F481898

General Info

Members Datasets Scaffolds Average Seq Length
812 326 680 197

Family's Representative Sequence

Representative Sequence 3300041405|Ga0439438_003794|Ga0439438_003794_2119_2736
Length 205
Sequence MSHSIAVIVLAAGVGKRFRQIAGPDKDKLLADCTGRDGAVRSVIEQVLVNLPASLAKRVLVTTEARPQAMRMAQAYGCDVVSIESTGMGDSIAAGVAACPGADGWLIVLGDMPFILPSSIERVLAAMADDAVSVPVLGGEFGHPVGFGRSFGAQLQALTGDRGARPLFAQGRVVEVAVDDPGVLWDIDVPEALVFKSPSPRGRGD

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231008 Pseudomonas sp. GM21 Isolate Nodule
3 2511231010 Pseudomonas sp. GM25 Isolate Nodule
4 2511231011 Pseudomonas sp. GM30 Isolate Nodule
5 2511231012 Pseudomonas sp. GM33 Isolate Nodule
6 2511231014 Pseudomonas sp. GM48 Isolate Nodule
7 2511231015 Pseudomonas sp. GM49 Isolate Nodule
8 2511231017 Pseudomonas sp. GM55 Isolate Nodule
9 2511231018 Pseudomonas sp. GM60 Isolate Nodule
10 2511231019 Pseudomonas sp. GM67 Isolate Nodule
11 2511231020 Pseudomonas sp. GM74 Isolate Nodule
12 2511231023 Pseudomonas sp. GM80 Isolate Nodule
13 2511231031 Pseudomonas sp. GM16 Isolate Nodule
14 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
15 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
16 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
17 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
18 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
19 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
20 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
21 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
22 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
23 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
24 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
25 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
26 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
27 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
28 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
29 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
30 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
31 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
32 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
33 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
34 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
35 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
36 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
37 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
38 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
39 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
40 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
41 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
42 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
43 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
44 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
45 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
46 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
47 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
48 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
49 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
50 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
51 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
52 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
53 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
54 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
55 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
56 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
57 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
58 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
59 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
60 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
61 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
62 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
63 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
64 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
65 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
66 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
67 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
68 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
69 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
70 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
71 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
72 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
73 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
74 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
75 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
76 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
77 2773857673 Pseudomonas sp. 443 Isolate Unclassified
78 2784132063 Pseudomonas sp. 424 Isolate Unclassified
79 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
80 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
81 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
82 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
83 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
84 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
85 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
86 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
87 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
88 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
89 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
90 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
91 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
92 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
93 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
94 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
95 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
96 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
97 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
98 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
99 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
100 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
101 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
102 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
103 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
104 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
105 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
106 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
107 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
108 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
109 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
110 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
111 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
112 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
113 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
114 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
115 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
116 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
117 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
118 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
119 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
120 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
121 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
122 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
123 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
124 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
125 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
126 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
127 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
128 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
129 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
130 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
131 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
132 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
133 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
134 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
135 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
136 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
137 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
138 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
139 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
140 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
141 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
142 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
143 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
144 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
145 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
146 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
147 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
148 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
149 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
150 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
151 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
152 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
153 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
154 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
155 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
156 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
157 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
158 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
159 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
160 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
161 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
162 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
163 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
165 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
166 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
167 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
179 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
180 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
181 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
182 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
185 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
186 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
195 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
196 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
197 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
198 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
199 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
200 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
201 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
202 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
203 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
204 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
205 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
206 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
207 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
208 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
209 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
210 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
211 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
212 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
213 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
214 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
215 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
216 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
217 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
218 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
219 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
220 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
221 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
222 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
223 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
224 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
225 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
226 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
227 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
228 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
229 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
230 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
231 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
232 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
233 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
234 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
235 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
236 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
237 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
238 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
239 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
240 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
241 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
242 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
243 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
244 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
245 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
246 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
247 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
248 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
249 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
250 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
251 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
252 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
253 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
254 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
255 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
256 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
257 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
258 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
259 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
260 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
261 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
262 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
263 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
264 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
265 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
266 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
267 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
268 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
269 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
270 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
271 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
272 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
273 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
274 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
275 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
276 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
277 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
278 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
279 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
280 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
281 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
282 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
283 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
284 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
285 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
286 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
287 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
288 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
289 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
290 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
291 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
292 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
293 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
294 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
295 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
296 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
297 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
298 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
299 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
300 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
301 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
302 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
303 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
304 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
305 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
306 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
307 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
308 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
309 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
310 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
311 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
312 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
313 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
314 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
315 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
316 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
317 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
318 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
319 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
320 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
321 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
322 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
323 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
324 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
325 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
326 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.74
Metatranscriptomes 0
Isolates 16.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.79
Nodule 2.46
Rhizoplane 6.4
Rhizosphere 77.96
Stem 0
Stem Tuber 0
Unclassified 7.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1198867 2162886007 Bacteria 5089
2 JGI25162J39368_1001215 3300002737 Bacteria 14973
3 JGI25163J39215_1000334 3300002771 Bacteria 15639
4 JGI25163J39215_1000510 3300002771 Bacteria 11476
5 JGI25164J39214_1000422 3300002772 Bacteria 23792
6 JGI25164J39214_1000624 3300002772 Bacteria 14975
7 JGI25165J46597_1000467 3300003214 Bacteria 39971
8 JGI25165J46597_1000801 3300003214 Bacteria 23792
9 Ga0055536_1001428 3300003781 Bacteria 14400
10 Ga0055536_1001512 3300003781 Bacteria 13960
11 Ga0055530_10000712 3300003791 Bacteria 28006
12 Ga0055530_10000790 3300003791 Bacteria 26355
13 Ga0055540_1000545 3300003792 Bacteria 28028
14 Ga0055540_1000547 3300003792 Bacteria 28006
15 Ga0055531_10000202 3300003794 Bacteria 65776
16 Ga0065714_10002606 3300005288 Bacteria 16358
17 Ga0065714_10010824 3300005288 Bacteria 2413
18 Ga0065714_10073420 3300005288 Bacteria 3178
19 Ga0065714_10114270 3300005288 Bacteria 1429
20 Ga0065704_10072128 3300005289 Bacteria 9104
21 Ga0070669_100021449 3300005353 Bacteria 4615
22 Ga0070662_100019035 3300005457 Bacteria 4655
23 Ga0075364_10628273 3300006051 Bacteria 734
24 Ga0075364_10679943 3300006051 Bacteria 702
25 Ga0075432_10055269 3300006058 Bacteria 1406
26 Ga0075432_10073574 3300006058 Bacteria 1230
27 Ga0075432_10114182 3300006058 Bacteria 1009
28 Ga0075432_10219041 3300006058 Bacteria 760
29 Ga0075362_10013137 3300006177 Bacteria 3307
30 Ga0075436_100117710 3300006914 Bacteria 1857
31 Ga0079104_1000577 3300006946 Bacteria 37077
32 Ga0079104_1000596 3300006946 Bacteria 35866
33 Ga0099826_10035378 3300006948 Bacteria 3554
34 Ga0105251_10010573 3300009011 Bacteria 5344
35 Ga0105251_10034965 3300009011 Bacteria 2482
36 Ga0105251_10054667 3300009011 Bacteria 1895
37 Ga0105251_10184258 3300009011 Bacteria 940
38 Ga0105251_10229160 3300009011 Bacteria 837
39 Ga0105244_10003940 3300009036 Bacteria 10411
40 Ga0105244_10010942 3300009036 Bacteria 5472
41 Ga0105244_10035493 3300009036 Bacteria 2619
42 Ga0105244_10038006 3300009036 Bacteria 2513
43 Ga0105244_10142688 3300009036 Bacteria 1151
44 Ga0105244_10164868 3300009036 Bacteria 1057
45 Ga0105244_10170490 3300009036 Bacteria 1035
46 Ga0105250_10003123 3300009092 Bacteria 7972
47 Ga0105250_10003645 3300009092 Bacteria 7250
48 Ga0105250_10008566 3300009092 Bacteria 4337
49 Ga0105250_10029353 3300009092 Bacteria 2213
50 Ga0105250_10029412 3300009092 Bacteria 2211
51 Ga0105243_10000983 3300009148 Bacteria 26562
52 Ga0105243_10074273 3300009148 Bacteria 2757
53 Ga0105249_10547347 3300009553 Bacteria 1208
54 Ga0105246_10003881 3300011119 Bacteria 9057
55 Ga0157345_1000063 3300012498 Bacteria 22692
56 Ga0157373_10003040 3300013100 Bacteria 12650
57 Ga0157373_10004515 3300013100 Bacteria 10463
58 Ga0157373_10014698 3300013100 Bacteria 5735
59 Ga0157373_10042511 3300013100 Bacteria 3248
60 Ga0157373_10058889 3300013100 Bacteria 2722
61 Ga0157371_10003249 3300013102 Bacteria 14908
62 Ga0157371_10003285 3300013102 Bacteria 14799
63 Ga0157371_10053789 3300013102 Bacteria 2859
64 Ga0157370_10031519 3300013104 Bacteria 5184
65 Ga0157370_10051033 3300013104 Bacteria 3952
66 Ga0157370_10250289 3300013104 Bacteria 1639
67 Ga0157370_10428922 3300013104 Bacteria 1216
68 Ga0157369_10012356 3300013105 Bacteria 9695
69 Ga0157369_10013095 3300013105 Bacteria 9386
70 Ga0157369_11174745 3300013105 Bacteria 783
71 Ga0163162_10017601 3300013306 Bacteria 6992
72 Ga0163162_10020087 3300013306 Bacteria 6559
73 Ga0163162_10517259 3300013306 Bacteria 1323
74 Ga0157372_10008391 3300013307 Bacteria 10977
75 Ga0157375_10074697 3300013308 Bacteria 3412
76 Ga0182008_10003936 3300014497 Bacteria 8791
77 Ga0182008_10006263 3300014497 Bacteria 6683
78 Ga0182008_10006521 3300014497 Bacteria 6515
79 Ga0182008_10033445 3300014497 Bacteria 2579
80 Ga0182008_10038003 3300014497 Bacteria 2408
81 Ga0182006_1002140 3300015261 Bacteria 10974
82 Ga0182006_1014728 3300015261 Bacteria 3366
83 Ga0182006_1016873 3300015261 Bacteria 3111
84 Ga0182006_1022301 3300015261 Bacteria 2633
85 Ga0182006_1042145 3300015261 Bacteria 1789
86 Ga0182007_10018350 3300015262 Bacteria 2535
87 Ga0182005_1013905 3300015265 Bacteria 2260
88 Ga0182005_1014295 3300015265 Bacteria 2222
89 Ga0182005_1015438 3300015265 Bacteria 2130
90 Ga0163161_10002255 3300017792 Bacteria 13834
91 Ga0163161_10004539 3300017792 Bacteria 9664
92 Ga0163161_10053456 3300017792 Bacteria 2929
93 Ga0163161_10256919 3300017792 Bacteria 1363
94 Ga0163161_10311403 3300017792 Bacteria 1242
95 Ga0209760_100233 3300025207 Bacteria 23922
96 Ga0209760_100269 3300025207 Bacteria 19191
97 Ga0209563_100668 3300025230 Bacteria 10879
98 Ga0207427_100001 3300025231 Bacteria 1410763
99 Ga0207427_100008 3300025231 Bacteria 740731
100 Ga0209437_100003 3300025233 Bacteria 1517827
101 Ga0209437_100014 3300025233 Bacteria 740714
102 Ga0209233_1000007 3300025261 Bacteria 1411234
103 Ga0209233_1000008 3300025261 Bacteria 1356712
104 Ga0209675_1007244 3300025291 Bacteria 4294
105 Ga0209676_1000010 3300025292 Bacteria 954025
106 Ga0209676_1000109 3300025292 Bacteria 217531
107 Ga0209676_1001671 3300025292 Bacteria 19264
108 Ga0209676_1005112 3300025292 Bacteria 6999
109 Ga0209050_1001085 3300025298 Bacteria 33197
110 Ga0209050_1001353 3300025298 Bacteria 26942
111 Ga0209050_1002606 3300025298 Bacteria 14936
112 Ga0209051_1000794 3300025303 Bacteria 33205
113 Ga0209051_1000828 3300025303 Bacteria 32008
114 Ga0209051_1006904 3300025303 Bacteria 6305
115 Ga0209257_1000040 3300025304 Bacteria 538759
116 Ga0209257_1019348 3300025304 Bacteria 2569
117 Ga0207696_1000097 3300025711 Bacteria 175696
118 Ga0207696_1004318 3300025711 Bacteria 6151
119 Ga0207696_1005424 3300025711 Bacteria 5296
120 Ga0207696_1012576 3300025711 Bacteria 2986
121 Ga0207696_1096101 3300025711 Bacteria 810
122 Ga0207655_1000467 3300025728 Bacteria 52754
123 Ga0207655_1002449 3300025728 Bacteria 15069
124 Ga0207655_1023490 3300025728 Bacteria 3056
125 Ga0207655_1029946 3300025728 Bacteria 2539
126 Ga0207655_1033277 3300025728 Bacteria 2339
127 Ga0207655_1043334 3300025728 Bacteria 1904
128 Ga0207713_1000898 3300025735 Bacteria 26955
129 Ga0207713_1010592 3300025735 Bacteria 5091
130 Ga0207713_1011049 3300025735 Bacteria 4945
131 Ga0207713_1017429 3300025735 Bacteria 3600
132 Ga0207713_1022262 3300025735 Bacteria 3013
133 Ga0207713_1026437 3300025735 Bacteria 2659
134 Ga0207713_1031998 3300025735 Bacteria 2317
135 Ga0207713_1061945 3300025735 Bacteria 1421
136 Ga0207713_1075725 3300025735 Bacteria 1227
137 Ga0207681_10016435 3300025923 Bacteria 4630
138 Ga0207709_10000035 3300025935 Bacteria 300968
139 Ga0207709_10000809 3300025935 Bacteria 24294
140 Ga0207712_10707660 3300025961 Bacteria 879
141 Ga0209281_1000642 3300027111 Bacteria 38198
142 Ga0209281_1000656 3300027111 Bacteria 37155
143 Ga0209281_1002134 3300027111 Bacteria 8714
144 Ga0209281_1014839 3300027111 Bacteria 1640
145 Ga0209282_1028507 3300027666 Bacteria 3458
146 Ga0207428_10012434 3300027907 Bacteria 7479
147 Ga0207428_10019065 3300027907 Bacteria 5851
148 Ga0207428_10020276 3300027907 Bacteria 5649
149 Ga0207428_10024709 3300027907 Bacteria 5044
150 Ga0207428_10048029 3300027907 Bacteria 3426
151 Ga0307517_10363871 3300028786 Bacteria 780
152 Ga0316178_1006889 3300030735 Bacteria 10673
153 Ga0307408_100003150 3300031548 Bacteria 11364
154 Ga0307408_100010035 3300031548 Bacteria 6241
155 Ga0307408_100016854 3300031548 Bacteria 4883
156 Ga0307408_100018960 3300031548 Bacteria 4626
157 Ga0307408_100031842 3300031548 Bacteria 3674
158 Ga0307408_100131867 3300031548 Bacteria 1950
159 Ga0307408_101418514 3300031548 Bacteria 654
160 Ga0307516_10199105 3300031730 Bacteria 1724
161 Ga0307405_10001242 3300031731 Bacteria 10617
162 Ga0307405_10003654 3300031731 Bacteria 7122
163 Ga0307405_10006850 3300031731 Bacteria 5649
164 Ga0307405_10768604 3300031731 Bacteria 804
165 Ga0307413_10009520 3300031824 Bacteria 4656
166 Ga0307413_10710446 3300031824 Bacteria 836
167 Ga0307406_10079193 3300031901 Bacteria 2178
168 Ga0307407_10023048 3300031903 Bacteria 3242
169 Ga0307412_10002449 3300031911 Bacteria 10326
170 Ga0307412_10004899 3300031911 Bacteria 7475
171 Ga0307412_10009595 3300031911 Bacteria 5557
172 Ga0307412_10022741 3300031911 Bacteria 3848
173 Ga0307412_10150101 3300031911 Bacteria 1718
174 Ga0307412_10462948 3300031911 Bacteria 1047
175 Ga0307409_100086827 3300031995 Bacteria 2547
176 Ga0307416_100096402 3300032002 Bacteria 2558
177 Ga0307416_100360660 3300032002 Bacteria 1475
178 Ga0307416_100525626 3300032002 Bacteria 1252
179 Ga0307416_101497604 3300032002 Bacteria 780
180 Ga0307414_10015886 3300032004 Bacteria 4559
181 Ga0307414_10043511 3300032004 Bacteria 3059
182 Ga0307414_10737946 3300032004 Bacteria 894
183 Ga0307414_10782769 3300032004 Bacteria 869
184 Ga0307414_11331782 3300032004 Bacteria 666
185 Ga0307411_10006455 3300032005 Bacteria 5872
186 Ga0307411_10081861 3300032005 Bacteria 2224
187 Ga0307411_10289758 3300032005 Bacteria 1307
188 Ga0307510_10002605 3300033180 Bacteria 20588
189 Ga0439438_000134 3300041405 Bacteria 33482
190 Ga0439438_001936 3300041405 Bacteria 9034
191 Ga0439438_002229 3300041405 Bacteria 8338
192 Ga0439438_003794 3300041405 Bacteria 5972
193 Ga0439438_004024 3300041405 Bacteria 5775
194 Ga0439438_004471 3300041405 Bacteria 5350
195 Ga0439438_005336 3300041405 Bacteria 4751
196 Ga0439438_009393 3300041405 Bacteria 3168
197 Ga0439438_024183 3300041405 Bacteria 1665
198 Ga0439447_001541 3300041407 Bacteria 8426
199 Ga0439447_004749 3300041407 Bacteria 4628
200 Ga0439447_006222 3300041407 Bacteria 3892
201 Ga0439447_008612 3300041407 Bacteria 3149
202 Ga0439447_014159 3300041407 Bacteria 2242
203 Ga0439447_015594 3300041407 Bacteria 2106
204 Ga0439447_023269 3300041407 Bacteria 1615
205 Ga0439466_0001287 3300041411 Bacteria 9761
206 Ga0439466_0008637 3300041411 Bacteria 3839
207 Ga0439466_0010753 3300041411 Bacteria 3397
208 Ga0439466_0018456 3300041411 Bacteria 2502
209 Ga0439466_0029055 3300041411 Bacteria 1904
210 Ga0439466_0108418 3300041411 Bacteria 862
211 Ga0439431_0005237 3300041997 Bacteria 2859
212 Ga0439442_072800 3300042002 Bacteria 732
213 Ga0439445_0034698 3300042004 Bacteria 1323
214 Ga0439445_0053516 3300042004 Bacteria 1093
215 Ga0439445_0063011 3300042004 Bacteria 1016
216 Ga0439432_004839 3300042006 Bacteria 4882
217 Ga0439432_005060 3300042006 Bacteria 4767
218 Ga0439432_009358 3300042006 Bacteria 3418
219 Ga0439432_010078 3300042006 Bacteria 3284
220 Ga0439432_068330 3300042006 Bacteria 1086
221 Ga0439451_006794 3300042009 Bacteria 2341
222 Ga0439451_009714 3300042009 Bacteria 1943
223 Ga0439451_080653 3300042009 Bacteria 653
224 Ga0439452_001153 3300042010 Bacteria 11489
225 Ga0439452_001988 3300042010 Bacteria 7824
226 Ga0439452_002515 3300042010 Bacteria 6742
227 Ga0439452_006284 3300042010 Bacteria 3729
228 Ga0439452_007932 3300042010 Bacteria 3217
229 Ga0439452_008153 3300042010 Bacteria 3169
230 Ga0439452_025277 3300042010 Bacteria 1509
231 Ga0439456_003007 3300042013 Bacteria 3409
232 Ga0439456_011179 3300042013 Bacteria 1855
233 Ga0439456_013019 3300042013 Bacteria 1729
234 Ga0439456_047396 3300042013 Bacteria 937
235 Ga0439456_064693 3300042013 Bacteria 806
236 Ga0439463_004151 3300042016 Bacteria 3637
237 Ga0439463_023724 3300042016 Bacteria 1536
238 Ga0439463_036066 3300042016 Bacteria 1252
239 Ga0439463_037454 3300042016 Bacteria 1230
240 Ga0450911_000276 3300042115 Bacteria 19065
241 Ga0450911_001087 3300042115 Bacteria 6831
242 Ga0450911_022571 3300042115 Bacteria 819
243 Ga0450922_001487 3300042124 Bacteria 2301
244 Ga0450923_041368 3300042125 Bacteria 969
245 Ga0450902_002023 3300042137 Bacteria 2839
246 Ga0450902_022161 3300042137 Bacteria 1051
247 Ga0450903_004344 3300042138 Bacteria 2423
248 Ga0450903_049769 3300042138 Bacteria 614
249 Ga0450904_002176 3300042139 Bacteria 2408
250 Ga0450904_014493 3300042139 Bacteria 786
251 Ga0450905_002369 3300042142 Bacteria 2418
252 Ga0450906_002614 3300042145 Bacteria 3930
253 Ga0450907_000070 3300042146 Bacteria 39296
254 Ga0450907_005728 3300042146 Bacteria 2090
255 Ga0450910_007357 3300042147 Bacteria 1534
256 Ga0439446_0062347 3300042156 Bacteria 1128
257 Ga0450909_003463 3300042185 Bacteria 2251
258 Ga0450909_005486 3300042185 Bacteria 1824
259 Ga0439434_0002019 3300042435 Bacteria 5865
260 Ga0439460_0003275 3300042461 Bacteria 3918
261 Ga0439460_0007345 3300042461 Bacteria 2751
262 Ga0450918_027380 3300042531 Bacteria 1002
263 Ga0450901_001816 3300042533 Bacteria 2393
264 Ga0439440_0003403 3300042993 Bacteria 3065
265 Ga0495617_001389 3300046452 Bacteria 10664
266 Ga0495617_006607 3300046452 Bacteria 4055
267 Ga0495617_007721 3300046452 Bacteria 3719
268 Ga0495617_010498 3300046452 Bacteria 3172
269 Ga0495617_011059 3300046452 Bacteria 3084
270 Ga0495617_016398 3300046452 Bacteria 2504
271 Ga0495617_027973 3300046452 Bacteria 1896
272 Ga0495617_034017 3300046452 Bacteria 1710
273 Ga0495627_001762 3300046453 Bacteria 11648
274 Ga0495627_007768 3300046453 Bacteria 4086
275 Ga0495627_007769 3300046453 Bacteria 4085
276 Ga0495627_011176 3300046453 Bacteria 3230
277 Ga0495627_062594 3300046453 Bacteria 1098
278 Ga0495627_065406 3300046453 Bacteria 1069
279 Ga0495627_081934 3300046453 Bacteria 934
280 Ga0495603_0073966 3300046455 Bacteria 2001
281 Ga0495603_0084244 3300046455 Bacteria 1861
282 Ga0495590_0014434 3300046457 Bacteria 2881
283 Ga0495590_0031394 3300046457 Bacteria 1860
284 Ga0495590_0093889 3300046457 Bacteria 1062
285 Ga0495591_000783 3300046458 Bacteria 22628
286 Ga0495591_001989 3300046458 Bacteria 11914
287 Ga0495591_002231 3300046458 Bacteria 11041
288 Ga0495591_003066 3300046458 Bacteria 8857
289 Ga0495591_003922 3300046458 Bacteria 7494
290 Ga0495591_005192 3300046458 Bacteria 6101
291 Ga0495591_010157 3300046458 Bacteria 3671
292 Ga0495591_011841 3300046458 Bacteria 3278
293 Ga0495591_029375 3300046458 Bacteria 1670
294 Ga0495591_075219 3300046458 Bacteria 870
295 Ga0495638_0007217 3300046460 Bacteria 7989
296 Ga0495638_0021482 3300046460 Bacteria 4252
297 Ga0495638_0025716 3300046460 Bacteria 3822
298 Ga0495638_0034644 3300046460 Bacteria 3223
299 Ga0495638_0040414 3300046460 Bacteria 2955
300 Ga0495638_0083447 3300046460 Bacteria 1935
301 Ga0495638_0086581 3300046460 Bacteria 1893
302 Ga0495638_0102542 3300046460 Bacteria 1709
303 Ga0495638_0102566 3300046460 Bacteria 1709
304 Ga0495653_0005408 3300046463 Bacteria 10394
305 Ga0495653_0086942 3300046463 Bacteria 2296
306 Ga0495653_0123829 3300046463 Bacteria 1838
307 Ga0495650_0011247 3300046471 Bacteria 4917
308 Ga0495650_0012205 3300046471 Bacteria 4636
309 Ga0495650_0016481 3300046471 Bacteria 3740
310 Ga0495650_0238986 3300046471 Bacteria 621
311 Ga0495605_0000067 3300046474 Bacteria 138871
312 Ga0495605_0018139 3300046474 Bacteria 3778
313 Ga0495605_0018524 3300046474 Bacteria 3731
314 Ga0495605_0041837 3300046474 Bacteria 2281
315 Ga0495605_0061761 3300046474 Bacteria 1792
316 Ga0495605_0274780 3300046474 Bacteria 717
317 Ga0495639_0011468 3300046475 Bacteria 3821
318 Ga0495584_0002080 3300046491 Bacteria 11475
319 Ga0495584_0005386 3300046491 Bacteria 6780
320 Ga0495584_0014653 3300046491 Bacteria 3994
321 Ga0495584_0015276 3300046491 Bacteria 3911
322 Ga0495584_0015483 3300046491 Bacteria 3886
323 Ga0495584_0025131 3300046491 Bacteria 3019
324 Ga0495584_0069661 3300046491 Bacteria 1767
325 Ga0495584_0134990 3300046491 Bacteria 1252
326 Ga0495584_0152684 3300046491 Bacteria 1173
327 Ga0495585_0002404 3300046492 Bacteria 13406
328 Ga0495585_0007012 3300046492 Bacteria 6938
329 Ga0495585_0007831 3300046492 Bacteria 6500
330 Ga0495585_0009606 3300046492 Bacteria 5791
331 Ga0495585_0033923 3300046492 Bacteria 2886
332 Ga0495585_0081130 3300046492 Bacteria 1757
333 Ga0495585_0214037 3300046492 Bacteria 975
334 Ga0495594_0039102 3300046499 Bacteria 2592
335 Ga0495594_0421049 3300046499 Bacteria 759
336 Ga0495596_0000463 3300046500 Bacteria 25768
337 Ga0495596_0017047 3300046500 Bacteria 3012
338 Ga0495607_0004027 3300046501 Bacteria 11020
339 Ga0495607_0024230 3300046501 Bacteria 3786
340 Ga0495607_0027116 3300046501 Bacteria 3547
341 Ga0495607_0028997 3300046501 Bacteria 3408
342 Ga0495607_0041062 3300046501 Bacteria 2750
343 Ga0495607_0043394 3300046501 Bacteria 2659
344 Ga0495607_0045359 3300046501 Bacteria 2586
345 Ga0495607_0062368 3300046501 Bacteria 2113
346 Ga0495607_0079945 3300046501 Bacteria 1799
347 Ga0495607_0101020 3300046501 Bacteria 1545
348 Ga0495607_0110069 3300046501 Bacteria 1461
349 Ga0495607_0112898 3300046501 Bacteria 1438
350 Ga0495607_0142098 3300046501 Bacteria 1237
351 Ga0495607_0148777 3300046501 Bacteria 1200
352 Ga0495607_0236018 3300046501 Unclassified 887
353 Ga0495607_0263513 3300046501 Bacteria 824
354 Ga0495583_0003623 3300046506 Bacteria 11563
355 Ga0495583_0008749 3300046506 Bacteria 6143
356 Ga0495583_0216297 3300046506 Bacteria 775
357 Ga0495606_0002735 3300046507 Bacteria 19850
358 Ga0495606_0006284 3300046507 Bacteria 11017
359 Ga0495606_0007433 3300046507 Bacteria 9807
360 Ga0495606_0008770 3300046507 Bacteria 8688
361 Ga0495606_0029685 3300046507 Bacteria 3833
362 Ga0495606_0030806 3300046507 Bacteria 3740
363 Ga0495606_0059181 3300046507 Bacteria 2458
364 Ga0495606_0068218 3300046507 Bacteria 2250
365 Ga0495606_0092233 3300046507 Bacteria 1860
366 Ga0495606_0160949 3300046507 Bacteria 1310
367 Ga0495606_0429932 3300046507 Bacteria 681
368 Ga0495610_0005212 3300046512 Bacteria 9303
369 Ga0495610_0006143 3300046512 Bacteria 8361
370 Ga0495610_0006684 3300046512 Bacteria 7855
371 Ga0495610_0014014 3300046512 Bacteria 4735
372 Ga0495610_0015454 3300046512 Bacteria 4434
373 Ga0495610_0018644 3300046512 Bacteria 3911
374 Ga0495610_0036552 3300046512 Bacteria 2508
375 Ga0495610_0039135 3300046512 Bacteria 2400
376 Ga0495610_0043954 3300046512 Bacteria 2221
377 Ga0495610_0084337 3300046512 Bacteria 1452
378 Ga0495610_0190929 3300046512 Bacteria 845
379 Ga0495616_0004347 3300046513 Bacteria 8940
380 Ga0495616_0014363 3300046513 Bacteria 4434
381 Ga0495616_0017219 3300046513 Bacteria 3987
382 Ga0495616_0025181 3300046513 Bacteria 3182
383 Ga0495616_0080271 3300046513 Bacteria 1562
384 Ga0495620_0002178 3300046515 Bacteria 11384
385 Ga0495620_0005936 3300046515 Bacteria 6766
386 Ga0495620_0008992 3300046515 Bacteria 5335
387 Ga0495620_0009845 3300046515 Bacteria 5066
388 Ga0495620_0017613 3300046515 Bacteria 3554
389 Ga0495620_0024483 3300046515 Bacteria 2870
390 Ga0495620_0030256 3300046515 Bacteria 2495
391 Ga0495620_0075485 3300046515 Bacteria 1371
392 Ga0495620_0082798 3300046515 Bacteria 1296
393 Ga0495630_0029370 3300046517 Bacteria 4088
394 Ga0495630_0133274 3300046517 Bacteria 1887
395 Ga0495631_0000587 3300046518 Bacteria 24169
396 Ga0495631_0017328 3300046518 Bacteria 3411
397 Ga0495631_0021437 3300046518 Bacteria 3009
398 Ga0495631_0082565 3300046518 Bacteria 1385
399 Ga0495632_0005283 3300046519 Bacteria 8578
400 Ga0495632_0005710 3300046519 Bacteria 8167
401 Ga0495632_0010136 3300046519 Bacteria 5608
402 Ga0495632_0021724 3300046519 Bacteria 3453
403 Ga0495632_0052094 3300046519 Bacteria 2013
404 Ga0495632_0052667 3300046519 Bacteria 2000
405 Ga0495632_0061323 3300046519 Bacteria 1825
406 Ga0495632_0062849 3300046519 Bacteria 1799
407 Ga0495632_0170203 3300046519 Bacteria 1001
408 Ga0495632_0339640 3300046519 Bacteria 661
409 Ga0495637_0000812 3300046520 Bacteria 20622
410 Ga0495637_0001172 3300046520 Bacteria 16011
411 Ga0495637_0002966 3300046520 Bacteria 9130
412 Ga0495637_0003937 3300046520 Bacteria 7778
413 Ga0495637_0012911 3300046520 Bacteria 3980
414 Ga0495637_0016793 3300046520 Bacteria 3419
415 Ga0495637_0017351 3300046520 Bacteria 3356
416 Ga0495637_0020598 3300046520 Bacteria 3032
417 Ga0495637_0032602 3300046520 Bacteria 2293
418 Ga0495637_0035550 3300046520 Bacteria 2174
419 Ga0495637_0041590 3300046520 Bacteria 1970
420 Ga0495637_0048064 3300046520 Bacteria 1799
421 Ga0495643_0027866 3300046522 Bacteria 3170
422 Ga0495643_0029422 3300046522 Bacteria 3073
423 Ga0495643_0059194 3300046522 Bacteria 2037
424 Ga0495643_0068686 3300046522 Bacteria 1864
425 Ga0495643_0107258 3300046522 Bacteria 1424
426 Ga0495644_0001895 3300046523 Bacteria 8409
427 Ga0495644_0017241 3300046523 Bacteria 2761
428 Ga0495648_0004655 3300046524 Bacteria 11635
429 Ga0495648_0004781 3300046524 Bacteria 11454
430 Ga0495648_0008808 3300046524 Bacteria 7894
431 Ga0495648_0022143 3300046524 Bacteria 4383
432 Ga0495648_0038340 3300046524 Bacteria 3066
433 Ga0495648_0051341 3300046524 Bacteria 2513
434 Ga0495666_0002706 3300046526 Bacteria 8850
435 Ga0495654_0002978 3300046530 Bacteria 10597
436 Ga0495654_0013895 3300046530 Bacteria 4297
437 Ga0495654_0014087 3300046530 Bacteria 4263
438 Ga0495654_0015885 3300046530 Bacteria 3989
439 Ga0495654_0016511 3300046530 Bacteria 3901
440 Ga0495654_0023920 3300046530 Bacteria 3160
441 Ga0495654_0029839 3300046530 Bacteria 2779
442 Ga0495654_0069077 3300046530 Bacteria 1678
443 Ga0495654_0070935 3300046530 Bacteria 1651
444 Ga0495654_0076736 3300046530 Bacteria 1574
445 Ga0495654_0095015 3300046530 Bacteria 1378
446 Ga0495654_0121563 3300046530 Bacteria 1181
447 Ga0495654_0124589 3300046530 Bacteria 1162
448 Ga0495654_0136095 3300046530 Bacteria 1098
449 Ga0495654_0222891 3300046530 Bacteria 796
450 Ga0495654_0231801 3300046530 Bacteria 776
451 Ga0495587_0072607 3300046536 Bacteria 2000
452 Ga0495587_0164876 3300046536 Bacteria 1260
453 Ga0495609_0000118 3300046538 Bacteria 92011
454 Ga0495609_0003397 3300046538 Bacteria 9141
455 Ga0495609_0012192 3300046538 Bacteria 4078
456 Ga0495609_0013890 3300046538 Bacteria 3796
457 Ga0495609_0015691 3300046538 Bacteria 3542
458 Ga0495609_0020978 3300046538 Bacteria 3015
459 Ga0495609_0029209 3300046538 Bacteria 2511
460 Ga0495609_0142440 3300046538 Bacteria 1022
461 Ga0495609_0161473 3300046538 Bacteria 949
462 Ga0495597_0002230 3300046542 Bacteria 12667
463 Ga0495597_0012942 3300046542 Bacteria 4007
464 Ga0495597_0046022 3300046542 Bacteria 1934
465 Ga0495597_0083954 3300046542 Bacteria 1359
466 Ga0495597_0109710 3300046542 Bacteria 1157
467 Ga0495622_0000595 3300046557 Bacteria 21043
468 Ga0495622_0008649 3300046557 Bacteria 4717
469 Ga0495622_0061470 3300046557 Bacteria 1739
470 Ga0495633_0007296 3300046558 Bacteria 6382
471 Ga0495633_0034267 3300046558 Bacteria 2443
472 Ga0495656_0446805 3300046615 Bacteria 681
473 Ga0495668_0016952 3300046616 Bacteria 4230
474 Ga0495668_0021642 3300046616 Bacteria 3684
475 Ga0495668_0027290 3300046616 Bacteria 3235
476 Ga0495668_0073538 3300046616 Bacteria 1877
477 Ga0495634_0067914 3300046642 Bacteria 2356
478 Ga0495611_0000447 3300046648 Bacteria 25011
479 Ga0495611_0042343 3300046648 Bacteria 2033
480 Ga0495611_0341275 3300046648 Bacteria 688
481 Ga0495625_0004966 3300046660 Bacteria 12363
482 Ga0495625_0009216 3300046660 Bacteria 8288
483 Ga0495625_0011012 3300046660 Bacteria 7420
484 Ga0495625_0018359 3300046660 Bacteria 5463
485 Ga0495625_0095195 3300046660 Bacteria 2053
486 Ga0495625_0138222 3300046660 Bacteria 1645
487 Ga0495625_0142192 3300046660 Bacteria 1618
488 Ga0495625_0362358 3300046660 Bacteria 913
489 Ga0495661_0000961 3300046665 Bacteria 26164
490 Ga0495661_0012872 3300046665 Bacteria 5638
491 Ga0495661_0017544 3300046665 Bacteria 4725
492 Ga0495661_0090473 3300046665 Bacteria 1742
493 Ga0495661_0137627 3300046665 Bacteria 1331
494 Ga0495657_0269406 3300046675 Bacteria 1021
495 Ga0495623_0019229 3300046679 Bacteria 4416
496 Ga0495646_0034741 3300046680 Bacteria 3129
497 Ga0495613_0053059 3300046689 Bacteria 2984
498 Ga0495613_0097437 3300046689 Bacteria 2126
499 Ga0495624_0003821 3300046690 Bacteria 11133
500 Ga0495670_0000847 3300046691 Bacteria 14776
501 Ga0495670_0002894 3300046691 Bacteria 8452
502 Ga0495670_0013552 3300046691 Bacteria 4009
503 Ga0495670_0019834 3300046691 Bacteria 3313
504 Ga0495670_0372801 3300046691 Bacteria 769
505 Ga0495670_0428580 3300046691 Bacteria 716
506 Ga0495671_0004644 3300046692 Bacteria 8142
507 Ga0495671_0007245 3300046692 Bacteria 6337
508 Ga0495671_0008526 3300046692 Bacteria 5762
509 Ga0495671_0015592 3300046692 Bacteria 4067
510 Ga0495671_0017580 3300046692 Bacteria 3803
511 Ga0495671_0019270 3300046692 Bacteria 3610
512 Ga0495671_0025700 3300046692 Bacteria 3057
513 Ga0495671_0038051 3300046692 Bacteria 2432
514 Ga0495671_0050553 3300046692 Bacteria 2069
515 Ga0495671_0065844 3300046692 Bacteria 1783
516 Ga0495649_0010531 3300046694 Bacteria 5450
517 Ga0495649_0018975 3300046694 Bacteria 3863
518 Ga0495649_0022830 3300046694 Bacteria 3498
519 Ga0495649_0029411 3300046694 Bacteria 3038
520 Ga0495649_0060393 3300046694 Bacteria 2039
521 Ga0495649_0176408 3300046694 Bacteria 1116
522 Ga0495649_0270572 3300046694 Bacteria 869
523 Ga0495649_0304645 3300046694 Bacteria 810
524 Ga0495589_0001285 3300046794 Bacteria 14844
525 Ga0495589_0002906 3300046794 Bacteria 9465
526 Ga0495589_0003991 3300046794 Bacteria 7921
527 Ga0495589_0004701 3300046794 Bacteria 7247
528 Ga0495589_0026119 3300046794 Bacteria 2960
529 Ga0495589_0050743 3300046794 Bacteria 2051
530 Ga0495600_0028154 3300046809 Bacteria 3634
531 Ga0495660_0010228 3300046810 Bacteria 5454
532 Ga0495660_0013944 3300046810 Bacteria 4658
533 Ga0495660_0017049 3300046810 Bacteria 4182
534 Ga0495660_0028189 3300046810 Bacteria 3174
535 Ga0495660_0031427 3300046810 Bacteria 2984
536 Ga0495660_0033434 3300046810 Bacteria 2883
537 Ga0495660_0033444 3300046810 Bacteria 2882
538 Ga0495660_0036381 3300046810 Bacteria 2746
539 Ga0495660_0040903 3300046810 Bacteria 2568
540 Ga0495660_0054966 3300046810 Bacteria 2156
541 Ga0495660_0094323 3300046810 Bacteria 1550
542 Ga0495660_0096201 3300046810 Bacteria 1530
543 Ga0495660_0147180 3300046810 Bacteria 1166
544 Ga0495660_0200434 3300046810 Bacteria 953
545 Ga0495604_0018610 3300047317 Bacteria 5565
546 Ga0495672_0003777 3300047320 Bacteria 12756
547 Ga0495672_0012129 3300047320 Bacteria 6032
548 Ga0495672_0012796 3300047320 Bacteria 5829
549 Ga0495672_0013052 3300047320 Bacteria 5748
550 Ga0495672_0016240 3300047320 Bacteria 5025
551 Ga0495672_0058604 3300047320 Bacteria 2231
552 Ga0495672_0083939 3300047320 Bacteria 1768
553 Ga0495676_0033095 3300047321 Bacteria 4357
554 Ga0495676_0043419 3300047321 Bacteria 3679
555 Ga0495680_0023597 3300047322 Bacteria 5112
556 Ga0495680_0070077 3300047322 Bacteria 2674
557 Ga0495680_0187066 3300047322 Bacteria 1491
558 Ga0495680_0228535 3300047322 Bacteria 1325
559 Ga0495683_0001535 3300047323 Bacteria 14958
560 Ga0495683_0021100 3300047323 Bacteria 3357
561 Ga0495683_0027188 3300047323 Bacteria 2926
562 Ga0495683_0034872 3300047323 Bacteria 2558
563 Ga0495683_0069673 3300047323 Bacteria 1728
564 Ga0495683_0162075 3300047323 Bacteria 1033
565 Ga0495687_005063 3300047443 Bacteria 8567
566 Ga0495675_0205709 3300047444 Bacteria 1196
567 Ga0495675_0236657 3300047444 Bacteria 1100
568 Ga0495679_005332 3300047446 Bacteria 5716
569 Ga0495679_009059 3300047446 Bacteria 4009
570 Ga0495679_013639 3300047446 Bacteria 3039
571 Ga0495679_015649 3300047446 Bacteria 2768
572 Ga0495679_029684 3300047446 Bacteria 1782
573 Ga0495679_030146 3300047446 Bacteria 1763
574 Ga0495679_122920 3300047446 Bacteria 708
575 Ga0495673_0004801 3300047469 Bacteria 8362
576 Ga0495673_0008000 3300047469 Bacteria 5994
577 Ga0495673_0008458 3300047469 Bacteria 5788
578 Ga0495673_0016214 3300047469 Bacteria 3815
579 Ga0495673_0024702 3300047469 Bacteria 2896
580 Ga0495673_0025789 3300047469 Bacteria 2817
581 Ga0495673_0053156 3300047469 Bacteria 1767
582 Ga0495673_0059910 3300047469 Bacteria 1634
583 Ga0495673_0176708 3300047469 Bacteria 810
584 Ga0495681_0001946 3300047470 Bacteria 15115
585 Ga0495681_0003128 3300047470 Bacteria 11606
586 Ga0495681_0003665 3300047470 Bacteria 10666
587 Ga0495681_0005294 3300047470 Bacteria 8658
588 Ga0495681_0005658 3300047470 Bacteria 8325
589 Ga0495681_0005742 3300047470 Bacteria 8253
590 Ga0495681_0014155 3300047470 Bacteria 4590
591 Ga0495681_0017057 3300047470 Bacteria 4045
592 Ga0495681_0026219 3300047470 Bacteria 3038
593 Ga0495681_0026371 3300047470 Bacteria 3025
594 Ga0495681_0068104 3300047470 Bacteria 1620
595 Ga0495681_0078990 3300047470 Bacteria 1473
596 Ga0495681_0162457 3300047470 Bacteria 929
597 Ga0495681_0173170 3300047470 Bacteria 891
598 Ga0495681_0173172 3300047470 Bacteria 891
599 Ga0495684_0034958 3300047471 Bacteria 3855
600 Ga0495684_0040249 3300047471 Bacteria 3583
601 Ga0495686_0004576 3300047472 Bacteria 11290
602 Ga0495686_0007704 3300047472 Bacteria 8038
603 Ga0495686_0012770 3300047472 Bacteria 5858
604 Ga0495686_0052697 3300047472 Bacteria 2550
605 Ga0495593_0003936 3300047673 Bacteria 8868
606 Ga0495593_0009775 3300047673 Bacteria 5564
607 Ga0495593_0046464 3300047673 Bacteria 2313
608 Ga0495602_0008769 3300048088 Bacteria 10553
609 Ga0495626_0000919 3300048091 Bacteria 25813
610 Ga0495626_0000929 3300048091 Bacteria 25621
611 Ga0495626_0004079 3300048091 Bacteria 9093
612 Ga0495626_0004215 3300048091 Bacteria 8904
613 Ga0495626_0021376 3300048091 Bacteria 3210
614 Ga0495626_0027885 3300048091 Bacteria 2742
615 Ga0495626_0033026 3300048091 Bacteria 2481
616 Ga0495626_0061734 3300048091 Bacteria 1703
617 Ga0495626_0190687 3300048091 Bacteria 845
618 Ga0496101_0163709 3300048904 Bacteria 1707
619 Ga0496106_0217410 3300048909 Bacteria 1523
620 Ga0496110_0779928 3300048913 Bacteria 860
621 Ga0496116_0000618 3300048919 Bacteria 46831
622 Ga0496116_0004106 3300048919 Bacteria 14045
623 Ga0496116_0011737 3300048919 Bacteria 7217
624 Ga0496116_0045426 3300048919 Bacteria 2973
625 Ga0496117_0000871 3300048920 Bacteria 46535
626 Ga0496117_0002468 3300048920 Bacteria 23232
627 Ga0496117_0011986 3300048920 Bacteria 7702
628 Ga0496117_0043102 3300048920 Bacteria 3285
629 Ga0496117_0071455 3300048920 Bacteria 2325
630 Ga0496118_0032529 3300048921 Bacteria 4294
631 Ga0496118_0041602 3300048921 Bacteria 3635
632 Ga0496118_0047936 3300048921 Bacteria 3306
633 Ga0496118_0057659 3300048921 Bacteria 2908
634 Ga0496119_0016236 3300048922 Bacteria 5682
635 Ga0496119_0062811 3300048922 Bacteria 2211
636 Ga0496119_0423556 3300048922 Bacteria 631
637 Ga0496120_0003681 3300048923 Bacteria 13703
638 Ga0496120_0029435 3300048923 Bacteria 3352
639 Ga0496121_0001131 3300048924 Bacteria 46845
640 Ga0496121_0043246 3300048924 Bacteria 3904
641 Ga0496121_0412458 3300048924 Bacteria 881
642 Ga0496122_0011596 3300048925 Bacteria 8896
643 Ga0496122_0023342 3300048925 Bacteria 5456
644 Ga0496123_0007333 3300048926 Bacteria 10444
645 Ga0496123_0013307 3300048926 Bacteria 6924
646 Ga0496123_0054807 3300048926 Bacteria 2621
647 Ga0496124_0014348 3300048927 Bacteria 7663
648 Ga0496124_0192737 3300048927 Bacteria 1557
649 Ga0496124_0239793 3300048927 Bacteria 1349
650 Ga0496125_0002601 3300048928 Bacteria 23166
651 Ga0496125_0043819 3300048928 Bacteria 3792
652 Ga0496125_0099978 3300048928 Bacteria 2140
653 Ga0496126_0096986 3300048929 Bacteria 2584
654 Ga0495678_001518 3300049459 Bacteria 18002
655 Ga0495678_004662 3300049459 Bacteria 7862
656 Ga0495678_013624 3300049459 Bacteria 3809
657 Ga0495678_023846 3300049459 Bacteria 2652
658 Ga0495678_028093 3300049459 Bacteria 2378
659 Ga0495678_041441 3300049459 Bacteria 1842
660 Ga0495678_044162 3300049459 Bacteria 1765
661 Ga0495678_094884 3300049459 Bacteria 1043
662 Ga0495678_147693 3300049459 Bacteria 762
663 Ga0495682_0002782 3300049460 Bacteria 8081
664 Ga0495682_0004627 3300049460 Bacteria 5843
665 Ga0495682_0010884 3300049460 Bacteria 3505
666 Ga0495682_0188535 3300049460 Bacteria 732
667 Ga0501222_008438 3300049662 Bacteria 1367
668 Ga0501227_016241 3300049665 Bacteria 1671
669 Ga0501252_008691 3300049682 Bacteria 1171
670 Ga0501241_009811 3300049758 Bacteria 1741
671 Ga0501269_014611 3300049766 Bacteria 963
672 nmdc:mga03683_14606_c1 3300050489 Bacteria 1791
673 nmdc:mga00v17_15795_c1 3300050491 Bacteria 4245
674 nmdc:mga00v17_34114_c1 3300050491 Bacteria 3020
675 nmdc:mga08x19_264896_c1 3300050514 Bacteria 1189
676 nmdc:mga0sz30_58313_c1 3300050516 Bacteria 1646
677 Ga0500572_001037 3300053111 Bacteria 8289
678 Ga0500568_0114595 3300053139 Bacteria 1006
679 Ga0500577_0043875 3300053142 Bacteria 1645
680 Ga0500586_028855 3300053145 Bacteria 1815

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049665 Ga0501227_016241 Ga0501227_016241_162_656 164
2 3300042013 Ga0439456_013019 Ga0439456_013019_36_566 176
3 3300042138 Ga0450903_049769 Ga0450903_049769_59_595 176
4 3300046519 Ga0495632_0339640 Ga0495632_0339640_21_557 176
5 3300047446 Ga0495679_122920 Ga0495679_122920_16_558 176
6 3300046471 Ga0495650_0238986 Ga0495650_0238986_34_609 189
7 iso_pu_bacteria 2946006987 2946008156 189
8 3300046648 Ga0495611_0341275 Ga0495611_0341275_95_673 190
9 iso_pu_bacteria 2908446538 2908451357 190
10 iso_pu_bacteria 2600254931 2600365918 191
11 3300046536 Ga0495587_0164876 Ga0495587_0164876_22_600 192
12 3300047322 Ga0495680_0023597 Ga0495680_0023597_4344_4922 192
13 3300047673 Ga0495593_0046464 Ga0495593_0046464_1663_2241 192
14 iso_pu_bacteria 2511231008 2511277760 192
15 iso_pu_bacteria 2511231010 2511287614 192
16 iso_pu_bacteria 2511231011 2511297527 192
17 iso_pu_bacteria 2511231012 2511300363 192
18 iso_pu_bacteria 2511231014 2511314135 192
19 iso_pu_bacteria 2511231015 2511318926 192
20 iso_pu_bacteria 2511231017 2511335364 192
21 iso_pu_bacteria 2511231018 2511339668 192
22 iso_pu_bacteria 2511231019 2511347631 192
23 iso_pu_bacteria 2511231020 2511348629 192
24 iso_pu_bacteria 2511231023 2511371475 192
25 iso_pu_bacteria 2511231031 2511410683 192
26 iso_pu_bacteria 2511231156 2511826148 192
27 iso_pu_bacteria 2599185160 2599357139 192
28 iso_pu_bacteria 2599185161 2599362074 192
29 iso_pu_bacteria 2599185162 2599368394 192
30 iso_pu_bacteria 2599185163 2599375183 192
31 iso_pu_bacteria 2599185164 2599382244 192
32 iso_pu_bacteria 2599185165 2599388691 192
33 iso_pu_bacteria 2599185166 2599394041 192
34 iso_pu_bacteria 2599185168 2599405806 192
35 iso_pu_bacteria 2599185181 2599464360 192
36 iso_pu_bacteria 2599185182 2599468680 192
37 iso_pu_bacteria 2599185186 2599493379 192
38 iso_pu_bacteria 2599185188 2599504302 192
39 iso_pu_bacteria 2599185212 2599613592 192
40 iso_pu_bacteria 2599185248 2599772508 192
41 iso_pu_bacteria 2599185289 2599888770 192
42 iso_pu_bacteria 2599185291 2599900400 192
43 iso_pu_bacteria 2599185300 2599933437 192
44 iso_pu_bacteria 2599185302 2599944110 192
45 iso_pu_bacteria 2599185304 2599956328 192
46 iso_pu_bacteria 2599185305 2599961295 192
47 iso_pu_bacteria 2599185306 2599968420 192
48 iso_pu_bacteria 2599185308 2599979719 192
49 iso_pu_bacteria 2599185309 2599985022 192
50 iso_pu_bacteria 2599185310 2599989352 192
51 iso_pu_bacteria 2599185311 2599994265 192
52 iso_pu_bacteria 2599185312 2600000252 192
53 iso_pu_bacteria 2599185313 2600008748 192
54 iso_pu_bacteria 2599185314 2600013514 192
55 iso_pu_bacteria 2599185315 2600020997 192
56 iso_pu_bacteria 2599185316 2600023560 192
57 iso_pu_bacteria 2599185317 2600030638 192
58 iso_pu_bacteria 2599185318 2600036995 192
59 iso_pu_bacteria 2599185319 2600042418 192
60 iso_pu_bacteria 2599185320 2600049586 192
61 iso_pu_bacteria 2599185321 2600055935 192
62 iso_pu_bacteria 2599185322 2600060481 192
63 iso_pu_bacteria 2599185323 2600065580 192
64 iso_pu_bacteria 2599185324 2600070739 192
65 iso_pu_bacteria 2599185325 2600078264 192
66 iso_pu_bacteria 2599185356 2600216637 192
67 iso_pu_bacteria 2600254930 2600360445 192
68 iso_pu_bacteria 2600255313 2601776770 192
69 iso_pu_bacteria 2600255318 2601796423 192
70 iso_pu_bacteria 2603880185 2606073573 192
71 iso_pu_bacteria 2603880199 2606126783 192
72 iso_pu_bacteria 2623620443 2624482071 192
73 iso_pu_bacteria 2643221589 2643956637 192
74 iso_pu_bacteria 2643221602 2644025320 192
75 iso_pu_bacteria 2643221650 2644286216 192
76 iso_pu_bacteria 2651869719 2652544386 192
77 iso_pu_bacteria 2667528170 2671093060 192
78 iso_pu_bacteria 2667528171 2671098713 192
79 iso_pu_bacteria 2667528176 2671129057 192
80 iso_pu_bacteria 2675903515 2678264485 192
81 iso_pu_bacteria 2713897148 2715751381 192
82 iso_pu_bacteria 2713897149 2715758372 192
83 iso_pu_bacteria 2718217725 2718635313 192
84 iso_pu_bacteria 2738543004 2739197022 192
85 iso_pu_bacteria 2738543015 2739259095 192
86 iso_pu_bacteria 2738543025 2739315108 192
87 iso_pu_bacteria 2744054620 2745004939 192
88 iso_pu_bacteria 2773857673 2774133009 192
89 iso_pu_bacteria 2784132063 2784263163 192
90 iso_pu_bacteria 2791355520 2794595926 192
91 iso_pu_bacteria 2808606361 2808856942 192
92 iso_pu_bacteria 2808606376 2808924223 192
93 iso_pu_bacteria 2808606377 2808929867 192
94 iso_pu_bacteria 2808606378 2808937014 192
95 iso_pu_bacteria 2808606380 2808946392 192
96 iso_pu_bacteria 2808606381 2808952058 192
97 iso_pu_bacteria 2808606382 2808957187 192
98 iso_pu_bacteria 2808606383 2808965290 192
99 iso_pu_bacteria 2808606389 2809000222 192
100 iso_pu_bacteria 2818991456 2819655809 192
101 iso_pu_bacteria 2818991464 2819703834 192
102 iso_pu_bacteria 2825651385 2825656572 192
103 iso_pu_bacteria 2842832357 2842836673 192
104 iso_pu_bacteria 2842843487 2842844789 192
105 iso_pu_bacteria 2842854478 2842856948 192
106 iso_pu_bacteria 2852657418 2852661369 192
107 iso_pu_bacteria 2860339153 2860340974 192
108 iso_pu_bacteria 2878029506 2878034052 192
109 iso_pu_bacteria 2880230671 2880234677 192
110 iso_pu_bacteria 2904518522 2904521189 192
111 iso_pu_bacteria 2904550169 2904554917 192
112 iso_pu_bacteria 2913036834 2913040963 192
113 iso_pu_bacteria 2917070673 2917072540 192
114 iso_pu_bacteria 2919063839 2919069326 192
115 iso_pu_bacteria 2919385768 2919388152 192
116 iso_pu_bacteria 2919481497 2919486280 192
117 iso_pu_bacteria 2919487758 2919489661 192
118 iso_pu_bacteria 2923586266 2923589999 192
119 iso_pu_bacteria 2929144301 2929148463 192
120 iso_pu_bacteria 2931369376 2931374123 192
121 iso_pu_bacteria 2931396565 2931396715 192
122 iso_pu_bacteria 2935353572 2935354704 192
123 iso_pu_bacteria 2969304461 2969308832 192
124 iso_pu_bacteria 2974289157 2974289791 192
125 iso_pu_bacteria 2988728565 2988730065 192
126 iso_pu_bacteria 2998139840 2998144135 192
127 iso_pu_bacteria 3007511990 3007515888 192
128 iso_pu_bacteria 3007614139 3007619629 192
129 iso_pu_bacteria 3007619802 3007619968 192
130 iso_pu_bacteria 3007718800 3007719060 192
131 iso_pu_bacteria 3007855910 3007858882 192
132 iso_pu_bacteria 3007861166 3007865565 192
133 iso_pu_bacteria 3007866637 3007868101 192
134 iso_pu_bacteria 8029995093 8029996746 192
135 iso_pu_bacteria 8055817908 8055822717 192
136 iso_pu_bacteria 8056125926 8056130406 192
137 iso_pu_bacteria 8056143049 8056144908 192
138 iso_pu_bacteria 8056155041 8056155187 192
139 iso_pu_bacteria 8056166840 8056167149 192
140 iso_pu_bacteria 8056172158 8056173118 192
141 iso_pu_bacteria 8056177738 8056180134 192
142 iso_pu_bacteria 8056569372 8056572873 192
143 3300017792 Ga0163161_10053456 Ga0163161_100534563 193
144 3300046507 Ga0495606_0030806 Ga0495606_0030806_1448_2032 193
145 3300046512 Ga0495610_0084337 Ga0495610_0084337_467_1057 194
146 3300046520 Ga0495637_0017351 Ga0495637_0017351_1592_2179 194
147 3300046530 Ga0495654_0014087 Ga0495654_0014087_1603_2199 194
148 3300046530 Ga0495654_0231801 Ga0495654_0231801_37_633 194
149 3300046694 Ga0495649_0176408 Ga0495649_0176408_302_898 194
150 3300009092 Ga0105250_10029353 Ga0105250_100293532 195
151 3300013306 Ga0163162_10517259 Ga0163162_105172592 195
152 3300014497 Ga0182008_10006521 Ga0182008_100065215 195
153 3300025735 Ga0207713_1017429 Ga0207713_10174292 195
154 3300031548 Ga0307408_100031842 Ga0307408_1000318423 195
155 3300046458 Ga0495591_003922 Ga0495591_003922_4925_5512 195
156 3300046501 Ga0495607_0028997 Ga0495607_0028997_2128_2715 195
157 3300046512 Ga0495610_0018644 Ga0495610_0018644_2829_3416 195
158 3300046515 Ga0495620_0009845 Ga0495620_0009845_2605_3192 195
159 3300046519 Ga0495632_0010136 Ga0495632_0010136_3091_3684 195
160 3300046519 Ga0495632_0170203 Ga0495632_0170203_110_697 195
161 3300046520 Ga0495637_0002966 Ga0495637_0002966_2108_2701 195
162 3300046530 Ga0495654_0069077 Ga0495654_0069077_884_1471 195
163 3300046665 Ga0495661_0000961 Ga0495661_0000961_2147_2734 195
164 3300046794 Ga0495589_0003991 Ga0495589_0003991_1287_1880 195
165 3300046794 Ga0495589_0004701 Ga0495589_0004701_1865_2452 195
166 3300047446 Ga0495679_005332 Ga0495679_005332_3161_3748 195
167 3300047470 Ga0495681_0014155 Ga0495681_0014155_1586_2173 195
168 3300048920 Ga0496117_0002468 Ga0496117_0002468_20815_21402 195
169 3300048922 Ga0496119_0016236 Ga0496119_0016236_1801_2388 195
170 3300048923 Ga0496120_0003681 Ga0496120_0003681_11469_12056 195
171 3300048926 Ga0496123_0054807 Ga0496123_0054807_511_1098 195
172 3300048927 Ga0496124_0014348 Ga0496124_0014348_5212_5799 195
173 3300048928 Ga0496125_0002601 Ga0496125_0002601_20663_21250 195
174 3300048929 Ga0496126_0096986 Ga0496126_0096986_947_1534 195
175 2162886007 SwRhRL2b_contig_1198867 SwRhRL2b_0137.00000440 196
176 3300002737 JGI25162J39368_1001215 JGI25162J39368_10012152 196
177 3300002771 JGI25163J39215_1000334 JGI25163J39215_10003342 196
178 3300002771 JGI25163J39215_1000510 JGI25163J39215_10005101 196
179 3300002772 JGI25164J39214_1000422 JGI25164J39214_100042223 196
180 3300002772 JGI25164J39214_1000624 JGI25164J39214_10006242 196
181 3300003214 JGI25165J46597_1000467 JGI25165J46597_100046742 196
182 3300003214 JGI25165J46597_1000801 JGI25165J46597_100080123 196
183 3300003781 Ga0055536_1001428 Ga0055536_100142812 196
184 3300003781 Ga0055536_1001512 Ga0055536_100151212 196
185 3300003791 Ga0055530_10000712 Ga0055530_1000071228 196
186 3300003791 Ga0055530_10000790 Ga0055530_1000079024 196
187 3300003792 Ga0055540_1000545 Ga0055540_100054526 196
188 3300003792 Ga0055540_1000547 Ga0055540_100054728 196
189 3300003794 Ga0055531_10000202 Ga0055531_1000020244 196
190 3300005288 Ga0065714_10002606 Ga0065714_100026062 196
191 3300005288 Ga0065714_10010824 Ga0065714_100108241 196
192 3300005288 Ga0065714_10073420 Ga0065714_100734203 196
193 3300005288 Ga0065714_10114270 Ga0065714_101142702 196
194 3300005289 Ga0065704_10072128 Ga0065704_100721282 196
195 3300005353 Ga0070669_100021449 Ga0070669_1000214492 196
196 3300005457 Ga0070662_100019035 Ga0070662_1000190353 196
197 3300006051 Ga0075364_10628273 Ga0075364_106282731 196
198 3300006051 Ga0075364_10679943 Ga0075364_106799432 196
199 3300006058 Ga0075432_10055269 Ga0075432_100552692 196
200 3300006058 Ga0075432_10073574 Ga0075432_100735742 196
201 3300006058 Ga0075432_10114182 Ga0075432_101141822 196
202 3300006058 Ga0075432_10219041 Ga0075432_102190412 196
203 3300006177 Ga0075362_10013137 Ga0075362_100131373 196
204 3300006914 Ga0075436_100117710 Ga0075436_1001177101 196
205 3300006946 Ga0079104_1000577 Ga0079104_100057736 196
206 3300006946 Ga0079104_1000596 Ga0079104_100059636 196
207 3300006948 Ga0099826_10035378 Ga0099826_100353782 196
208 3300009011 Ga0105251_10010573 Ga0105251_100105732 196
209 3300009011 Ga0105251_10034965 Ga0105251_100349653 196
210 3300009011 Ga0105251_10054667 Ga0105251_100546672 196
211 3300009011 Ga0105251_10184258 Ga0105251_101842582 196
212 3300009011 Ga0105251_10229160 Ga0105251_102291601 196
213 3300009036 Ga0105244_10003940 Ga0105244_100039402 196
214 3300009036 Ga0105244_10010942 Ga0105244_100109422 196
215 3300009036 Ga0105244_10035493 Ga0105244_100354932 196
216 3300009036 Ga0105244_10038006 Ga0105244_100380062 196
217 3300009036 Ga0105244_10142688 Ga0105244_101426881 196
218 3300009036 Ga0105244_10164868 Ga0105244_101648682 196
219 3300009036 Ga0105244_10170490 Ga0105244_101704901 196
220 3300009092 Ga0105250_10003123 Ga0105250_100031232 196
221 3300009092 Ga0105250_10003645 Ga0105250_100036452 196
222 3300009092 Ga0105250_10008566 Ga0105250_100085662 196
223 3300009092 Ga0105250_10029412 Ga0105250_100294122 196
224 3300009148 Ga0105243_10000983 Ga0105243_1000098325 196
225 3300009148 Ga0105243_10074273 Ga0105243_100742732 196
226 3300009553 Ga0105249_10547347 Ga0105249_105473472 196
227 3300011119 Ga0105246_10003881 Ga0105246_100038812 196
228 3300012498 Ga0157345_1000063 Ga0157345_100006327 196
229 3300013100 Ga0157373_10003040 Ga0157373_100030402 196
230 3300013100 Ga0157373_10004515 Ga0157373_100045152 196
231 3300013100 Ga0157373_10014698 Ga0157373_100146982 196
232 3300013100 Ga0157373_10042511 Ga0157373_100425112 196
233 3300013100 Ga0157373_10058889 Ga0157373_100588892 196
234 3300013102 Ga0157371_10003249 Ga0157371_100032492 196
235 3300013102 Ga0157371_10003285 Ga0157371_100032852 196
236 3300013102 Ga0157371_10053789 Ga0157371_100537892 196
237 3300013104 Ga0157370_10031519 Ga0157370_100315193 196
238 3300013104 Ga0157370_10051033 Ga0157370_100510332 196
239 3300013104 Ga0157370_10250289 Ga0157370_102502892 196
240 3300013104 Ga0157370_10428922 Ga0157370_104289221 196
241 3300013105 Ga0157369_10012356 Ga0157369_100123562 196
242 3300013105 Ga0157369_10013095 Ga0157369_100130951 196
243 3300013105 Ga0157369_11174745 Ga0157369_111747451 196
244 3300013306 Ga0163162_10017601 Ga0163162_100176012 196
245 3300013306 Ga0163162_10020087 Ga0163162_100200872 196
246 3300013307 Ga0157372_10008391 Ga0157372_1000839111 196
247 3300013308 Ga0157375_10074697 Ga0157375_100746972 196
248 3300014497 Ga0182008_10003936 Ga0182008_100039362 196
249 3300014497 Ga0182008_10006263 Ga0182008_100062635 196
250 3300014497 Ga0182008_10033445 Ga0182008_100334452 196
251 3300014497 Ga0182008_10038003 Ga0182008_100380032 196
252 3300015261 Ga0182006_1002140 Ga0182006_10021402 196
253 3300015261 Ga0182006_1014728 Ga0182006_10147282 196
254 3300015261 Ga0182006_1016873 Ga0182006_10168732 196
255 3300015261 Ga0182006_1022301 Ga0182006_10223011 196
256 3300015261 Ga0182006_1042145 Ga0182006_10421452 196
257 3300015262 Ga0182007_10018350 Ga0182007_100183502 196
258 3300015265 Ga0182005_1013905 Ga0182005_10139053 196
259 3300015265 Ga0182005_1014295 Ga0182005_10142952 196
260 3300015265 Ga0182005_1015438 Ga0182005_10154383 196
261 3300017792 Ga0163161_10002255 Ga0163161_100022553 196
262 3300017792 Ga0163161_10004539 Ga0163161_1000453911 196
263 3300017792 Ga0163161_10256919 Ga0163161_102569192 196
264 3300017792 Ga0163161_10311403 Ga0163161_103114032 196
265 3300025207 Ga0209760_100233 Ga0209760_1002333 196
266 3300025207 Ga0209760_100269 Ga0209760_1002695 196
267 3300025230 Ga0209563_100668 Ga0209563_1006682 196
268 3300025231 Ga0207427_100001 Ga0207427_1000011028 196
269 3300025231 Ga0207427_100008 Ga0207427_100008410 196
270 3300025233 Ga0209437_100003 Ga0209437_100003344 196
271 3300025233 Ga0209437_100014 Ga0209437_100014301 196
272 3300025261 Ga0209233_1000007 Ga0209233_10000071028 196
273 3300025261 Ga0209233_1000008 Ga0209233_1000008301 196
274 3300025291 Ga0209675_1007244 Ga0209675_10072442 196
275 3300025292 Ga0209676_1000010 Ga0209676_1000010261 196
276 3300025292 Ga0209676_1000109 Ga0209676_10001092 196
277 3300025292 Ga0209676_1001671 Ga0209676_10016712 196
278 3300025292 Ga0209676_1005112 Ga0209676_10051125 196
279 3300025298 Ga0209050_1001085 Ga0209050_10010857 196
280 3300025298 Ga0209050_1001353 Ga0209050_100135324 196
281 3300025298 Ga0209050_1002606 Ga0209050_100260612 196
282 3300025303 Ga0209051_1000794 Ga0209051_100079428 196
283 3300025303 Ga0209051_1000828 Ga0209051_100082824 196
284 3300025303 Ga0209051_1006904 Ga0209051_10069047 196
285 3300025304 Ga0209257_1000040 Ga0209257_1000040264 196
286 3300025304 Ga0209257_1019348 Ga0209257_10193482 196
287 3300025711 Ga0207696_1000097 Ga0207696_10000975 196
288 3300025711 Ga0207696_1004318 Ga0207696_10043183 196
289 3300025711 Ga0207696_1005424 Ga0207696_10054243 196
290 3300025711 Ga0207696_1012576 Ga0207696_10125763 196
291 3300025711 Ga0207696_1096101 Ga0207696_10961011 196
292 3300025728 Ga0207655_1000467 Ga0207655_10004672 196
293 3300025728 Ga0207655_1002449 Ga0207655_10024492 196
294 3300025728 Ga0207655_1023490 Ga0207655_10234903 196
295 3300025728 Ga0207655_1029946 Ga0207655_10299463 196
296 3300025728 Ga0207655_1033277 Ga0207655_10332772 196
297 3300025728 Ga0207655_1043334 Ga0207655_10433342 196
298 3300025735 Ga0207713_1000898 Ga0207713_10008982 196
299 3300025735 Ga0207713_1010592 Ga0207713_10105923 196
300 3300025735 Ga0207713_1011049 Ga0207713_10110492 196
301 3300025735 Ga0207713_1022262 Ga0207713_10222621 196
302 3300025735 Ga0207713_1026437 Ga0207713_10264372 196
303 3300025735 Ga0207713_1031998 Ga0207713_10319982 196
304 3300025735 Ga0207713_1061945 Ga0207713_10619452 196
305 3300025735 Ga0207713_1075725 Ga0207713_10757252 196
306 3300025923 Ga0207681_10016435 Ga0207681_100164353 196
307 3300025935 Ga0207709_10000035 Ga0207709_10000035255 196
308 3300025935 Ga0207709_10000809 Ga0207709_1000080923 196
309 3300025961 Ga0207712_10707660 Ga0207712_107076602 196
310 3300027111 Ga0209281_1000642 Ga0209281_100064241 196
311 3300027111 Ga0209281_1000656 Ga0209281_100065636 196
312 3300027111 Ga0209281_1002134 Ga0209281_10021345 196
313 3300027111 Ga0209281_1014839 Ga0209281_10148392 196
314 3300027666 Ga0209282_1028507 Ga0209282_10285072 196
315 3300027907 Ga0207428_10012434 Ga0207428_100124342 196
316 3300027907 Ga0207428_10019065 Ga0207428_100190656 196
317 3300027907 Ga0207428_10020276 Ga0207428_100202762 196
318 3300027907 Ga0207428_10024709 Ga0207428_100247092 196
319 3300027907 Ga0207428_10048029 Ga0207428_100480293 196
320 3300028786 Ga0307517_10363871 Ga0307517_103638712 196
321 3300030735 Ga0316178_1006889 Ga0316178_100688912 196
322 3300031548 Ga0307408_100003150 Ga0307408_10000315011 196
323 3300031548 Ga0307408_100010035 Ga0307408_1000100354 196
324 3300031548 Ga0307408_100016854 Ga0307408_1000168541 196
325 3300031548 Ga0307408_100018960 Ga0307408_1000189602 196
326 3300031548 Ga0307408_100131867 Ga0307408_1001318672 196
327 3300031548 Ga0307408_101418514 Ga0307408_1014185141 196
328 3300031730 Ga0307516_10199105 Ga0307516_101991051 196
329 3300031731 Ga0307405_10001242 Ga0307405_1000124210 196
330 3300031731 Ga0307405_10003654 Ga0307405_100036542 196
331 3300031731 Ga0307405_10006850 Ga0307405_100068502 196
332 3300031731 Ga0307405_10768604 Ga0307405_107686041 196
333 3300031824 Ga0307413_10009520 Ga0307413_100095202 196
334 3300031824 Ga0307413_10710446 Ga0307413_107104462 196
335 3300031901 Ga0307406_10079193 Ga0307406_100791932 196
336 3300031903 Ga0307407_10023048 Ga0307407_100230482 196
337 3300031911 Ga0307412_10002449 Ga0307412_100024492 196
338 3300031911 Ga0307412_10004899 Ga0307412_100048992 196
339 3300031911 Ga0307412_10009595 Ga0307412_100095952 196
340 3300031911 Ga0307412_10022741 Ga0307412_100227413 196
341 3300031911 Ga0307412_10150101 Ga0307412_101501012 196
342 3300031911 Ga0307412_10462948 Ga0307412_104629482 196
343 3300031995 Ga0307409_100086827 Ga0307409_1000868271 196
344 3300032002 Ga0307416_100096402 Ga0307416_1000964022 196
345 3300032002 Ga0307416_100360660 Ga0307416_1003606602 196
346 3300032002 Ga0307416_100525626 Ga0307416_1005256262 196
347 3300032002 Ga0307416_101497604 Ga0307416_1014976041 196
348 3300032004 Ga0307414_10015886 Ga0307414_100158861 196
349 3300032004 Ga0307414_10043511 Ga0307414_100435112 196
350 3300032004 Ga0307414_10737946 Ga0307414_107379462 196
351 3300032004 Ga0307414_10782769 Ga0307414_107827692 196
352 3300032004 Ga0307414_11331782 Ga0307414_113317821 196
353 3300032005 Ga0307411_10006455 Ga0307411_100064552 196
354 3300032005 Ga0307411_10081861 Ga0307411_100818612 196
355 3300032005 Ga0307411_10289758 Ga0307411_102897582 196
356 3300033180 Ga0307510_10002605 Ga0307510_100026053 196
357 3300041405 Ga0439438_000134 Ga0439438_000134_30801_31391 196
358 3300041405 Ga0439438_001936 Ga0439438_001936_6371_6961 196
359 3300041405 Ga0439438_002229 Ga0439438_002229_5264_5860 196
360 3300041405 Ga0439438_003794 Ga0439438_003794_2119_2736 196
361 3300041405 Ga0439438_004024 Ga0439438_004024_3116_3706 196
362 3300041405 Ga0439438_004471 Ga0439438_004471_2063_2653 196
363 3300041405 Ga0439438_005336 Ga0439438_005336_3660_4256 196
364 3300041405 Ga0439438_009393 Ga0439438_009393_1071_1664 196
365 3300041405 Ga0439438_024183 Ga0439438_024183_588_1181 196
366 3300041407 Ga0439447_001541 Ga0439447_001541_5800_6390 196
367 3300041407 Ga0439447_004749 Ga0439447_004749_2698_3288 196
368 3300041407 Ga0439447_006222 Ga0439447_006222_2019_2612 196
369 3300041407 Ga0439447_008612 Ga0439447_008612_1861_2454 196
370 3300041407 Ga0439447_014159 Ga0439447_014159_777_1376 196
371 3300041407 Ga0439447_015594 Ga0439447_015594_59_649 196
372 3300041407 Ga0439447_023269 Ga0439447_023269_563_1159 196
373 3300041411 Ga0439466_0001287 Ga0439466_0001287_8065_8658 196
374 3300041411 Ga0439466_0008637 Ga0439466_0008637_59_649 196
375 3300041411 Ga0439466_0010753 Ga0439466_0010753_2004_2597 196
376 3300041411 Ga0439466_0018456 Ga0439466_0018456_506_1102 196
377 3300041411 Ga0439466_0029055 Ga0439466_0029055_62_652 196
378 3300041411 Ga0439466_0108418 Ga0439466_0108418_86_682 196
379 3300041997 Ga0439431_0005237 Ga0439431_0005237_178_768 196
380 3300042002 Ga0439442_072800 Ga0439442_072800_77_673 196
381 3300042004 Ga0439445_0034698 Ga0439445_0034698_287_880 196
382 3300042004 Ga0439445_0053516 Ga0439445_0053516_72_662 196
383 3300042004 Ga0439445_0063011 Ga0439445_0063011_355_945 196
384 3300042006 Ga0439432_004839 Ga0439432_004839_1790_2389 196
385 3300042006 Ga0439432_005060 Ga0439432_005060_2091_2681 196
386 3300042006 Ga0439432_009358 Ga0439432_009358_2302_2898 196
387 3300042006 Ga0439432_010078 Ga0439432_010078_2107_2697 196
388 3300042006 Ga0439432_068330 Ga0439432_068330_63_656 196
389 3300042009 Ga0439451_006794 Ga0439451_006794_1114_1710 196
390 3300042009 Ga0439451_009714 Ga0439451_009714_1106_1696 196
391 3300042009 Ga0439451_080653 Ga0439451_080653_40_633 196
392 3300042010 Ga0439452_001153 Ga0439452_001153_2469_3065 196
393 3300042010 Ga0439452_001988 Ga0439452_001988_1846_2442 196
394 3300042010 Ga0439452_002515 Ga0439452_002515_5662_6255 196
395 3300042010 Ga0439452_006284 Ga0439452_006284_2262_2852 196
396 3300042010 Ga0439452_007932 Ga0439452_007932_2130_2720 196
397 3300042010 Ga0439452_008153 Ga0439452_008153_1691_2281 196
398 3300042010 Ga0439452_025277 Ga0439452_025277_724_1317 196
399 3300042013 Ga0439456_003007 Ga0439456_003007_1483_2079 196
400 3300042013 Ga0439456_011179 Ga0439456_011179_1117_1707 196
401 3300042013 Ga0439456_047396 Ga0439456_047396_307_897 196
402 3300042013 Ga0439456_064693 Ga0439456_064693_154_744 196
403 3300042016 Ga0439463_004151 Ga0439463_004151_175_774 196
404 3300042016 Ga0439463_023724 Ga0439463_023724_780_1370 196
405 3300042016 Ga0439463_036066 Ga0439463_036066_22_612 196
406 3300042016 Ga0439463_037454 Ga0439463_037454_277_873 196
407 3300042115 Ga0450911_000276 Ga0450911_000276_2354_2950 196
408 3300042115 Ga0450911_001087 Ga0450911_001087_831_1421 196
409 3300042115 Ga0450911_022571 Ga0450911_022571_147_740 196
410 3300042124 Ga0450922_001487 Ga0450922_001487_782_1375 196
411 3300042125 Ga0450923_041368 Ga0450923_041368_279_872 196
412 3300042137 Ga0450902_002023 Ga0450902_002023_585_1175 196
413 3300042137 Ga0450902_022161 Ga0450902_022161_72_662 196
414 3300042138 Ga0450903_004344 Ga0450903_004344_1177_1773 196
415 3300042139 Ga0450904_002176 Ga0450904_002176_44_640 196
416 3300042139 Ga0450904_014493 Ga0450904_014493_45_641 196
417 3300042142 Ga0450905_002369 Ga0450905_002369_879_1469 196
418 3300042145 Ga0450906_002614 Ga0450906_002614_2000_2596 196
419 3300042146 Ga0450907_000070 Ga0450907_000070_2227_2820 196
420 3300042146 Ga0450907_005728 Ga0450907_005728_48_644 196
421 3300042147 Ga0450910_007357 Ga0450910_007357_88_678 196
422 3300042156 Ga0439446_0062347 Ga0439446_0062347_122_712 196
423 3300042185 Ga0450909_003463 Ga0450909_003463_787_1380 196
424 3300042185 Ga0450909_005486 Ga0450909_005486_675_1265 196
425 3300042435 Ga0439434_0002019 Ga0439434_0002019_3303_3896 196
426 3300042461 Ga0439460_0003275 Ga0439460_0003275_1977_2573 196
427 3300042461 Ga0439460_0007345 Ga0439460_0007345_129_719 196
428 3300042531 Ga0450918_027380 Ga0450918_027380_352_948 196
429 3300042533 Ga0450901_001816 Ga0450901_001816_497_1087 196
430 3300042993 Ga0439440_0003403 Ga0439440_0003403_1379_1972 196
431 3300046452 Ga0495617_001389 Ga0495617_001389_8014_8610 196
432 3300046452 Ga0495617_006607 Ga0495617_006607_1839_2432 196
433 3300046452 Ga0495617_007721 Ga0495617_007721_2093_2689 196
434 3300046452 Ga0495617_010498 Ga0495617_010498_1189_1785 196
435 3300046452 Ga0495617_011059 Ga0495617_011059_1474_2064 196
436 3300046452 Ga0495617_016398 Ga0495617_016398_1091_1687 196
437 3300046452 Ga0495617_027973 Ga0495617_027973_1045_1641 196
438 3300046452 Ga0495617_034017 Ga0495617_034017_49_645 196
439 3300046453 Ga0495627_001762 Ga0495627_001762_2441_3037 196
440 3300046453 Ga0495627_007768 Ga0495627_007768_1260_1856 196
441 3300046453 Ga0495627_007769 Ga0495627_007769_250_846 196
442 3300046453 Ga0495627_011176 Ga0495627_011176_1569_2159 196
443 3300046453 Ga0495627_062594 Ga0495627_062594_132_722 196
444 3300046453 Ga0495627_065406 Ga0495627_065406_343_933 196
445 3300046453 Ga0495627_081934 Ga0495627_081934_144_740 196
446 3300046455 Ga0495603_0073966 Ga0495603_0073966_850_1446 196
447 3300046455 Ga0495603_0084244 Ga0495603_0084244_351_947 196
448 3300046457 Ga0495590_0014434 Ga0495590_0014434_2035_2631 196
449 3300046457 Ga0495590_0031394 Ga0495590_0031394_71_667 196
450 3300046457 Ga0495590_0093889 Ga0495590_0093889_304_894 196
451 3300046458 Ga0495591_000783 Ga0495591_000783_2000_2590 196
452 3300046458 Ga0495591_001989 Ga0495591_001989_261_857 196
453 3300046458 Ga0495591_002231 Ga0495591_002231_8010_8606 196
454 3300046458 Ga0495591_003066 Ga0495591_003066_5972_6568 196
455 3300046458 Ga0495591_005192 Ga0495591_005192_1805_2401 196
456 3300046458 Ga0495591_010157 Ga0495591_010157_1689_2285 196
457 3300046458 Ga0495591_011841 Ga0495591_011841_1670_2260 196
458 3300046458 Ga0495591_029375 Ga0495591_029375_1058_1654 196
459 3300046458 Ga0495591_075219 Ga0495591_075219_184_780 196
460 3300046460 Ga0495638_0007217 Ga0495638_0007217_2041_2637 196
461 3300046460 Ga0495638_0021482 Ga0495638_0021482_1857_2447 196
462 3300046460 Ga0495638_0025716 Ga0495638_0025716_1745_2335 196
463 3300046460 Ga0495638_0034644 Ga0495638_0034644_1496_2086 196
464 3300046460 Ga0495638_0040414 Ga0495638_0040414_1125_1721 196
465 3300046460 Ga0495638_0083447 Ga0495638_0083447_208_798 196
466 3300046460 Ga0495638_0086581 Ga0495638_0086581_692_1288 196
467 3300046460 Ga0495638_0102542 Ga0495638_0102542_161_751 196
468 3300046460 Ga0495638_0102566 Ga0495638_0102566_301_891 196
469 3300046463 Ga0495653_0005408 Ga0495653_0005408_2211_2807 196
470 3300046463 Ga0495653_0086942 Ga0495653_0086942_408_1004 196
471 3300046463 Ga0495653_0123829 Ga0495653_0123829_136_726 196
472 3300046471 Ga0495650_0011247 Ga0495650_0011247_2875_3471 196
473 3300046471 Ga0495650_0012205 Ga0495650_0012205_2047_2637 196
474 3300046471 Ga0495650_0016481 Ga0495650_0016481_1163_1753 196
475 3300046474 Ga0495605_0000067 Ga0495605_0000067_134910_135506 196
476 3300046474 Ga0495605_0018139 Ga0495605_0018139_2038_2634 196
477 3300046474 Ga0495605_0018524 Ga0495605_0018524_1219_1809 196
478 3300046474 Ga0495605_0041837 Ga0495605_0041837_616_1206 196
479 3300046474 Ga0495605_0061761 Ga0495605_0061761_88_684 196
480 3300046474 Ga0495605_0274780 Ga0495605_0274780_36_626 196
481 3300046475 Ga0495639_0011468 Ga0495639_0011468_1228_1824 196
482 3300046491 Ga0495584_0002080 Ga0495584_0002080_8888_9484 196
483 3300046491 Ga0495584_0005386 Ga0495584_0005386_4221_4817 196
484 3300046491 Ga0495584_0014653 Ga0495584_0014653_1401_1997 196
485 3300046491 Ga0495584_0015276 Ga0495584_0015276_1063_1653 196
486 3300046491 Ga0495584_0015483 Ga0495584_0015483_1171_1767 196
487 3300046491 Ga0495584_0025131 Ga0495584_0025131_1202_1798 196
488 3300046491 Ga0495584_0069661 Ga0495584_0069661_46_642 196
489 3300046491 Ga0495584_0134990 Ga0495584_0134990_216_806 196
490 3300046491 Ga0495584_0152684 Ga0495584_0152684_511_1101 196
491 3300046492 Ga0495585_0002404 Ga0495585_0002404_1756_2346 196
492 3300046492 Ga0495585_0007012 Ga0495585_0007012_2156_2752 196
493 3300046492 Ga0495585_0007831 Ga0495585_0007831_1966_2556 196
494 3300046492 Ga0495585_0009606 Ga0495585_0009606_2027_2623 196
495 3300046492 Ga0495585_0033923 Ga0495585_0033923_987_1577 196
496 3300046492 Ga0495585_0081130 Ga0495585_0081130_1084_1680 196
497 3300046492 Ga0495585_0214037 Ga0495585_0214037_293_889 196
498 3300046499 Ga0495594_0039102 Ga0495594_0039102_56_652 196
499 3300046499 Ga0495594_0421049 Ga0495594_0421049_99_695 196
500 3300046500 Ga0495596_0000463 Ga0495596_0000463_23212_23802 196
501 3300046500 Ga0495596_0017047 Ga0495596_0017047_2238_2834 196
502 3300046501 Ga0495607_0004027 Ga0495607_0004027_2251_2841 196
503 3300046501 Ga0495607_0024230 Ga0495607_0024230_1063_1659 196
504 3300046501 Ga0495607_0027116 Ga0495607_0027116_1150_1746 196
505 3300046501 Ga0495607_0041062 Ga0495607_0041062_1744_2340 196
506 3300046501 Ga0495607_0043394 Ga0495607_0043394_1101_1697 196
507 3300046501 Ga0495607_0045359 Ga0495607_0045359_1078_1674 196
508 3300046501 Ga0495607_0062368 Ga0495607_0062368_1413_2009 196
509 3300046501 Ga0495607_0079945 Ga0495607_0079945_1074_1664 196
510 3300046501 Ga0495607_0101020 Ga0495607_0101020_35_628 196
511 3300046501 Ga0495607_0110069 Ga0495607_0110069_179_775 196
512 3300046501 Ga0495607_0112898 Ga0495607_0112898_281_877 196
513 3300046501 Ga0495607_0142098 Ga0495607_0142098_354_944 196
514 3300046501 Ga0495607_0148777 Ga0495607_0148777_179_775 196
515 3300046501 Ga0495607_0236018 Ga0495607_0236018_53_649 196
516 3300046501 Ga0495607_0263513 Ga0495607_0263513_172_768 196
517 3300046506 Ga0495583_0003623 Ga0495583_0003623_3145_3741 196
518 3300046506 Ga0495583_0008749 Ga0495583_0008749_2390_2986 196
519 3300046506 Ga0495583_0216297 Ga0495583_0216297_38_628 196
520 3300046507 Ga0495606_0002735 Ga0495606_0002735_2010_2606 196
521 3300046507 Ga0495606_0006284 Ga0495606_0006284_2211_2807 196
522 3300046507 Ga0495606_0007433 Ga0495606_0007433_2036_2626 196
523 3300046507 Ga0495606_0008770 Ga0495606_0008770_6036_6632 196
524 3300046507 Ga0495606_0029685 Ga0495606_0029685_1200_1796 196
525 3300046507 Ga0495606_0059181 Ga0495606_0059181_1320_1910 196
526 3300046507 Ga0495606_0068218 Ga0495606_0068218_221_817 196
527 3300046507 Ga0495606_0092233 Ga0495606_0092233_285_881 196
528 3300046507 Ga0495606_0160949 Ga0495606_0160949_447_1040 196
529 3300046507 Ga0495606_0429932 Ga0495606_0429932_16_606 196
530 3300046512 Ga0495610_0005212 Ga0495610_0005212_6607_7197 196
531 3300046512 Ga0495610_0006143 Ga0495610_0006143_5823_6419 196
532 3300046512 Ga0495610_0006684 Ga0495610_0006684_4830_5426 196
533 3300046512 Ga0495610_0014014 Ga0495610_0014014_2806_3396 196
534 3300046512 Ga0495610_0015454 Ga0495610_0015454_3783_4373 196
535 3300046512 Ga0495610_0036552 Ga0495610_0036552_162_752 196
536 3300046512 Ga0495610_0039135 Ga0495610_0039135_261_851 196
537 3300046512 Ga0495610_0043954 Ga0495610_0043954_1530_2126 196
538 3300046512 Ga0495610_0190929 Ga0495610_0190929_20_616 196
539 3300046513 Ga0495616_0004347 Ga0495616_0004347_6263_6859 196
540 3300046513 Ga0495616_0014363 Ga0495616_0014363_1571_2167 196
541 3300046513 Ga0495616_0017219 Ga0495616_0017219_1207_1797 196
542 3300046513 Ga0495616_0025181 Ga0495616_0025181_1147_1743 196
543 3300046513 Ga0495616_0080271 Ga0495616_0080271_145_741 196
544 3300046515 Ga0495620_0002178 Ga0495620_0002178_8368_8964 196
545 3300046515 Ga0495620_0005936 Ga0495620_0005936_519_1115 196
546 3300046515 Ga0495620_0008992 Ga0495620_0008992_986_1582 196
547 3300046515 Ga0495620_0017613 Ga0495620_0017613_1805_2401 196
548 3300046515 Ga0495620_0024483 Ga0495620_0024483_1291_1887 196
549 3300046515 Ga0495620_0030256 Ga0495620_0030256_919_1515 196
550 3300046515 Ga0495620_0075485 Ga0495620_0075485_726_1322 196
551 3300046515 Ga0495620_0082798 Ga0495620_0082798_71_661 196
552 3300046517 Ga0495630_0029370 Ga0495630_0029370_1255_1845 196
553 3300046517 Ga0495630_0133274 Ga0495630_0133274_54_644 196
554 3300046518 Ga0495631_0000587 Ga0495631_0000587_21627_22223 196
555 3300046518 Ga0495631_0017328 Ga0495631_0017328_1835_2431 196
556 3300046518 Ga0495631_0021437 Ga0495631_0021437_633_1223 196
557 3300046518 Ga0495631_0082565 Ga0495631_0082565_649_1245 196
558 3300046519 Ga0495632_0005283 Ga0495632_0005283_5631_6227 196
559 3300046519 Ga0495632_0005710 Ga0495632_0005710_5564_6160 196
560 3300046519 Ga0495632_0021724 Ga0495632_0021724_1998_2588 196
561 3300046519 Ga0495632_0052094 Ga0495632_0052094_1107_1703 196
562 3300046519 Ga0495632_0052667 Ga0495632_0052667_1264_1854 196
563 3300046519 Ga0495632_0061323 Ga0495632_0061323_1217_1813 196
564 3300046519 Ga0495632_0062849 Ga0495632_0062849_1131_1721 196
565 3300046520 Ga0495637_0000812 Ga0495637_0000812_2351_2947 196
566 3300046520 Ga0495637_0001172 Ga0495637_0001172_2001_2591 196
567 3300046520 Ga0495637_0003937 Ga0495637_0003937_5271_5861 196
568 3300046520 Ga0495637_0012911 Ga0495637_0012911_2247_2843 196
569 3300046520 Ga0495637_0016793 Ga0495637_0016793_1085_1675 196
570 3300046520 Ga0495637_0020598 Ga0495637_0020598_1213_1809 196
571 3300046520 Ga0495637_0032602 Ga0495637_0032602_1653_2249 196
572 3300046520 Ga0495637_0035550 Ga0495637_0035550_1495_2085 196
573 3300046520 Ga0495637_0041590 Ga0495637_0041590_1324_1920 196
574 3300046520 Ga0495637_0048064 Ga0495637_0048064_72_668 196
575 3300046522 Ga0495643_0027866 Ga0495643_0027866_1273_1869 196
576 3300046522 Ga0495643_0029422 Ga0495643_0029422_1252_1848 196
577 3300046522 Ga0495643_0059194 Ga0495643_0059194_1368_1964 196
578 3300046522 Ga0495643_0068686 Ga0495643_0068686_1091_1681 196
579 3300046522 Ga0495643_0107258 Ga0495643_0107258_710_1306 196
580 3300046523 Ga0495644_0001895 Ga0495644_0001895_1474_2064 196
581 3300046523 Ga0495644_0017241 Ga0495644_0017241_921_1517 196
582 3300046524 Ga0495648_0004655 Ga0495648_0004655_2363_2959 196
583 3300046524 Ga0495648_0004781 Ga0495648_0004781_8508_9104 196
584 3300046524 Ga0495648_0008808 Ga0495648_0008808_2026_2622 196
585 3300046524 Ga0495648_0022143 Ga0495648_0022143_1976_2572 196
586 3300046524 Ga0495648_0038340 Ga0495648_0038340_986_1576 196
587 3300046524 Ga0495648_0051341 Ga0495648_0051341_1132_1728 196
588 3300046526 Ga0495666_0002706 Ga0495666_0002706_2071_2661 196
589 3300046530 Ga0495654_0002978 Ga0495654_0002978_7895_8491 196
590 3300046530 Ga0495654_0013895 Ga0495654_0013895_54_650 196
591 3300046530 Ga0495654_0015885 Ga0495654_0015885_1859_2455 196
592 3300046530 Ga0495654_0016511 Ga0495654_0016511_1465_2061 196
593 3300046530 Ga0495654_0023920 Ga0495654_0023920_597_1193 196
594 3300046530 Ga0495654_0029839 Ga0495654_0029839_1025_1618 196
595 3300046530 Ga0495654_0070935 Ga0495654_0070935_1018_1608 196
596 3300046530 Ga0495654_0076736 Ga0495654_0076736_751_1347 196
597 3300046530 Ga0495654_0095015 Ga0495654_0095015_725_1321 196
598 3300046530 Ga0495654_0121563 Ga0495654_0121563_144_740 196
599 3300046530 Ga0495654_0124589 Ga0495654_0124589_237_827 196
600 3300046530 Ga0495654_0136095 Ga0495654_0136095_357_947 196
601 3300046530 Ga0495654_0222891 Ga0495654_0222891_38_628 196
602 3300046536 Ga0495587_0072607 Ga0495587_0072607_383_979 196
603 3300046538 Ga0495609_0000118 Ga0495609_0000118_3038_3634 196
604 3300046538 Ga0495609_0003397 Ga0495609_0003397_2330_2926 196
605 3300046538 Ga0495609_0012192 Ga0495609_0012192_1254_1850 196
606 3300046538 Ga0495609_0013890 Ga0495609_0013890_1170_1766 196
607 3300046538 Ga0495609_0015691 Ga0495609_0015691_1838_2434 196
608 3300046538 Ga0495609_0020978 Ga0495609_0020978_2334_2933 196
609 3300046538 Ga0495609_0029209 Ga0495609_0029209_690_1280 196
610 3300046538 Ga0495609_0142440 Ga0495609_0142440_146_739 196
611 3300046538 Ga0495609_0161473 Ga0495609_0161473_151_747 196
612 3300046542 Ga0495597_0002230 Ga0495597_0002230_261_857 196
613 3300046542 Ga0495597_0012942 Ga0495597_0012942_1336_1926 196
614 3300046542 Ga0495597_0046022 Ga0495597_0046022_107_703 196
615 3300046542 Ga0495597_0083954 Ga0495597_0083954_208_804 196
616 3300046542 Ga0495597_0109710 Ga0495597_0109710_169_759 196
617 3300046557 Ga0495622_0000595 Ga0495622_0000595_18184_18780 196
618 3300046557 Ga0495622_0008649 Ga0495622_0008649_1941_2537 196
619 3300046557 Ga0495622_0061470 Ga0495622_0061470_22_612 196
620 3300046558 Ga0495633_0007296 Ga0495633_0007296_3765_4361 196
621 3300046558 Ga0495633_0034267 Ga0495633_0034267_901_1497 196
622 3300046615 Ga0495656_0446805 Ga0495656_0446805_36_632 196
623 3300046616 Ga0495668_0016952 Ga0495668_0016952_1605_2195 196
624 3300046616 Ga0495668_0021642 Ga0495668_0021642_1821_2417 196
625 3300046616 Ga0495668_0027290 Ga0495668_0027290_677_1267 196
626 3300046616 Ga0495668_0073538 Ga0495668_0073538_315_911 196
627 3300046642 Ga0495634_0067914 Ga0495634_0067914_822_1418 196
628 3300046648 Ga0495611_0000447 Ga0495611_0000447_2421_3017 196
629 3300046648 Ga0495611_0042343 Ga0495611_0042343_1414_2004 196
630 3300046660 Ga0495625_0004966 Ga0495625_0004966_1429_2025 196
631 3300046660 Ga0495625_0009216 Ga0495625_0009216_2371_2967 196
632 3300046660 Ga0495625_0011012 Ga0495625_0011012_1402_1998 196
633 3300046660 Ga0495625_0018359 Ga0495625_0018359_3479_4075 196
634 3300046660 Ga0495625_0095195 Ga0495625_0095195_859_1455 196
635 3300046660 Ga0495625_0138222 Ga0495625_0138222_534_1130 196
636 3300046660 Ga0495625_0142192 Ga0495625_0142192_761_1351 196
637 3300046660 Ga0495625_0362358 Ga0495625_0362358_51_641 196
638 3300046665 Ga0495661_0012872 Ga0495661_0012872_4662_5258 196
639 3300046665 Ga0495661_0017544 Ga0495661_0017544_2974_3570 196
640 3300046665 Ga0495661_0090473 Ga0495661_0090473_26_622 196
641 3300046665 Ga0495661_0137627 Ga0495661_0137627_97_693 196
642 3300046675 Ga0495657_0269406 Ga0495657_0269406_370_960 196
643 3300046679 Ga0495623_0019229 Ga0495623_0019229_2191_2781 196
644 3300046680 Ga0495646_0034741 Ga0495646_0034741_558_1154 196
645 3300046689 Ga0495613_0053059 Ga0495613_0053059_236_832 196
646 3300046689 Ga0495613_0097437 Ga0495613_0097437_974_1570 196
647 3300046690 Ga0495624_0003821 Ga0495624_0003821_2157_2753 196
648 3300046691 Ga0495670_0000847 Ga0495670_0000847_2058_2654 196
649 3300046691 Ga0495670_0002894 Ga0495670_0002894_5521_6117 196
650 3300046691 Ga0495670_0013552 Ga0495670_0013552_1681_2277 196
651 3300046691 Ga0495670_0019834 Ga0495670_0019834_1896_2492 196
652 3300046691 Ga0495670_0372801 Ga0495670_0372801_132_722 196
653 3300046691 Ga0495670_0428580 Ga0495670_0428580_71_667 196
654 3300046692 Ga0495671_0004644 Ga0495671_0004644_5534_6130 196
655 3300046692 Ga0495671_0007245 Ga0495671_0007245_5276_5866 196
656 3300046692 Ga0495671_0008526 Ga0495671_0008526_4217_4813 196
657 3300046692 Ga0495671_0015592 Ga0495671_0015592_2091_2687 196
658 3300046692 Ga0495671_0017580 Ga0495671_0017580_1119_1715 196
659 3300046692 Ga0495671_0019270 Ga0495671_0019270_2051_2647 196
660 3300046692 Ga0495671_0025700 Ga0495671_0025700_1349_1945 196
661 3300046692 Ga0495671_0038051 Ga0495671_0038051_1610_2200 196
662 3300046692 Ga0495671_0050553 Ga0495671_0050553_1328_1924 196
663 3300046692 Ga0495671_0065844 Ga0495671_0065844_1123_1713 196
664 3300046694 Ga0495649_0010531 Ga0495649_0010531_2105_2701 196
665 3300046694 Ga0495649_0018975 Ga0495649_0018975_1973_2569 196
666 3300046694 Ga0495649_0022830 Ga0495649_0022830_88_684 196
667 3300046694 Ga0495649_0029411 Ga0495649_0029411_1284_1880 196
668 3300046694 Ga0495649_0060393 Ga0495649_0060393_282_872 196
669 3300046694 Ga0495649_0270572 Ga0495649_0270572_49_639 196
670 3300046694 Ga0495649_0304645 Ga0495649_0304645_46_636 196
671 3300046794 Ga0495589_0001285 Ga0495589_0001285_2032_2628 196
672 3300046794 Ga0495589_0002906 Ga0495589_0002906_2375_2971 196
673 3300046794 Ga0495589_0026119 Ga0495589_0026119_1207_1797 196
674 3300046794 Ga0495589_0050743 Ga0495589_0050743_181_771 196
675 3300046809 Ga0495600_0028154 Ga0495600_0028154_1115_1711 196
676 3300046810 Ga0495660_0010228 Ga0495660_0010228_3877_4473 196
677 3300046810 Ga0495660_0013944 Ga0495660_0013944_818_1414 196
678 3300046810 Ga0495660_0017049 Ga0495660_0017049_1328_1918 196
679 3300046810 Ga0495660_0028189 Ga0495660_0028189_1222_1818 196
680 3300046810 Ga0495660_0031427 Ga0495660_0031427_1278_1874 196
681 3300046810 Ga0495660_0033434 Ga0495660_0033434_1164_1760 196
682 3300046810 Ga0495660_0033444 Ga0495660_0033444_1021_1611 196
683 3300046810 Ga0495660_0036381 Ga0495660_0036381_1590_2186 196
684 3300046810 Ga0495660_0040903 Ga0495660_0040903_1862_2452 196
685 3300046810 Ga0495660_0054966 Ga0495660_0054966_525_1121 196
686 3300046810 Ga0495660_0094323 Ga0495660_0094323_868_1458 196
687 3300046810 Ga0495660_0096201 Ga0495660_0096201_542_1132 196
688 3300046810 Ga0495660_0147180 Ga0495660_0147180_494_1090 196
689 3300046810 Ga0495660_0200434 Ga0495660_0200434_72_668 196
690 3300047317 Ga0495604_0018610 Ga0495604_0018610_2923_3513 196
691 3300047320 Ga0495672_0003777 Ga0495672_0003777_11400_11993 196
692 3300047320 Ga0495672_0012129 Ga0495672_0012129_3423_4019 196
693 3300047320 Ga0495672_0012796 Ga0495672_0012796_142_738 196
694 3300047320 Ga0495672_0013052 Ga0495672_0013052_2142_2738 196
695 3300047320 Ga0495672_0016240 Ga0495672_0016240_1960_2556 196
696 3300047320 Ga0495672_0058604 Ga0495672_0058604_1479_2075 196
697 3300047320 Ga0495672_0083939 Ga0495672_0083939_763_1353 196
698 3300047321 Ga0495676_0033095 Ga0495676_0033095_196_792 196
699 3300047321 Ga0495676_0043419 Ga0495676_0043419_2023_2619 196
700 3300047322 Ga0495680_0070077 Ga0495680_0070077_1039_1629 196
701 3300047322 Ga0495680_0187066 Ga0495680_0187066_506_1096 196
702 3300047322 Ga0495680_0228535 Ga0495680_0228535_511_1101 196
703 3300047323 Ga0495683_0001535 Ga0495683_0001535_12341_12937 196
704 3300047323 Ga0495683_0021100 Ga0495683_0021100_1587_2177 196
705 3300047323 Ga0495683_0027188 Ga0495683_0027188_1074_1670 196
706 3300047323 Ga0495683_0034872 Ga0495683_0034872_1754_2350 196
707 3300047323 Ga0495683_0069673 Ga0495683_0069673_435_1025 196
708 3300047323 Ga0495683_0162075 Ga0495683_0162075_112_708 196
709 3300047443 Ga0495687_005063 Ga0495687_005063_2122_2718 196
710 3300047444 Ga0495675_0205709 Ga0495675_0205709_78_668 196
711 3300047444 Ga0495675_0236657 Ga0495675_0236657_90_686 196
712 3300047446 Ga0495679_009059 Ga0495679_009059_1196_1792 196
713 3300047446 Ga0495679_013639 Ga0495679_013639_1047_1637 196
714 3300047446 Ga0495679_015649 Ga0495679_015649_1175_1771 196
715 3300047446 Ga0495679_029684 Ga0495679_029684_1134_1724 196
716 3300047446 Ga0495679_030146 Ga0495679_030146_1094_1690 196
717 3300047469 Ga0495673_0004801 Ga0495673_0004801_2188_2778 196
718 3300047469 Ga0495673_0008000 Ga0495673_0008000_3594_4190 196
719 3300047469 Ga0495673_0008458 Ga0495673_0008458_2222_2818 196
720 3300047469 Ga0495673_0016214 Ga0495673_0016214_1205_1801 196
721 3300047469 Ga0495673_0024702 Ga0495673_0024702_827_1417 196
722 3300047469 Ga0495673_0025789 Ga0495673_0025789_1421_2011 196
723 3300047469 Ga0495673_0053156 Ga0495673_0053156_115_705 196
724 3300047469 Ga0495673_0059910 Ga0495673_0059910_803_1399 196
725 3300047469 Ga0495673_0176708 Ga0495673_0176708_175_765 196
726 3300047470 Ga0495681_0001946 Ga0495681_0001946_12297_12887 196
727 3300047470 Ga0495681_0003128 Ga0495681_0003128_8941_9537 196
728 3300047470 Ga0495681_0003665 Ga0495681_0003665_44_640 196
729 3300047470 Ga0495681_0005294 Ga0495681_0005294_6107_6703 196
730 3300047470 Ga0495681_0005658 Ga0495681_0005658_6499_7095 196
731 3300047470 Ga0495681_0005742 Ga0495681_0005742_2232_2828 196
732 3300047470 Ga0495681_0017057 Ga0495681_0017057_1253_1843 196
733 3300047470 Ga0495681_0026219 Ga0495681_0026219_450_1040 196
734 3300047470 Ga0495681_0026371 Ga0495681_0026371_1237_1833 196
735 3300047470 Ga0495681_0068104 Ga0495681_0068104_386_982 196
736 3300047470 Ga0495681_0078990 Ga0495681_0078990_34_624 196
737 3300047470 Ga0495681_0162457 Ga0495681_0162457_244_834 196
738 3300047470 Ga0495681_0173170 Ga0495681_0173170_236_832 196
739 3300047470 Ga0495681_0173172 Ga0495681_0173172_60_656 196
740 3300047471 Ga0495684_0034958 Ga0495684_0034958_407_997 196
741 3300047471 Ga0495684_0040249 Ga0495684_0040249_1060_1656 196
742 3300047472 Ga0495686_0004576 Ga0495686_0004576_9482_10078 196
743 3300047472 Ga0495686_0007704 Ga0495686_0007704_1055_1651 196
744 3300047472 Ga0495686_0012770 Ga0495686_0012770_1950_2540 196
745 3300047472 Ga0495686_0052697 Ga0495686_0052697_1329_1925 196
746 3300047673 Ga0495593_0003936 Ga0495593_0003936_6037_6627 196
747 3300047673 Ga0495593_0009775 Ga0495593_0009775_2898_3494 196
748 3300048088 Ga0495602_0008769 Ga0495602_0008769_7869_8465 196
749 3300048091 Ga0495626_0000919 Ga0495626_0000919_2000_2590 196
750 3300048091 Ga0495626_0000929 Ga0495626_0000929_2207_2803 196
751 3300048091 Ga0495626_0004079 Ga0495626_0004079_2031_2627 196
752 3300048091 Ga0495626_0004215 Ga0495626_0004215_2064_2660 196
753 3300048091 Ga0495626_0021376 Ga0495626_0021376_1273_1869 196
754 3300048091 Ga0495626_0027885 Ga0495626_0027885_1160_1750 196
755 3300048091 Ga0495626_0033026 Ga0495626_0033026_1030_1620 196
756 3300048091 Ga0495626_0061734 Ga0495626_0061734_23_613 196
757 3300048091 Ga0495626_0190687 Ga0495626_0190687_164_760 196
758 3300048904 Ga0496101_0163709 Ga0496101_0163709_1070_1666 196
759 3300048909 Ga0496106_0217410 Ga0496106_0217410_49_645 196
760 3300048913 Ga0496110_0779928 Ga0496110_0779928_136_732 196
761 3300048919 Ga0496116_0000618 Ga0496116_0000618_44235_44846 196
762 3300048919 Ga0496116_0004106 Ga0496116_0004106_2338_2934 196
763 3300048919 Ga0496116_0011737 Ga0496116_0011737_5490_6086 196
764 3300048919 Ga0496116_0045426 Ga0496116_0045426_1328_1924 196
765 3300048920 Ga0496117_0000871 Ga0496117_0000871_43987_44598 196
766 3300048920 Ga0496117_0011986 Ga0496117_0011986_1625_2221 196
767 3300048920 Ga0496117_0043102 Ga0496117_0043102_2255_2851 196
768 3300048920 Ga0496117_0071455 Ga0496117_0071455_1547_2143 196
769 3300048921 Ga0496118_0032529 Ga0496118_0032529_3382_3978 196
770 3300048921 Ga0496118_0041602 Ga0496118_0041602_1711_2307 196
771 3300048921 Ga0496118_0047936 Ga0496118_0047936_2276_2872 196
772 3300048921 Ga0496118_0057659 Ga0496118_0057659_2220_2831 196
773 3300048922 Ga0496119_0062811 Ga0496119_0062811_396_992 196
774 3300048922 Ga0496119_0423556 Ga0496119_0423556_19_609 196
775 3300048923 Ga0496120_0029435 Ga0496120_0029435_2009_2605 196
776 3300048924 Ga0496121_0001131 Ga0496121_0001131_44246_44857 196
777 3300048924 Ga0496121_0043246 Ga0496121_0043246_1156_1752 196
778 3300048924 Ga0496121_0412458 Ga0496121_0412458_67_663 196
779 3300048925 Ga0496122_0011596 Ga0496122_0011596_1969_2580 196
780 3300048925 Ga0496122_0023342 Ga0496122_0023342_762_1358 196
781 3300048926 Ga0496123_0007333 Ga0496123_0007333_1972_2583 196
782 3300048926 Ga0496123_0013307 Ga0496123_0013307_5267_5863 196
783 3300048927 Ga0496124_0192737 Ga0496124_0192737_90_686 196
784 3300048927 Ga0496124_0239793 Ga0496124_0239793_527_1123 196
785 3300048928 Ga0496125_0043819 Ga0496125_0043819_1281_1877 196
786 3300048928 Ga0496125_0099978 Ga0496125_0099978_1054_1665 196
787 3300049459 Ga0495678_001518 Ga0495678_001518_2341_2937 196
788 3300049459 Ga0495678_004662 Ga0495678_004662_5275_5871 196
789 3300049459 Ga0495678_013624 Ga0495678_013624_1132_1728 196
790 3300049459 Ga0495678_023846 Ga0495678_023846_736_1332 196
791 3300049459 Ga0495678_028093 Ga0495678_028093_267_857 196
792 3300049459 Ga0495678_041441 Ga0495678_041441_1172_1768 196
793 3300049459 Ga0495678_044162 Ga0495678_044162_449_1039 196
794 3300049459 Ga0495678_094884 Ga0495678_094884_43_633 196
795 3300049459 Ga0495678_147693 Ga0495678_147693_156_746 196
796 3300049460 Ga0495682_0002782 Ga0495682_0002782_2119_2715 196
797 3300049460 Ga0495682_0004627 Ga0495682_0004627_1910_2506 196
798 3300049460 Ga0495682_0010884 Ga0495682_0010884_1785_2381 196
799 3300049460 Ga0495682_0188535 Ga0495682_0188535_119_715 196
800 3300049662 Ga0501222_008438 Ga0501222_008438_641_1231 196
801 3300049682 Ga0501252_008691 Ga0501252_008691_63_659 196
802 3300049758 Ga0501241_009811 Ga0501241_009811_71_667 196
803 3300049766 Ga0501269_014611 Ga0501269_014611_316_912 196
804 3300050489 nmdc:mga03683_14606_c1 nmdc:mga03683_14606_c1_900_1496 196
805 3300050491 nmdc:mga00v17_15795_c1 nmdc:mga00v17_15795_c1_3602_4195 196
806 3300050491 nmdc:mga00v17_34114_c1 nmdc:mga00v17_34114_c1_260_850 196
807 3300050514 nmdc:mga08x19_264896_c1 nmdc:mga08x19_264896_c1_242_838 196
808 3300050516 nmdc:mga0sz30_58313_c1 nmdc:mga0sz30_58313_c1_585_1181 196
809 3300053111 Ga0500572_001037 Ga0500572_001037_2340_2936 196
810 3300053139 Ga0500568_0114595 Ga0500568_0114595_280_870 196
811 3300053142 Ga0500577_0043875 Ga0500577_0043875_400_996 196
812 3300053145 Ga0500586_028855 Ga0500586_028855_203_793 196

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12804

NTP_transf_3

MobA-like NTP transferase domain

7

176

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d5n-assembly4.cif.gz_E crystal structure of the q97w15_sulso protein from sulfolobus solfataricus. nesg target ssr125. 0.8824 4 188
3d5n-assembly1.cif.gz_G crystal structure of the q97w15_sulso protein from sulfolobus solfataricus. nesg target ssr125. 0.8735 4 187
3d5n-assembly3.cif.gz_B crystal structure of the q97w15_sulso protein from sulfolobus solfataricus. nesg target ssr125. 0.8684 6 187
3d5n-assembly1.cif.gz_G crystal structure of the q97w15_sulso protein from sulfolobus solfataricus. nesg target ssr125. 0.8636 4 187
3d5n-assembly4.cif.gz_E crystal structure of the q97w15_sulso protein from sulfolobus solfataricus. nesg target ssr125. 0.8631 4 188
ID Description Score Start End Superfamily
3d5nF00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8463 4 187 3.90.550.10
2weeA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8331 1 192 3.90.550.10
af_Q46810_2_188_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8291 4 192 3.90.550.10
3d5nF00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8227 4 187 3.90.550.10
2weeA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8006 1 192 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A0Q8HQT2-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein MobA 0.9972 1 196 GO:0016779
AF-A0A7X1DWQ0-F1-model_v4 Nucleotidyltransferase family protein 0.9929 4 195 GO:0016779
AF-A0A5E7LY60-F1-model_v4 Xanthine dehydrogenase subunit A 0.9888 1 196 GO:0016779
AF-A0A5E7LY60-F1-model_v4 Xanthine dehydrogenase subunit A 0.9838 1 196 GO:0016779
AF-A0A109LFS3-F1-model_v4 MobA-like NTP transferase domain protein 0.9712 35 196 GO:0016779

Feature Viewer

pLDDT pTM Quality
95.64 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map