437
769 3300046691 Ga0495670_0078044 Ga0495670_0078044_103_1416 437
770 3300046692 Ga0495671_0013895 Ga0495671_0013895_2275_3588 437
771 3300046692 Ga0495671_0044287 Ga0495671_0044287_493_1806 437
772 3300046694 Ga0495649_0011672 Ga0495649_0011672_1398_2711 437
773 3300046694 Ga0495649_0018020 Ga0495649_0018020_1690_3003 437
774 3300046694 Ga0495649_0057159 Ga0495649_0057159_38_1351 437
775 3300046694 Ga0495649_0057233 Ga0495649_0057233_416_1729 437
776 3300046694 Ga0495649_0066215 Ga0495649_0066215_159_1472 437
777 3300046794 Ga0495589_0004416 Ga0495589_0004416_1992_3305 437
778 3300046794 Ga0495589_0005848 Ga0495589_0005848_631_1944 437
779 3300046810 Ga0495660_0012400 Ga0495660_0012400_812_2125 437
780 3300046810 Ga0495660_0040431 Ga0495660_0040431_1207_2520 437
781 3300047315 Ga0495581_0011286 Ga0495581_0011286_1729_3042 437
782 3300047318 Ga0495636_0005957 Ga0495636_0005957_1451_2764 437
783 3300047320 Ga0495672_0005482 Ga0495672_0005482_7600_8913 437
784 3300047320 Ga0495672_0014692 Ga0495672_0014692_3570_4883 437
785 3300047320 Ga0495672_0022197 Ga0495672_0022197_987_2300 437
786 3300047320 Ga0495672_0032814 Ga0495672_0032814_1429_2742 437
787 3300047323 Ga0495683_0012672 Ga0495683_0012672_3041_4354 437
788 3300047443 Ga0495687_000399 Ga0495687_000399_31311_32624 437
789 3300047443 Ga0495687_004790 Ga0495687_004790_6198_7511 437
790 3300047443 Ga0495687_008075 Ga0495687_008075_222_1535 437
791 3300047443 Ga0495687_009135 Ga0495687_009135_3753_5066 437
792 3300047469 Ga0495673_0000665 Ga0495673_0000665_23791_25104 437
793 3300047469 Ga0495673_0004646 Ga0495673_0004646_5548_6861 437
794 3300047469 Ga0495673_0006531 Ga0495673_0006531_644_1957 437
795 3300047469 Ga0495673_0011860 Ga0495673_0011860_2133_3446 437
796 3300047470 Ga0495681_0001328 Ga0495681_0001328_5477_6790 437
797 3300047472 Ga0495686_0036332 Ga0495686_0036332_1477_2790 437
798 3300048091 Ga0495626_0000192 Ga0495626_0000192_46908_48221 437
799 3300048091 Ga0495626_0000634 Ga0495626_0000634_23092_24405 437
800 3300048091 Ga0495626_0001216 Ga0495626_0001216_4490_5803 437
801 3300048091 Ga0495626_0021761 Ga0495626_0021761_1416_2729 437
802 3300048908 Ga0496105_0059302 Ga0496105_0059302_800_2113 437
803 3300048919 Ga0496116_0011263 Ga0496116_0011263_4067_5380 437
804 3300048920 Ga0496117_0068190 Ga0496117_0068190_489_1802 437
805 3300048920 Ga0496117_0098903 Ga0496117_0098903_208_1530 437
806 3300048921 Ga0496118_0062352 Ga0496118_0062352_945_2258 437
807 3300048925 Ga0496122_0006870 Ga0496122_0006870_3977_5290 437
808 3300048926 Ga0496123_0025244 Ga0496123_0025244_385_1698 437
809 3300048927 Ga0496124_0012316 Ga0496124_0012316_3595_4908 437
810 3300049459 Ga0495678_002734 Ga0495678_002734_2117_3430 437
811 3300049459 Ga0495678_011702 Ga0495678_011702_201_1514 437
812 3300049460 Ga0495682_0025074 Ga0495682_0025074_325_1638 437
813 3300050489 nmdc:mga03683_7918_c1 nmdc:mga03683_7918_c1_486_1799 437

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03573

OprD

outer membrane porin, OprD family

49

462

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4foz-assembly1.cif.gz_A crystal structure of occd1 (oprd) y282r/d307h 0.9584 27 436
3sy7-assembly1.cif.gz_A improved crystal structure of pseudomonas aeruginosa oprd 0.957 27 436
2y2x-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa opdk with vanillate 0.9534 28 434
2odj-assembly2.cif.gz_B crystal structure of the outer membrane protein oprd from pseudomonas aeruginosa 0.9527 27 435
2y2x-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa opdk with vanillate 0.9484 28 434
ID Description Score Start End Superfamily
2odjA01 Mainly Beta;Beta Barrel;Porin;Porin 0.9579 32 435 2.40.160.10
2odjA01 Mainly Beta;Beta Barrel;Porin;Porin 0.9553 32 435 2.40.160.10
2y2xB01 Mainly Beta;Beta Barrel;Porin;Porin 0.9472 32 434 2.40.160.10
2y2xB01 Mainly Beta;Beta Barrel;Porin;Porin 0.9423 32 434 2.40.160.10
4fsoA01 Mainly Beta;Beta Barrel;Porin;Porin 0.9328 32 436 2.40.160.10
ID Description Score Start End GO Terms
AF-A0A7U9EYD1-F1-model_v4 deleted 0.9682 23 436
AF-A0A7U9EYD1-F1-model_v4 deleted 0.9613 23 436
AF-A0A656K693-F1-model_v4 Porin D 0.9589 40 436 GO:0015288
GO:0016020
AF-A0A2N8GT66-F1-model_v4 deleted 0.9563 64 166
AF-Q0VKF0-F1-model_v4 Putative outer membrane protein D 0.9561 43 431 GO:0015288
GO:0016020

Feature Viewer

pLDDT pTM Quality
85.16 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map