F481664

General Info

Members Datasets Scaffolds Average Seq Length
806 278 1612 132

Family's Representative Sequence

Representative Sequence 3300049459|Ga0495678_215765|Ga0495678_215765_57_479
Length 140
Sequence MTDSRRPYDAVQPEPIDDNEDRMGSVHELDFDEDEPSAKIGDEIPEREREQLMPNERVREAGMTGASVADHEPTDDDMSPETLIHEDGARDAEEAGEGNQADWDLSIVDEDDIGGGNGLDEAELGSAIRWTANADKRDPL

Samples

Sample ID Description Type Environment
1 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
25 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
29 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
30 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
46 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
47 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
72 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
78 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
79 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
80 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
81 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
82 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
83 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
84 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
85 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
86 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
87 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
88 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
89 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
90 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
91 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
92 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
93 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
94 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
95 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
96 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
97 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
98 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
99 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
100 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
101 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
102 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
103 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
104 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
105 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
106 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
107 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
108 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
109 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
110 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
111 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
114 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
115 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
118 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
119 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
120 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
123 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
124 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
125 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
126 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
127 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
128 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
129 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
130 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
131 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
135 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
136 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
137 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
138 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
139 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
140 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
145 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
148 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
149 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
150 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
151 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
152 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
155 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
156 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
157 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
158 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
159 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
162 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
163 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
164 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
165 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
166 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
167 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
168 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
169 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
170 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
171 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
172 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
173 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
174 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
175 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
176 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
177 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
178 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
179 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
182 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
185 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
197 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
198 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
199 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
200 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
201 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
202 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
203 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
204 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
205 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
206 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
207 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
208 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
209 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
210 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
211 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
212 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
213 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
214 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
215 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
216 2511231004 Pseudomonas sp. GM102 Isolate Nodule
217 2511231007 Pseudomonas sp. GM18 Isolate Nodule
218 2511231008 Pseudomonas sp. GM21 Isolate Nodule
219 2511231010 Pseudomonas sp. GM25 Isolate Nodule
220 2511231011 Pseudomonas sp. GM30 Isolate Nodule
221 2511231016 Pseudomonas sp. GM50 Isolate Nodule
222 2511231017 Pseudomonas sp. GM55 Isolate Nodule
223 2511231022 Pseudomonas sp. GM79 Isolate Nodule
224 2511231023 Pseudomonas sp. GM80 Isolate Nodule
225 2511231031 Pseudomonas sp. GM16 Isolate Nodule
226 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
227 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
228 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
229 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
230 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
231 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
232 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
233 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
234 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
235 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
236 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
237 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
238 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
239 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
240 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
241 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
242 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
243 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
244 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
245 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
246 2773857673 Pseudomonas sp. 443 Isolate Unclassified
247 2784132063 Pseudomonas sp. 424 Isolate Unclassified
248 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
249 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
250 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
251 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
252 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
253 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
254 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
255 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
256 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
257 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
258 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
259 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
260 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
261 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
262 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
263 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
264 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
265 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
266 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
267 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
268 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
269 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
270 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
271 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
272 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
273 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
274 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
275 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
276 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
277 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
278 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.06
Metatranscriptomes 0.12
Isolates 7.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.85
Nodule 1.36
Rhizoplane 2.61
Rhizosphere 83.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495678_215765 3300049459 Bacteria 584
2 MRS2a_Contig_25852 2124908027 Bacteria 1548
3 JGI24741J21665_1049620 3300001915 Bacteria 617
4 Ga0006562J51391_1006713 3300003578 Bacteria 530
5 Ga0055525_1007004 3300003759 Bacteria 953
6 Ga0055536_1000790 3300003781 Bacteria 21068
7 Ga0055530_10001612 3300003791 Bacteria 16180
8 Ga0055540_1000505 3300003792 Bacteria 29657
9 Ga0055531_10000123 3300003794 Bacteria 86722
10 Ga0065714_10075709 3300005288 Bacteria 2874
11 Ga0065714_10240022 3300005288 Bacteria 797
12 Ga0065714_10275559 3300005288 Bacteria 732
13 Ga0065714_10312226 3300005288 Bacteria 679
14 Ga0065704_10366959 3300005289 Bacteria 774
15 Ga0065712_10092601 3300005290 Bacteria 2326
16 Ga0070670_100480426 3300005331 Bacteria 1103
17 Ga0070669_100000452 3300005353 Bacteria 31263
18 Ga0070669_100003010 3300005353 Bacteria 12139
19 Ga0070671_100233225 3300005355 Bacteria 1562
20 Ga0070659_100447710 3300005366 Bacteria 1095
21 Ga0070662_100006733 3300005457 Bacteria 7427
22 Ga0070662_100021712 3300005457 Bacteria 4387
23 Ga0068853_100001380 3300005539 Bacteria 17535
24 Ga0070665_100176958 3300005548 Bacteria 2134
25 Ga0070665_100224375 3300005548 Bacteria 1879
26 Ga0070665_100782981 3300005548 Bacteria 967
27 Ga0070664_100818306 3300005564 Bacteria 871
28 Ga0068854_100004527 3300005578 Bacteria 8765
29 Ga0068851_10000021 3300005834 Bacteria 132824
30 Ga0075364_10085802 3300006051 Bacteria 2085
31 Ga0075364_10173764 3300006051 Bacteria 1456
32 Ga0075364_10201021 3300006051 Bacteria 1351
33 Ga0075364_10248584 3300006051 Bacteria 1209
34 Ga0075432_10014432 3300006058 Bacteria 2691
35 Ga0075432_10047202 3300006058 Bacteria 1514
36 Ga0075432_10059207 3300006058 Bacteria 1361
37 Ga0075362_10410785 3300006177 Bacteria 684
38 Ga0075370_10917419 3300006353 Bacteria 536
39 Ga0075436_100224420 3300006914 Bacteria 1333
40 Ga0105251_10003422 3300009011 Bacteria 11511
41 Ga0105251_10006741 3300009011 Bacteria 7249
42 Ga0105251_10007701 3300009011 Bacteria 6582
43 Ga0105251_10048243 3300009011 Bacteria 2042
44 Ga0105251_10061622 3300009011 Bacteria 1763
45 Ga0105251_10089203 3300009011 Bacteria 1418
46 Ga0105251_10098250 3300009011 Bacteria 1340
47 Ga0105251_10183176 3300009011 Bacteria 943
48 Ga0105251_10210081 3300009011 Bacteria 876
49 Ga0105251_10321312 3300009011 Bacteria 703
50 Ga0105244_10008583 3300009036 Bacteria 6373
51 Ga0105244_10021816 3300009036 Bacteria 3533
52 Ga0105244_10024121 3300009036 Bacteria 3324
53 Ga0105244_10058408 3300009036 Bacteria 1947
54 Ga0105244_10067215 3300009036 Bacteria 1793
55 Ga0105244_10134070 3300009036 Bacteria 1194
56 Ga0105244_10143031 3300009036 Bacteria 1149
57 Ga0105244_10164685 3300009036 Bacteria 1057
58 Ga0105244_10175750 3300009036 Bacteria 1017
59 Ga0105244_10279122 3300009036 Bacteria 775
60 Ga0105250_10000120 3300009092 Bacteria 69464
61 Ga0105250_10001686 3300009092 Bacteria 11684
62 Ga0105250_10010112 3300009092 Bacteria 3938
63 Ga0105250_10025186 3300009092 Bacteria 2398
64 Ga0105250_10424421 3300009092 Bacteria 593
65 Ga0105240_10921729 3300009093 Bacteria 939
66 Ga0105243_10001176 3300009148 Bacteria 23688
67 Ga0105242_10851667 3300009176 Bacteria 907
68 Ga0105248_10044903 3300009177 Bacteria 4956
69 Ga0105239_12521295 3300010375 Bacteria 599
70 Ga0105239_12600188 3300010375 Bacteria 590
71 Ga0105246_10003916 3300011119 Bacteria 9014
72 Ga0105246_10165354 3300011119 Bacteria 1689
73 Ga0157345_1000042 3300012498 Bacteria 30268
74 Ga0157373_10005127 3300013100 Bacteria 9848
75 Ga0157373_10037579 3300013100 Bacteria 3471
76 Ga0157373_10259317 3300013100 Bacteria 1230
77 Ga0157373_10435287 3300013100 Bacteria 942
78 Ga0157373_10652048 3300013100 Bacteria 769
79 Ga0157373_10832782 3300013100 Bacteria 682
80 Ga0157373_10888430 3300013100 Bacteria 661
81 Ga0157370_10048778 3300013104 Bacteria 4056
82 Ga0157370_11150527 3300013104 Bacteria 701
83 Ga0157370_11155409 3300013104 Bacteria 699
84 Ga0157370_11577072 3300013104 Bacteria 590
85 Ga0157369_10004354 3300013105 Bacteria 16706
86 Ga0157369_10038595 3300013105 Bacteria 5222
87 Ga0157369_10476632 3300013105 Bacteria 1291
88 Ga0163162_10001021 3300013306 Bacteria 26003
89 Ga0163162_10250382 3300013306 Bacteria 1904
90 Ga0163162_10981054 3300013306 Bacteria 955
91 Ga0163162_11648577 3300013306 Bacteria 732
92 Ga0157372_10006828 3300013307 Bacteria 12136
93 Ga0157375_10689520 3300013308 Bacteria 1176
94 Ga0157375_10731159 3300013308 Bacteria 1142
95 Ga0182008_10004169 3300014497 Bacteria 8502
96 Ga0182008_10007900 3300014497 Bacteria 5838
97 Ga0182008_10019141 3300014497 Bacteria 3538
98 Ga0182008_10039914 3300014497 Bacteria 2345
99 Ga0182008_10155738 3300014497 Bacteria 1148
100 Ga0182006_1000508 3300015261 Bacteria 29663
101 Ga0182006_1001937 3300015261 Bacteria 11759
102 Ga0182006_1028612 3300015261 Bacteria 2265
103 Ga0182006_1058617 3300015261 Bacteria 1460
104 Ga0182006_1202151 3300015261 Bacteria 658
105 Ga0182007_10001676 3300015262 Bacteria 11745
106 Ga0182007_10065383 3300015262 Bacteria 1192
107 Ga0182005_1001052 3300015265 Bacteria 11680
108 Ga0182005_1039955 3300015265 Bacteria 1276
109 Ga0182005_1041280 3300015265 Bacteria 1254
110 Ga0182005_1088592 3300015265 Bacteria 859
111 Ga0163161_10037661 3300017792 Bacteria 3468
112 Ga0163161_10058107 3300017792 Bacteria 2811
113 Ga0163161_10220175 3300017792 Bacteria 1470
114 Ga0163161_10542554 3300017792 Bacteria 952
115 Ga0163161_10702179 3300017792 Bacteria 842
116 Ga0163161_10714808 3300017792 Bacteria 835
117 Ga0163161_10772931 3300017792 Bacteria 805
118 Ga0163161_10849413 3300017792 Bacteria 770
119 Ga0163161_10869568 3300017792 Bacteria 762
120 Ga0209563_100838 3300025230 Bacteria 9157
121 Ga0209675_1015408 3300025291 Bacteria 2270
122 Ga0209676_1000010 3300025292 Bacteria 954025
123 Ga0209050_1000866 3300025298 Bacteria 40900
124 Ga0209051_1000631 3300025303 Bacteria 40463
125 Ga0209257_1000357 3300025304 Bacteria 93431
126 Ga0207656_10000020 3300025321 Bacteria 114666
127 Ga0207696_1000052 3300025711 Bacteria 272880
128 Ga0207696_1000738 3300025711 Bacteria 21855
129 Ga0207696_1001510 3300025711 Bacteria 12479
130 Ga0207696_1016498 3300025711 Bacteria 2469
131 Ga0207655_1000723 3300025728 Bacteria 37487
132 Ga0207655_1001045 3300025728 Bacteria 27769
133 Ga0207655_1003748 3300025728 Bacteria 11149
134 Ga0207655_1006098 3300025728 Bacteria 8045
135 Ga0207655_1018817 3300025728 Bacteria 3643
136 Ga0207655_1020318 3300025728 Bacteria 3419
137 Ga0207655_1050309 3300025728 Bacteria 1695
138 Ga0207655_1055613 3300025728 Bacteria 1566
139 Ga0207655_1122133 3300025728 Bacteria 861
140 Ga0207655_1180284 3300025728 Bacteria 646
141 Ga0207713_1000990 3300025735 Bacteria 24928
142 Ga0207713_1001083 3300025735 Bacteria 23417
143 Ga0207713_1002401 3300025735 Bacteria 13683
144 Ga0207713_1006100 3300025735 Bacteria 7420
145 Ga0207713_1007286 3300025735 Bacteria 6561
146 Ga0207713_1013157 3300025735 Bacteria 4378
147 Ga0207713_1043489 3300025735 Bacteria 1856
148 Ga0207713_1048386 3300025735 Bacteria 1713
149 Ga0207713_1055790 3300025735 Bacteria 1539
150 Ga0207671_10964949 3300025914 Bacteria 672
151 Ga0207681_10000119 3300025923 Bacteria 66476
152 Ga0207681_10010462 3300025923 Bacteria 5677
153 Ga0207650_10000225 3300025925 Bacteria 63430
154 Ga0207690_10232654 3300025932 Bacteria 1416
155 Ga0207706_10000855 3300025933 Bacteria 31362
156 Ga0207706_10011726 3300025933 Bacteria 7987
157 Ga0207686_10811299 3300025934 Bacteria 751
158 Ga0207709_10000189 3300025935 Bacteria 82404
159 Ga0207711_10025554 3300025941 Bacteria 4954
160 Ga0207679_10282879 3300025945 Bacteria 1423
161 Ga0207639_10001210 3300026041 Bacteria 17542
162 Ga0207428_10042657 3300027907 Bacteria 3668
163 Ga0207428_10117365 3300027907 Bacteria 2043
164 Ga0207428_10351075 3300027907 Bacteria 1085
165 Ga0268266_10043510 3300028379 Bacteria 3838
166 Ga0268266_10369118 3300028379 Bacteria 1351
167 Ga0268266_11393891 3300028379 Bacteria 676
168 Ga0307511_10028914 3300030521 Bacteria 5018
169 Ga0307511_10380965 3300030521 Bacteria 590
170 Ga0265316_10917445 3300031344 Bacteria 611
171 Ga0307408_100005853 3300031548 Bacteria 8180
172 Ga0307405_10005315 3300031731 Bacteria 6196
173 Ga0307405_12163402 3300031731 Bacteria 500
174 Ga0307412_10030472 3300031911 Bacteria 3397
175 Ga0307412_10105526 3300031911 Bacteria 2001
176 Ga0307412_11234874 3300031911 Bacteria 670
177 Ga0307414_11482321 3300032004 Bacteria 631
178 Ga0307510_10000760 3300033180 Bacteria 33313
179 Ga0439438_013914 3300041405 Bacteria 2408
180 Ga0439438_031150 3300041405 Bacteria 1418
181 Ga0439438_133771 3300041405 Bacteria 594
182 Ga0439447_000164 3300041407 Bacteria 22655
183 Ga0439447_006486 3300041407 Bacteria 3792
184 Ga0439447_014144 3300041407 Bacteria 2244
185 Ga0439447_023228 3300041407 Bacteria 1617
186 Ga0439447_042050 3300041407 Bacteria 1110
187 Ga0439466_0010082 3300041411 Bacteria 3513
188 Ga0439466_0011032 3300041411 Bacteria 3349
189 Ga0439466_0013456 3300041411 Bacteria 2994
190 Ga0439466_0021779 3300041411 Bacteria 2267
191 Ga0439466_0099843 3300041411 Bacteria 905
192 Ga0439465_0015620 3300041413 Bacteria 2368
193 Ga0451853_3596406 3300041512 Bacteria 692
194 Ga0439432_000107 3300042006 Bacteria 26714
195 Ga0439432_017184 3300042006 Bacteria 2430
196 Ga0439432_017202 3300042006 Bacteria 2428
197 Ga0439432_058894 3300042006 Bacteria 1187
198 Ga0439451_001663 3300042009 Bacteria 4416
199 Ga0439451_002456 3300042009 Bacteria 3756
200 Ga0439452_003943 3300042010 Bacteria 5085
201 Ga0439456_001367 3300042013 Bacteria 4878
202 Ga0439456_036059 3300042013 Bacteria 1066
203 Ga0439463_001373 3300042016 Bacteria 6482
204 Ga0439463_094381 3300042016 Bacteria 770
205 Ga0450911_002116 3300042115 Bacteria 4055
206 Ga0450919_002151 3300042121 Bacteria 2566
207 Ga0450922_000522 3300042124 Bacteria 4078
208 Ga0450890_001081 3300042127 Bacteria 3971
209 Ga0450897_010015 3300042128 Bacteria 905
210 Ga0450898_024289 3300042134 Bacteria 1082
211 Ga0450899_006221 3300042135 Bacteria 1288
212 Ga0450902_001401 3300042137 Bacteria 3277
213 Ga0450902_003072 3300042137 Bacteria 2411
214 Ga0450902_016067 3300042137 Bacteria 1218
215 Ga0450902_021010 3300042137 Bacteria 1078
216 Ga0450903_001769 3300042138 Bacteria 3954
217 Ga0450903_005466 3300042138 Bacteria 2129
218 Ga0450903_017010 3300042138 Bacteria 1138
219 Ga0450903_020176 3300042138 Bacteria 1031
220 Ga0450904_006536 3300042139 Bacteria 1162
221 Ga0450905_009643 3300042142 Bacteria 1330
222 Ga0450889_007563 3300042144 Bacteria 1097
223 Ga0450889_020365 3300042144 Bacteria 734
224 Ga0450906_001413 3300042145 Bacteria 5227
225 Ga0450907_005336 3300042146 Bacteria 2171
226 Ga0450907_027448 3300042146 Bacteria 965
227 Ga0450910_010755 3300042147 Bacteria 1307
228 Ga0439446_0011066 3300042156 Bacteria 2442
229 Ga0439446_0201854 3300042156 Bacteria 671
230 Ga0450908_000513 3300042184 Bacteria 7467
231 Ga0450909_001050 3300042185 Bacteria 3790
232 Ga0450909_036372 3300042185 Bacteria 753
233 Ga0439464_0005632 3300042439 Bacteria 3243
234 Ga0439460_0000049 3300042461 Bacteria 17698
235 Ga0439460_0143771 3300042461 Bacteria 792
236 Ga0450893_0033661 3300042532 Bacteria 920
237 Ga0450893_0034330 3300042532 Bacteria 913
238 Ga0439440_0000884 3300042993 Bacteria 5236
239 Ga0495617_009005 3300046452 Bacteria 3433
240 Ga0495617_037387 3300046452 Bacteria 1626
241 Ga0495617_048905 3300046452 Bacteria 1407
242 Ga0495617_074581 3300046452 Bacteria 1113
243 Ga0495617_089933 3300046452 Bacteria 1002
244 Ga0495617_130215 3300046452 Bacteria 807
245 Ga0495617_203474 3300046452 Bacteria 618
246 Ga0495617_232056 3300046452 Bacteria 571
247 Ga0495617_235007 3300046452 Bacteria 567
248 Ga0495627_000107 3300046453 Bacteria 102518
249 Ga0495627_000829 3300046453 Bacteria 22331
250 Ga0495627_007613 3300046453 Bacteria 4134
251 Ga0495627_010413 3300046453 Bacteria 3380
252 Ga0495627_018570 3300046453 Bacteria 2342
253 Ga0495627_056313 3300046453 Bacteria 1172
254 Ga0495627_181750 3300046453 Bacteria 582
255 Ga0495592_0333302 3300046454 Bacteria 977
256 Ga0495603_0051155 3300046455 Bacteria 2455
257 Ga0495590_0006886 3300046457 Bacteria 4413
258 Ga0495590_0007585 3300046457 Bacteria 4173
259 Ga0495590_0033652 3300046457 Bacteria 1791
260 Ga0495591_000610 3300046458 Bacteria 26765
261 Ga0495591_002278 3300046458 Bacteria 10885
262 Ga0495591_015801 3300046458 Bacteria 2653
263 Ga0495591_020098 3300046458 Bacteria 2216
264 Ga0495591_022985 3300046458 Bacteria 2006
265 Ga0495591_049407 3300046458 Bacteria 1156
266 Ga0495591_053432 3300046458 Bacteria 1095
267 Ga0495591_056291 3300046458 Bacteria 1057
268 Ga0495591_078170 3300046458 Bacteria 847
269 Ga0495591_114532 3300046458 Bacteria 660
270 Ga0495638_0002621 3300046460 Bacteria 14479
271 Ga0495638_0028621 3300046460 Bacteria 3595
272 Ga0495638_0068625 3300046460 Bacteria 2173
273 Ga0495638_0082730 3300046460 Bacteria 1946
274 Ga0495638_0101578 3300046460 Bacteria 1719
275 Ga0495638_0101647 3300046460 Bacteria 1718
276 Ga0495638_0167019 3300046460 Bacteria 1265
277 Ga0495638_0188496 3300046460 Bacteria 1171
278 Ga0495638_0292582 3300046460 Bacteria 880
279 Ga0495638_0303825 3300046460 Bacteria 858
280 Ga0495653_0002213 3300046463 Bacteria 15381
281 Ga0495653_0007596 3300046463 Bacteria 8864
282 Ga0495653_0041578 3300046463 Bacteria 3587
283 Ga0495653_0091678 3300046463 Bacteria 2221
284 Ga0495653_0524779 3300046463 Bacteria 735
285 Ga0495653_0622360 3300046463 Bacteria 661
286 Ga0495650_0012094 3300046471 Bacteria 4667
287 Ga0495650_0043915 3300046471 Bacteria 1892
288 Ga0495650_0124200 3300046471 Bacteria 947
289 Ga0495650_0134377 3300046471 Bacteria 900
290 Ga0495650_0164611 3300046471 Bacteria 788
291 Ga0495580_0484298 3300046472 Bacteria 827
292 Ga0495580_0569379 3300046472 Bacteria 751
293 Ga0495605_0004348 3300046474 Bacteria 8331
294 Ga0495605_0022295 3300046474 Bacteria 3346
295 Ga0495605_0046618 3300046474 Bacteria 2129
296 Ga0495605_0060483 3300046474 Bacteria 1815
297 Ga0495605_0114337 3300046474 Bacteria 1228
298 Ga0495605_0161565 3300046474 Bacteria 994
299 Ga0495605_0164025 3300046474 Bacteria 985
300 Ga0495605_0342027 3300046474 Bacteria 628
301 Ga0495605_0421905 3300046474 Bacteria 552
302 Ga0495639_0000086 3300046475 Bacteria 44597
303 Ga0495639_0406468 3300046475 Bacteria 688
304 Ga0495584_0001054 3300046491 Bacteria 17157
305 Ga0495584_0005175 3300046491 Bacteria 6923
306 Ga0495584_0029964 3300046491 Bacteria 2757
307 Ga0495584_0048510 3300046491 Bacteria 2140
308 Ga0495584_0048611 3300046491 Bacteria 2138
309 Ga0495584_0057408 3300046491 Bacteria 1958
310 Ga0495584_0129427 3300046491 Bacteria 1280
311 Ga0495584_0174215 3300046491 Bacteria 1093
312 Ga0495584_0234726 3300046491 Bacteria 932
313 Ga0495584_0239643 3300046491 Bacteria 922
314 Ga0495584_0507434 3300046491 Bacteria 614
315 Ga0495584_0603789 3300046491 Bacteria 559
316 Ga0495585_0001257 3300046492 Bacteria 20434
317 Ga0495585_0007697 3300046492 Bacteria 6565
318 Ga0495585_0008998 3300046492 Bacteria 6018
319 Ga0495585_0014307 3300046492 Bacteria 4625
320 Ga0495585_0027209 3300046492 Bacteria 3264
321 Ga0495585_0091429 3300046492 Bacteria 1638
322 Ga0495585_0162617 3300046492 Bacteria 1157
323 Ga0495585_0168756 3300046492 Bacteria 1131
324 Ga0495585_0369256 3300046492 Bacteria 694
325 Ga0495585_0512011 3300046492 Bacteria 569
326 Ga0495594_0068459 3300046499 Bacteria 1972
327 Ga0495596_0124501 3300046500 Bacteria 1000
328 Ga0495607_0002285 3300046501 Bacteria 15778
329 Ga0495607_0004396 3300046501 Bacteria 10385
330 Ga0495607_0005337 3300046501 Bacteria 9233
331 Ga0495607_0005402 3300046501 Bacteria 9152
332 Ga0495607_0005785 3300046501 Bacteria 8795
333 Ga0495607_0021044 3300046501 Bacteria 4108
334 Ga0495607_0029053 3300046501 Bacteria 3405
335 Ga0495607_0056174 3300046501 Bacteria 2261
336 Ga0495607_0141108 3300046501 Bacteria 1242
337 Ga0495607_0150145 3300046501 Bacteria 1193
338 Ga0495607_0160575 3300046501 Bacteria 1142
339 Ga0495607_0236599 3300046501 Bacteria 885
340 Ga0495607_0292865 3300046501 Bacteria 768
341 Ga0495607_0362065 3300046501 Bacteria 667
342 Ga0495607_0378183 3300046501 Bacteria 648
343 Ga0495607_0384473 3300046501 Bacteria 641
344 Ga0495607_0530072 3300046501 Bacteria 519
345 Ga0495583_0007462 3300046506 Bacteria 6859
346 Ga0495583_0079717 3300046506 Bacteria 1424
347 Ga0495606_0008144 3300046507 Bacteria 9182
348 Ga0495606_0020157 3300046507 Bacteria 4928
349 Ga0495606_0020581 3300046507 Bacteria 4857
350 Ga0495606_0026182 3300046507 Bacteria 4159
351 Ga0495606_0027986 3300046507 Bacteria 3984
352 Ga0495606_0033274 3300046507 Bacteria 3557
353 Ga0495606_0073674 3300046507 Bacteria 2141
354 Ga0495606_0091786 3300046507 Bacteria 1866
355 Ga0495606_0115936 3300046507 Bacteria 1609
356 Ga0495606_0211437 3300046507 Bacteria 1098
357 Ga0495606_0298636 3300046507 Bacteria 873
358 Ga0495606_0327220 3300046507 Bacteria 821
359 Ga0495606_0384407 3300046507 Bacteria 735
360 Ga0495610_0001135 3300046512 Bacteria 24214
361 Ga0495610_0003376 3300046512 Bacteria 12487
362 Ga0495610_0012495 3300046512 Bacteria 5105
363 Ga0495610_0016281 3300046512 Bacteria 4289
364 Ga0495610_0016514 3300046512 Bacteria 4245
365 Ga0495610_0021065 3300046512 Bacteria 3595
366 Ga0495610_0033551 3300046512 Bacteria 2652
367 Ga0495610_0039596 3300046512 Bacteria 2382
368 Ga0495610_0100252 3300046512 Bacteria 1298
369 Ga0495610_0154553 3300046512 Bacteria 975
370 Ga0495610_0290675 3300046512 Bacteria 633
371 Ga0495616_0005357 3300046513 Bacteria 7913
372 Ga0495616_0005657 3300046513 Bacteria 7653
373 Ga0495616_0014718 3300046513 Bacteria 4369
374 Ga0495616_0039866 3300046513 Bacteria 2403
375 Ga0495616_0041096 3300046513 Bacteria 2360
376 Ga0495616_0061951 3300046513 Bacteria 1833
377 Ga0495616_0121807 3300046513 Bacteria 1203
378 Ga0495616_0236193 3300046513 Bacteria 790
379 Ga0495620_0000808 3300046515 Bacteria 19266
380 Ga0495620_0027393 3300046515 Bacteria 2667
381 Ga0495620_0032507 3300046515 Bacteria 2376
382 Ga0495620_0047520 3300046515 Bacteria 1846
383 Ga0495620_0231838 3300046515 Bacteria 705
384 Ga0495628_0168861 3300046516 Bacteria 1659
385 Ga0495630_0128311 3300046517 Bacteria 1925
386 Ga0495631_0000250 3300046518 Bacteria 37252
387 Ga0495631_0000276 3300046518 Bacteria 35903
388 Ga0495631_0002243 3300046518 Bacteria 11099
389 Ga0495631_0025882 3300046518 Bacteria 2698
390 Ga0495631_0102813 3300046518 Bacteria 1229
391 Ga0495631_0111839 3300046518 Bacteria 1174
392 Ga0495631_0163304 3300046518 Bacteria 955
393 Ga0495632_0001128 3300046519 Bacteria 22842
394 Ga0495632_0007671 3300046519 Bacteria 6737
395 Ga0495632_0016512 3300046519 Bacteria 4104
396 Ga0495632_0016832 3300046519 Bacteria 4054
397 Ga0495632_0020061 3300046519 Bacteria 3629
398 Ga0495632_0026676 3300046519 Bacteria 3038
399 Ga0495632_0032985 3300046519 Bacteria 2662
400 Ga0495632_0035979 3300046519 Bacteria 2521
401 Ga0495632_0133242 3300046519 Bacteria 1155
402 Ga0495632_0133970 3300046519 Bacteria 1152
403 Ga0495632_0182340 3300046519 Bacteria 961
404 Ga0495637_0000424 3300046520 Bacteria 30857
405 Ga0495637_0001077 3300046520 Bacteria 16951
406 Ga0495637_0001331 3300046520 Bacteria 14807
407 Ga0495637_0001707 3300046520 Bacteria 12678
408 Ga0495637_0004875 3300046520 Bacteria 6902
409 Ga0495637_0014590 3300046520 Bacteria 3703
410 Ga0495637_0020988 3300046520 Bacteria 2996
411 Ga0495637_0030244 3300046520 Bacteria 2403
412 Ga0495637_0033634 3300046520 Bacteria 2249
413 Ga0495637_0035686 3300046520 Bacteria 2170
414 Ga0495637_0036357 3300046520 Bacteria 2145
415 Ga0495637_0047524 3300046520 Bacteria 1810
416 Ga0495637_0092689 3300046520 Bacteria 1190
417 Ga0495637_0268797 3300046520 Bacteria 610
418 Ga0495643_0004491 3300046522 Bacteria 9729
419 Ga0495643_0022829 3300046522 Bacteria 3563
420 Ga0495643_0053268 3300046522 Bacteria 2169
421 Ga0495643_0086047 3300046522 Bacteria 1629
422 Ga0495643_0193935 3300046522 Bacteria 979
423 Ga0495643_0205655 3300046522 Bacteria 942
424 Ga0495643_0536439 3300046522 Bacteria 500
425 Ga0495644_0000223 3300046523 Bacteria 26777
426 Ga0495644_0001517 3300046523 Bacteria 9456
427 Ga0495644_0025425 3300046523 Bacteria 2247
428 Ga0495644_0210499 3300046523 Bacteria 750
429 Ga0495648_0031384 3300046524 Bacteria 3499
430 Ga0495648_0034873 3300046524 Bacteria 3268
431 Ga0495648_0151874 3300046524 Bacteria 1207
432 Ga0495648_0183731 3300046524 Bacteria 1060
433 Ga0495648_0211381 3300046524 Bacteria 963
434 Ga0495648_0477640 3300046524 Bacteria 539
435 Ga0495648_0496131 3300046524 Bacteria 524
436 Ga0495666_0136325 3300046526 Bacteria 1145
437 Ga0495666_0165166 3300046526 Bacteria 1025
438 Ga0495666_0264668 3300046526 Bacteria 781
439 Ga0495652_0469752 3300046529 Bacteria 877
440 Ga0495654_0000137 3300046530 Bacteria 76186
441 Ga0495654_0000702 3300046530 Bacteria 26270
442 Ga0495654_0001756 3300046530 Bacteria 14521
443 Ga0495654_0001984 3300046530 Bacteria 13486
444 Ga0495654_0002874 3300046530 Bacteria 10815
445 Ga0495654_0006574 3300046530 Bacteria 6584
446 Ga0495654_0017627 3300046530 Bacteria 3749
447 Ga0495654_0066898 3300046530 Bacteria 1711
448 Ga0495654_0078117 3300046530 Bacteria 1556
449 Ga0495654_0125423 3300046530 Bacteria 1157
450 Ga0495654_0126028 3300046530 Bacteria 1154
451 Ga0495654_0152622 3300046530 Bacteria 1020
452 Ga0495654_0167663 3300046530 Bacteria 959
453 Ga0495654_0246112 3300046530 Bacteria 746
454 Ga0495654_0268292 3300046530 Bacteria 705
455 Ga0495654_0435259 3300046530 Bacteria 517
456 Ga0495587_0024842 3300046536 Bacteria 3667
457 Ga0495587_0400769 3300046536 Bacteria 762
458 Ga0495609_0005190 3300046538 Bacteria 6932
459 Ga0495609_0123817 3300046538 Bacteria 1110
460 Ga0495609_0144116 3300046538 Bacteria 1015
461 Ga0495609_0195302 3300046538 Bacteria 847
462 Ga0495597_0002668 3300046542 Bacteria 11037
463 Ga0495597_0022891 3300046542 Bacteria 2894
464 Ga0495597_0026804 3300046542 Bacteria 2646
465 Ga0495597_0043299 3300046542 Bacteria 2005
466 Ga0495597_0103375 3300046542 Bacteria 1199
467 Ga0495597_0142584 3300046542 Bacteria 987
468 Ga0495597_0153746 3300046542 Bacteria 942
469 Ga0495597_0192568 3300046542 Bacteria 819
470 Ga0495645_0471088 3300046543 Bacteria 789
471 Ga0495622_0000225 3300046557 Bacteria 44796
472 Ga0495622_0000482 3300046557 Bacteria 25100
473 Ga0495622_0530092 3300046557 Bacteria 502
474 Ga0495633_0042610 3300046558 Bacteria 2154
475 Ga0495633_0092960 3300046558 Bacteria 1402
476 Ga0495656_0053907 3300046615 Bacteria 1729
477 Ga0495656_0498348 3300046615 Bacteria 646
478 Ga0495668_0004667 3300046616 Bacteria 9615
479 Ga0495634_0001331 3300046642 Bacteria 22500
480 Ga0495634_0240611 3300046642 Bacteria 1110
481 Ga0495611_0000286 3300046648 Bacteria 34423
482 Ga0495611_0164639 3300046648 Bacteria 1036
483 Ga0495611_0172298 3300046648 Bacteria 1011
484 Ga0495611_0456080 3300046648 Bacteria 582
485 Ga0495611_0513826 3300046648 Bacteria 544
486 Ga0495625_0004277 3300046660 Bacteria 13585
487 Ga0495625_0004376 3300046660 Bacteria 13397
488 Ga0495625_0005240 3300046660 Bacteria 11932
489 Ga0495625_0043158 3300046660 Bacteria 3272
490 Ga0495625_0126733 3300046660 Bacteria 1732
491 Ga0495625_0335587 3300046660 Bacteria 959
492 Ga0495625_0476914 3300046660 Bacteria 766
493 Ga0495625_0508580 3300046660 Bacteria 735
494 Ga0495625_0544727 3300046660 Bacteria 703
495 Ga0495625_0705576 3300046660 Bacteria 595
496 Ga0495625_0769650 3300046660 Bacteria 562
497 Ga0495625_0850858 3300046660 Bacteria 526
498 Ga0495635_0012749 3300046663 Bacteria 5889
499 Ga0495659_0000110 3300046664 Bacteria 36480
500 Ga0495659_0001576 3300046664 Bacteria 7669
501 Ga0495661_0000575 3300046665 Bacteria 38183
502 Ga0495661_0005029 3300046665 Bacteria 9442
503 Ga0495661_0010957 3300046665 Bacteria 6161
504 Ga0495661_0027806 3300046665 Bacteria 3627
505 Ga0495661_0043715 3300046665 Bacteria 2752
506 Ga0495661_0071638 3300046665 Bacteria 2024
507 Ga0495661_0076772 3300046665 Bacteria 1937
508 Ga0495661_0165290 3300046665 Bacteria 1184
509 Ga0495661_0503309 3300046665 Bacteria 577
510 Ga0495661_0551326 3300046665 Bacteria 545
511 Ga0495623_0039669 3300046679 Bacteria 3008
512 Ga0495646_0048365 3300046680 Bacteria 2584
513 Ga0495646_0259173 3300046680 Bacteria 929
514 Ga0495646_0302648 3300046680 Bacteria 845
515 Ga0495669_0416525 3300046684 Bacteria 651
516 Ga0495613_0102116 3300046689 Bacteria 2070
517 Ga0495613_0115248 3300046689 Bacteria 1934
518 Ga0495613_0480537 3300046689 Bacteria 838
519 Ga0495624_0069379 3300046690 Bacteria 2196
520 Ga0495670_0000889 3300046691 Bacteria 14480
521 Ga0495670_0001208 3300046691 Bacteria 12556
522 Ga0495670_0001590 3300046691 Bacteria 11096
523 Ga0495670_0138749 3300046691 Bacteria 1270
524 Ga0495670_0236420 3300046691 Bacteria 972
525 Ga0495670_0372873 3300046691 Bacteria 769
526 Ga0495670_0491348 3300046691 Bacteria 666
527 Ga0495670_0797440 3300046691 Bacteria 515
528 Ga0495671_0001223 3300046692 Bacteria 17580
529 Ga0495671_0007222 3300046692 Bacteria 6350
530 Ga0495671_0063793 3300046692 Bacteria 1814
531 Ga0495671_0073457 3300046692 Bacteria 1678
532 Ga0495671_0129516 3300046692 Bacteria 1230
533 Ga0495671_0139930 3300046692 Bacteria 1179
534 Ga0495671_0153282 3300046692 Bacteria 1121
535 Ga0495671_0162126 3300046692 Bacteria 1087
536 Ga0495671_0241039 3300046692 Bacteria 873
537 Ga0495671_0621529 3300046692 Bacteria 513
538 Ga0495671_0646821 3300046692 Bacteria 502
539 Ga0495649_0001059 3300046694 Bacteria 21506
540 Ga0495649_0024331 3300046694 Bacteria 3377
541 Ga0495649_0027004 3300046694 Bacteria 3187
542 Ga0495649_0037588 3300046694 Bacteria 2657
543 Ga0495649_0045439 3300046694 Bacteria 2394
544 Ga0495649_0048301 3300046694 Bacteria 2312
545 Ga0495649_0049008 3300046694 Bacteria 2294
546 Ga0495649_0065793 3300046694 Bacteria 1945
547 Ga0495649_0152480 3300046694 Bacteria 1213
548 Ga0495649_0189622 3300046694 Bacteria 1070
549 Ga0495649_0191486 3300046694 Bacteria 1064
550 Ga0495649_0213841 3300046694 Bacteria 998
551 Ga0495649_0336203 3300046694 Bacteria 764
552 Ga0495649_0576014 3300046694 Bacteria 556
553 Ga0495589_0000667 3300046794 Bacteria 22510
554 Ga0495589_0008464 3300046794 Bacteria 5371
555 Ga0495589_0031454 3300046794 Bacteria 2671
556 Ga0495589_0096754 3300046794 Bacteria 1430
557 Ga0495589_0241521 3300046794 Bacteria 845
558 Ga0495589_0295406 3300046794 Bacteria 751
559 Ga0495589_0319762 3300046794 Bacteria 717
560 Ga0495600_0132456 3300046809 Bacteria 1620
561 Ga0495660_0003097 3300046810 Bacteria 10365
562 Ga0495660_0007035 3300046810 Bacteria 6633
563 Ga0495660_0023919 3300046810 Bacteria 3481
564 Ga0495660_0053801 3300046810 Bacteria 2183
565 Ga0495660_0057835 3300046810 Bacteria 2090
566 Ga0495660_0062523 3300046810 Bacteria 1995
567 Ga0495660_0063183 3300046810 Bacteria 1983
568 Ga0495660_0090130 3300046810 Bacteria 1595
569 Ga0495660_0141652 3300046810 Bacteria 1195
570 Ga0495660_0162198 3300046810 Bacteria 1095
571 Ga0495660_0206851 3300046810 Bacteria 933
572 Ga0495660_0309170 3300046810 Bacteria 713
573 Ga0495660_0413634 3300046810 Bacteria 588
574 Ga0495581_0034121 3300047315 Bacteria 2944
575 Ga0495604_0006964 3300047317 Bacteria 8960
576 Ga0495604_0055222 3300047317 Bacteria 3062
577 Ga0495672_0001938 3300047320 Bacteria 19559
578 Ga0495672_0002030 3300047320 Bacteria 19098
579 Ga0495672_0002566 3300047320 Bacteria 16526
580 Ga0495672_0003500 3300047320 Bacteria 13396
581 Ga0495672_0004290 3300047320 Bacteria 11758
582 Ga0495672_0011806 3300047320 Bacteria 6135
583 Ga0495672_0024807 3300047320 Bacteria 3854
584 Ga0495672_0306926 3300047320 Bacteria 749
585 Ga0495672_0381998 3300047320 Bacteria 647
586 Ga0495672_0395000 3300047320 Bacteria 633
587 Ga0495676_0004850 3300047321 Bacteria 12336
588 Ga0495676_0005794 3300047321 Bacteria 11330
589 Ga0495676_0322992 3300047321 Bacteria 1036
590 Ga0495680_0008909 3300047322 Bacteria 9073
591 Ga0495680_0097803 3300047322 Bacteria 2190
592 Ga0495680_0625977 3300047322 Bacteria 717
593 Ga0495683_0000675 3300047323 Bacteria 25171
594 Ga0495683_0000686 3300047323 Bacteria 24920
595 Ga0495683_0014343 3300047323 Bacteria 4129
596 Ga0495683_0020679 3300047323 Bacteria 3393
597 Ga0495683_0037979 3300047323 Bacteria 2439
598 Ga0495683_0054379 3300047323 Bacteria 1995
599 Ga0495683_0056562 3300047323 Bacteria 1951
600 Ga0495683_0059766 3300047323 Bacteria 1890
601 Ga0495683_0170053 3300047323 Bacteria 1002
602 Ga0495683_0186118 3300047323 Bacteria 945
603 Ga0495683_0199726 3300047323 Bacteria 902
604 Ga0495683_0306781 3300047323 Bacteria 680
605 Ga0495683_0469158 3300047323 Bacteria 514
606 Ga0495687_005180 3300047443 Bacteria 8432
607 Ga0495675_0215042 3300047444 Bacteria 1165
608 Ga0495677_0325716 3300047445 Bacteria 605
609 Ga0495679_002492 3300047446 Bacteria 9343
610 Ga0495679_015478 3300047446 Bacteria 2789
611 Ga0495679_018322 3300047446 Bacteria 2487
612 Ga0495679_052278 3300047446 Bacteria 1222
613 Ga0495679_083014 3300047446 Bacteria 907
614 Ga0495679_084574 3300047446 Bacteria 896
615 Ga0495673_0002498 3300047469 Bacteria 12872
616 Ga0495673_0009330 3300047469 Bacteria 5437
617 Ga0495673_0018088 3300047469 Bacteria 3562
618 Ga0495673_0026193 3300047469 Bacteria 2790
619 Ga0495673_0027354 3300047469 Bacteria 2716
620 Ga0495673_0074143 3300047469 Bacteria 1424
621 Ga0495673_0225199 3300047469 Bacteria 692
622 Ga0495681_0000966 3300047470 Bacteria 21998
623 Ga0495681_0001799 3300047470 Bacteria 15779
624 Ga0495681_0004294 3300047470 Bacteria 9758
625 Ga0495681_0007071 3300047470 Bacteria 7245
626 Ga0495681_0017801 3300047470 Bacteria 3934
627 Ga0495681_0060216 3300047470 Bacteria 1752
628 Ga0495681_0221200 3300047470 Bacteria 759
629 Ga0495681_0248276 3300047470 Bacteria 703
630 Ga0495681_0404612 3300047470 Bacteria 509
631 Ga0495684_0146357 3300047471 Bacteria 1769
632 Ga0495686_0006558 3300047472 Bacteria 8878
633 Ga0495686_0020032 3300047472 Bacteria 4463
634 Ga0495686_0072326 3300047472 Bacteria 2120
635 Ga0495686_0189832 3300047472 Bacteria 1185
636 Ga0495686_0208888 3300047472 Bacteria 1116
637 Ga0495686_0445613 3300047472 Bacteria 688
638 Ga0495593_0051598 3300047673 Bacteria 2176
639 Ga0495593_0078967 3300047673 Bacteria 1703
640 Ga0495593_0090837 3300047673 Bacteria 1573
641 Ga0495593_0218026 3300047673 Bacteria 957
642 Ga0495602_0107582 3300048088 Bacteria 2272
643 Ga0495614_0259853 3300048089 Bacteria 796
644 Ga0495626_0001018 3300048091 Bacteria 24104
645 Ga0495626_0002062 3300048091 Bacteria 14674
646 Ga0495626_0010179 3300048091 Bacteria 5042
647 Ga0495626_0018056 3300048091 Bacteria 3550
648 Ga0495626_0024546 3300048091 Bacteria 2954
649 Ga0495626_0137169 3300048091 Bacteria 1039
650 Ga0495626_0168982 3300048091 Bacteria 912
651 Ga0495626_0296648 3300048091 Bacteria 639
652 Ga0495626_0399528 3300048091 Bacteria 531
653 Ga0496101_0460807 3300048904 Bacteria 1003
654 Ga0496102_0000963 3300048905 Bacteria 27075
655 Ga0496103_0002945 3300048906 Bacteria 10551
656 Ga0496104_0511590 3300048907 Bacteria 1112
657 Ga0496105_0641153 3300048908 Bacteria 821
658 Ga0496106_0352417 3300048909 Bacteria 1182
659 Ga0496107_0491462 3300048910 Bacteria 910
660 Ga0496110_0071726 3300048913 Bacteria 3072
661 Ga0496113_1319088 3300048916 Bacteria 561
662 Ga0496114_0429770 3300048917 Bacteria 1170
663 Ga0496115_0333671 3300048918 Bacteria 1239
664 Ga0496116_0000824 3300048919 Bacteria 39126
665 Ga0496116_0001464 3300048919 Bacteria 26439
666 Ga0496116_0005891 3300048919 Bacteria 11254
667 Ga0496116_0011922 3300048919 Bacteria 7144
668 Ga0496116_0067220 3300048919 Bacteria 2290
669 Ga0496117_0006785 3300048920 Bacteria 11421
670 Ga0496117_0008064 3300048920 Bacteria 10089
671 Ga0496117_0087105 3300048920 Bacteria 2025
672 Ga0496117_0091484 3300048920 Bacteria 1956
673 Ga0496117_0183792 3300048920 Bacteria 1198
674 Ga0496117_0190496 3300048920 Bacteria 1168
675 Ga0496117_0194471 3300048920 Bacteria 1151
676 Ga0496117_0339962 3300048920 Bacteria 779
677 Ga0496117_0368451 3300048920 Bacteria 735
678 Ga0496118_0009042 3300048921 Bacteria 10154
679 Ga0496118_0022925 3300048921 Bacteria 5439
680 Ga0496118_0030037 3300048921 Bacteria 4545
681 Ga0496118_0031218 3300048921 Bacteria 4422
682 Ga0496118_0085582 3300048921 Bacteria 2194
683 Ga0496118_0196630 3300048921 Bacteria 1199
684 Ga0496118_0227027 3300048921 Bacteria 1081
685 Ga0496119_0164257 3300048922 Bacteria 1177
686 Ga0496119_0410488 3300048922 Bacteria 644
687 Ga0496120_0157672 3300048923 Bacteria 1134
688 Ga0496120_0205568 3300048923 Bacteria 950
689 Ga0496120_0243911 3300048923 Bacteria 846
690 Ga0496120_0275099 3300048923 Bacteria 780
691 Ga0496120_0353450 3300048923 Bacteria 659
692 Ga0496121_0009775 3300048924 Bacteria 10963
693 Ga0496121_0029238 3300048924 Bacteria 5103
694 Ga0496121_0037117 3300048924 Bacteria 4331
695 Ga0496121_0066951 3300048924 Bacteria 2913
696 Ga0496121_0089185 3300048924 Bacteria 2415
697 Ga0496121_0410827 3300048924 Bacteria 883
698 Ga0496121_0635784 3300048924 Bacteria 652
699 Ga0496122_0001608 3300048925 Bacteria 35325
700 Ga0496122_0048394 3300048925 Bacteria 3269
701 Ga0496122_0173587 3300048925 Bacteria 1295
702 Ga0496122_0265822 3300048925 Bacteria 948
703 Ga0496122_0333317 3300048925 Bacteria 800
704 Ga0496123_0008778 3300048926 Bacteria 9218
705 Ga0496123_0138023 3300048926 Bacteria 1338
706 Ga0496123_0245112 3300048926 Bacteria 887
707 Ga0496123_0342018 3300048926 Bacteria 699
708 Ga0496124_0003600 3300048927 Bacteria 18825
709 Ga0496124_0015291 3300048927 Bacteria 7365
710 Ga0496124_0130380 3300048927 Bacteria 1998
711 Ga0496124_0141186 3300048927 Bacteria 1900
712 Ga0496124_0395766 3300048927 Bacteria 960
713 Ga0496125_0004482 3300048928 Bacteria 16087
714 Ga0496125_0126332 3300048928 Bacteria 1811
715 Ga0496125_0139962 3300048928 Bacteria 1684
716 Ga0496125_0240892 3300048928 Bacteria 1148
717 Ga0496125_0280507 3300048928 Bacteria 1032
718 Ga0496125_0464184 3300048928 Bacteria 721
719 Ga0496125_0561338 3300048928 Bacteria 630
720 Ga0496126_0044008 3300048929 Bacteria 4114
721 Ga0496126_0438960 3300048929 Bacteria 1052
722 Ga0495678_000992 3300049459 Bacteria 24319
723 Ga0495678_004782 3300049459 Bacteria 7712
724 Ga0495678_007695 3300049459 Bacteria 5554
725 Ga0495678_008128 3300049459 Bacteria 5341
726 Ga0495678_011559 3300049459 Bacteria 4221
727 Ga0495678_029518 3300049459 Bacteria 2301
728 Ga0495678_035982 3300049459 Bacteria 2024
729 Ga0495678_090819 3300049459 Bacteria 1076
730 Ga0495678_095274 3300049459 Bacteria 1040
731 Ga0495678_225492 3300049459 Bacteria 566
732 Ga0495682_0001863 3300049460 Bacteria 10533
733 Ga0495682_0070463 3300049460 Bacteria 1258
734 Ga0495682_0118400 3300049460 Bacteria 948
735 Ga0495682_0120217 3300049460 Bacteria 940
736 Ga0495682_0271138 3300049460 Bacteria 599
737 Ga0501241_000096 3300049758 Bacteria 19209
738 nmdc:mga00v17_380421_c1 3300050491 Bacteria 918
739 Ga0500572_007230 3300053111 Bacteria 2567
740 Ga0500618_005147 3300053125 Bacteria 4023
741 Ga0500586_116210 3300053145 Bacteria 933
742 Ga0500589_289260 3300053147 Bacteria 584
743 Ga0500634_0004624 3300053161 Bacteria 6399
744 2511253680 2511231004 Bacteria 6669789
745 2511272844 2511231007 Bacteria 6306603
746 2511275218 2511231008 Bacteria 6624100
747 2511288453 2511231010 Bacteria 6373152
748 2511293720 2511231011 Bacteria 6149768
749 2511327656 2511231016 Bacteria 6704427
750 2511330641 2511231017 Bacteria 6503007
751 2511364773 2511231022 Bacteria 6719296
752 2511367910 2511231023 Bacteria 6808468
753 2511413002 2511231031 Bacteria 6558529
754 2597861920 2597489888 Bacteria 6179543
755 2597867653 2597489889 Bacteria 6297495
756 2599397462 2599185167 Bacteria 6353609
757 2599449460 2599185179 Bacteria 6611171
758 2599510802 2599185190 Bacteria 6285678
759 2599519708 2599185191 Bacteria 6297582
760 2599883956 2599185288 Bacteria 6666191
761 2599890177 2599185290 Bacteria 6289611
762 2599950334 2599185303 Bacteria 6512725
763 2601801168 2600255318 Bacteria 6383414
764 2606073253 2603880185 Bacteria 6379190
765 2606126137 2603880199 Bacteria 6377649
766 2624482743 2623620443 Bacteria 6427864
767 2624490183 2623620446 Bacteria 6500345
768 2643869282 2643221571 Bacteria 6228673
769 2677898487 2675903420 Bacteria 6247433
770 2715755440 2713897149 Bacteria 6506249
771 2738808708 2738541294 Bacteria 6925949
772 2738896068 2738541309 Bacteria 6926455
773 2739314376 2738543025 Bacteria 6600348
774 2774138489 2773857673 Bacteria 6513460
775 2784262480 2784132063 Bacteria 6262788
776 2808974781 2808606385 Bacteria 6711065
777 2808991580 2808606388 Bacteria 6706662
778 2819654151 2818991456 Bacteria 6123676
779 2834028621 2834028612 Bacteria 6354979
780 2852616010 2852612431 Bacteria 6885235
781 2852662996 2852657418 Bacteria 6472974
782 2852670978 2852667396 Bacteria 6885555
783 2860344615 2860339153 Bacteria 6846989
784 2878034675 2878029506 Bacteria 6418441
785 2880235323 2880230671 Bacteria 6140320
786 2904521697 2904518522 Bacteria 6068986
787 2908447289 2908446538 Bacteria 6829095
788 2919069409 2919063839 Bacteria 6302690
789 2919702247 2919697872 Bacteria 6553725
790 2931391638 2931390751 Bacteria 6273349
791 2931397384 2931396565 Bacteria 7251677
792 2945929909 2945928738 Bacteria 6053221
793 2945961090 2945961074 Bacteria 7342064
794 2946028896 2946027586 Bacteria 6049274
795 2969309490 2969304461 Bacteria 6601805
796 3007617996 3007614139 Bacteria 6053559
797 3007624050 3007619802 Bacteria 6411688
798 3007723448 3007718800 Bacteria 5971527
799 8019780088 8019775933 Bacteria 6858656
800 8054289260 8054285046 Bacteria 6919322
801 8054504228 8054503363 Bacteria 6101651
802 8056150822 8056148874 Bacteria 6479865
803 8056158068 8056155041 Bacteria 6486948
804 8056161575 8056161164 Bacteria 6106669
805 8056179877 8056177738 Bacteria 6748268
806 8056574724 8056569372 Bacteria 5997322
807 Ga0495678_215765
808 MRS2a_Contig_25852
809 JGI24741J21665_1049620
810 Ga0006562J51391_1006713
811 Ga0055525_1007004
812 Ga0055536_1000790
813 Ga0055530_10001612
814 Ga0055540_1000505
815 Ga0055531_10000123
816 Ga0065714_10075709
817 Ga0065714_10240022
818 Ga0065714_10275559
819 Ga0065714_10312226
820 Ga0065704_10366959
821 Ga0065712_10092601
822 Ga0070670_100480426
823 Ga0070669_100000452
824 Ga0070669_100003010
825 Ga0070671_100233225
826 Ga0070659_100447710
827 Ga0070662_100006733
828 Ga0070662_100021712
829 Ga0068853_100001380
830 Ga0070665_100176958
831 Ga0070665_100224375
832 Ga0070665_100782981
833 Ga0070664_100818306
834 Ga0068854_100004527
835 Ga0068851_10000021
836 Ga0075364_10085802
837 Ga0075364_10173764
838 Ga0075364_10201021
839 Ga0075364_10248584
840 Ga0075432_10014432
841 Ga0075432_10047202
842 Ga0075432_10059207
843 Ga0075362_10410785
844 Ga0075370_10917419
845 Ga0075436_100224420
846 Ga0105251_10003422
847 Ga0105251_10006741
848 Ga0105251_10007701
849 Ga0105251_10048243
850 Ga0105251_10061622
851 Ga0105251_10089203
852 Ga0105251_10098250
853 Ga0105251_10183176
854 Ga0105251_10210081
855 Ga0105251_10321312
856 Ga0105244_10008583
857 Ga0105244_10021816
858 Ga0105244_10024121
859 Ga0105244_10058408
860 Ga0105244_10067215
861 Ga0105244_10134070
862 Ga0105244_10143031
863 Ga0105244_10164685
864 Ga0105244_10175750
865 Ga0105244_10279122
866 Ga0105250_10000120
867 Ga0105250_10001686
868 Ga0105250_10010112
869 Ga0105250_10025186
870 Ga0105250_10424421
871 Ga0105240_10921729
872 Ga0105243_10001176
873 Ga0105242_10851667
874 Ga0105248_10044903
875 Ga0105239_12521295
876 Ga0105239_12600188
877 Ga0105246_10003916
878 Ga0105246_10165354
879 Ga0157345_1000042
880 Ga0157373_10005127
881 Ga0157373_10037579
882 Ga0157373_10259317
883 Ga0157373_10435287
884 Ga0157373_10652048
885 Ga0157373_10832782
886 Ga0157373_10888430
887 Ga0157370_10048778
888 Ga0157370_11150527
889 Ga0157370_11155409
890 Ga0157370_11577072
891 Ga0157369_10004354
892 Ga0157369_10038595
893 Ga0157369_10476632
894 Ga0163162_10001021
895 Ga0163162_10250382
896 Ga0163162_10981054
897 Ga0163162_11648577
898 Ga0157372_10006828
899 Ga0157375_10689520
900 Ga0157375_10731159
901 Ga0182008_10004169
902 Ga0182008_10007900
903 Ga0182008_10019141
904 Ga0182008_10039914
905 Ga0182008_10155738
906 Ga0182006_1000508
907 Ga0182006_1001937
908 Ga0182006_1028612
909 Ga0182006_1058617
910 Ga0182006_1202151
911 Ga0182007_10001676
912 Ga0182007_10065383
913 Ga0182005_1001052
914 Ga0182005_1039955
915 Ga0182005_1041280
916 Ga0182005_1088592
917 Ga0163161_10037661
918 Ga0163161_10058107
919 Ga0163161_10220175
920 Ga0163161_10542554
921 Ga0163161_10702179
922 Ga0163161_10714808
923 Ga0163161_10772931
924 Ga0163161_10849413
925 Ga0163161_10869568
926 Ga0209563_100838
927 Ga0209675_1015408
928 Ga0209676_1000010
929 Ga0209050_1000866
930 Ga0209051_1000631
931 Ga0209257_1000357
932 Ga0207656_10000020
933 Ga0207696_1000052
934 Ga0207696_1000738
935 Ga0207696_1001510
936 Ga0207696_1016498
937 Ga0207655_1000723
938 Ga0207655_1001045
939 Ga0207655_1003748
940 Ga0207655_1006098
941 Ga0207655_1018817
942 Ga0207655_1020318
943 Ga0207655_1050309
944 Ga0207655_1055613
945 Ga0207655_1122133
946 Ga0207655_1180284
947 Ga0207713_1000990
948 Ga0207713_1001083
949 Ga0207713_1002401
950 Ga0207713_1006100
951 Ga0207713_1007286
952 Ga0207713_1013157
953 Ga0207713_1043489
954 Ga0207713_1048386
955 Ga0207713_1055790
956 Ga0207671_10964949
957 Ga0207681_10000119
958 Ga0207681_10010462
959 Ga0207650_10000225
960 Ga0207690_10232654
961 Ga0207706_10000855
962 Ga0207706_10011726
963 Ga0207686_10811299
964 Ga0207709_10000189
965 Ga0207711_10025554
966 Ga0207679_10282879
967 Ga0207639_10001210
968 Ga0207428_10042657
969 Ga0207428_10117365
970 Ga0207428_10351075
971 Ga0268266_10043510
972 Ga0268266_10369118
973 Ga0268266_11393891
974 Ga0307511_10028914
975 Ga0307511_10380965
976 Ga0265316_10917445
977 Ga0307408_100005853
978 Ga0307405_10005315
979 Ga0307405_12163402
980 Ga0307412_10030472
981 Ga0307412_10105526
982 Ga0307412_11234874
983 Ga0307414_11482321
984 Ga0307510_10000760
985 Ga0439438_013914
986 Ga0439438_031150
987 Ga0439438_133771
988 Ga0439447_000164
989 Ga0439447_006486
990 Ga0439447_014144
991 Ga0439447_023228
992 Ga0439447_042050
993 Ga0439466_0010082
994 Ga0439466_0011032
995 Ga0439466_0013456
996 Ga0439466_0021779
997 Ga0439466_0099843
998 Ga0439465_0015620
999 Ga0451853_3596406
1000 Ga0439432_000107
1001 Ga0439432_017184
1002 Ga0439432_017202
1003 Ga0439432_058894
1004 Ga0439451_001663
1005 Ga0439451_002456
1006 Ga0439452_003943
1007 Ga0439456_001367
1008 Ga0439456_036059
1009 Ga0439463_001373
1010 Ga0439463_094381
1011 Ga0450911_002116
1012 Ga0450919_002151
1013 Ga0450922_000522
1014 Ga0450890_001081
1015 Ga0450897_010015
1016 Ga0450898_024289
1017 Ga0450899_006221
1018 Ga0450902_001401
1019 Ga0450902_003072
1020 Ga0450902_016067
1021 Ga0450902_021010
1022 Ga0450903_001769
1023 Ga0450903_005466
1024 Ga0450903_017010
1025 Ga0450903_020176
1026 Ga0450904_006536
1027 Ga0450905_009643
1028 Ga0450889_007563
1029 Ga0450889_020365
1030 Ga0450906_001413
1031 Ga0450907_005336
1032 Ga0450907_027448
1033 Ga0450910_010755
1034 Ga0439446_0011066
1035 Ga0439446_0201854
1036 Ga0450908_000513
1037 Ga0450909_001050
1038 Ga0450909_036372
1039 Ga0439464_0005632
1040 Ga0439460_0000049
1041 Ga0439460_0143771
1042 Ga0450893_0033661
1043 Ga0450893_0034330
1044 Ga0439440_0000884
1045 Ga0495617_009005
1046 Ga0495617_037387
1047 Ga0495617_048905
1048 Ga0495617_074581
1049 Ga0495617_089933
1050 Ga0495617_130215
1051 Ga0495617_203474
1052 Ga0495617_232056
1053 Ga0495617_235007
1054 Ga0495627_000107
1055 Ga0495627_000829
1056 Ga0495627_007613
1057 Ga0495627_010413
1058 Ga0495627_018570
1059 Ga0495627_056313
1060 Ga0495627_181750
1061 Ga0495592_0333302
1062 Ga0495603_0051155
1063 Ga0495590_0006886
1064 Ga0495590_0007585
1065 Ga0495590_0033652
1066 Ga0495591_000610
1067 Ga0495591_002278
1068 Ga0495591_015801
1069 Ga0495591_020098
1070 Ga0495591_022985
1071 Ga0495591_049407
1072 Ga0495591_053432
1073 Ga0495591_056291
1074 Ga0495591_078170
1075 Ga0495591_114532
1076 Ga0495638_0002621
1077 Ga0495638_0028621
1078 Ga0495638_0068625
1079 Ga0495638_0082730
1080 Ga0495638_0101578
1081 Ga0495638_0101647
1082 Ga0495638_0167019
1083 Ga0495638_0188496
1084 Ga0495638_0292582
1085 Ga0495638_0303825
1086 Ga0495653_0002213
1087 Ga0495653_0007596
1088 Ga0495653_0041578
1089 Ga0495653_0091678
1090 Ga0495653_0524779
1091 Ga0495653_0622360
1092 Ga0495650_0012094
1093 Ga0495650_0043915
1094 Ga0495650_0124200
1095 Ga0495650_0134377
1096 Ga0495650_0164611
1097 Ga0495580_0484298
1098 Ga0495580_0569379
1099 Ga0495605_0004348
1100 Ga0495605_0022295
1101 Ga0495605_0046618
1102 Ga0495605_0060483
1103 Ga0495605_0114337
1104 Ga0495605_0161565
1105 Ga0495605_0164025
1106 Ga0495605_0342027
1107 Ga0495605_0421905
1108 Ga0495639_0000086
1109 Ga0495639_0406468
1110 Ga0495584_0001054
1111 Ga0495584_0005175
1112 Ga0495584_0029964
1113 Ga0495584_0048510
1114 Ga0495584_0048611
1115 Ga0495584_0057408
1116 Ga0495584_0129427
1117 Ga0495584_0174215
1118 Ga0495584_0234726
1119 Ga0495584_0239643
1120 Ga0495584_0507434
1121 Ga0495584_0603789
1122 Ga0495585_0001257
1123 Ga0495585_0007697
1124 Ga0495585_0008998
1125 Ga0495585_0014307
1126 Ga0495585_0027209
1127 Ga0495585_0091429
1128 Ga0495585_0162617
1129 Ga0495585_0168756
1130 Ga0495585_0369256
1131 Ga0495585_0512011
1132 Ga0495594_0068459
1133 Ga0495596_0124501
1134 Ga0495607_0002285
1135 Ga0495607_0004396
1136 Ga0495607_0005337
1137 Ga0495607_0005402
1138 Ga0495607_0005785
1139 Ga0495607_0021044
1140 Ga0495607_0029053
1141 Ga0495607_0056174
1142 Ga0495607_0141108
1143 Ga0495607_0150145
1144 Ga0495607_0160575
1145 Ga0495607_0236599
1146 Ga0495607_0292865
1147 Ga0495607_0362065
1148 Ga0495607_0378183
1149 Ga0495607_0384473
1150 Ga0495607_0530072
1151 Ga0495583_0007462
1152 Ga0495583_0079717
1153 Ga0495606_0008144
1154 Ga0495606_0020157
1155 Ga0495606_0020581
1156 Ga0495606_0026182
1157 Ga0495606_0027986
1158 Ga0495606_0033274
1159 Ga0495606_0073674
1160 Ga0495606_0091786
1161 Ga0495606_0115936
1162 Ga0495606_0211437
1163 Ga0495606_0298636
1164 Ga0495606_0327220
1165 Ga0495606_0384407
1166 Ga0495610_0001135
1167 Ga0495610_0003376
1168 Ga0495610_0012495
1169 Ga0495610_0016281
1170 Ga0495610_0016514
1171 Ga0495610_0021065
1172 Ga0495610_0033551
1173 Ga0495610_0039596
1174 Ga0495610_0100252
1175 Ga0495610_0154553
1176 Ga0495610_0290675
1177 Ga0495616_0005357
1178 Ga0495616_0005657
1179 Ga0495616_0014718
1180 Ga0495616_0039866
1181 Ga0495616_0041096
1182 Ga0495616_0061951
1183 Ga0495616_0121807
1184 Ga0495616_0236193
1185 Ga0495620_0000808
1186 Ga0495620_0027393
1187 Ga0495620_0032507
1188 Ga0495620_0047520
1189 Ga0495620_0231838
1190 Ga0495628_0168861
1191 Ga0495630_0128311
1192 Ga0495631_0000250
1193 Ga0495631_0000276
1194 Ga0495631_0002243
1195 Ga0495631_0025882
1196 Ga0495631_0102813
1197 Ga0495631_0111839
1198 Ga0495631_0163304
1199 Ga0495632_0001128
1200 Ga0495632_0007671
1201 Ga0495632_0016512
1202 Ga0495632_0016832
1203 Ga0495632_0020061
1204 Ga0495632_0026676
1205 Ga0495632_0032985
1206 Ga0495632_0035979
1207 Ga0495632_0133242
1208 Ga0495632_0133970
1209 Ga0495632_0182340
1210 Ga0495637_0000424
1211 Ga0495637_0001077
1212 Ga0495637_0001331
1213 Ga0495637_0001707
1214 Ga0495637_0004875
1215 Ga0495637_0014590
1216 Ga0495637_0020988
1217 Ga0495637_0030244
1218 Ga0495637_0033634
1219 Ga0495637_0035686
1220 Ga0495637_0036357
1221 Ga0495637_0047524
1222 Ga0495637_0092689
1223 Ga0495637_0268797
1224 Ga0495643_0004491
1225 Ga0495643_0022829
1226 Ga0495643_0053268
1227 Ga0495643_0086047
1228 Ga0495643_0193935
1229 Ga0495643_0205655
1230 Ga0495643_0536439
1231 Ga0495644_0000223
1232 Ga0495644_0001517
1233 Ga0495644_0025425
1234 Ga0495644_0210499
1235 Ga0495648_0031384
1236 Ga0495648_0034873
1237 Ga0495648_0151874
1238 Ga0495648_0183731
1239 Ga0495648_0211381
1240 Ga0495648_0477640
1241 Ga0495648_0496131
1242 Ga0495666_0136325
1243 Ga0495666_0165166
1244 Ga0495666_0264668
1245 Ga0495652_0469752
1246 Ga0495654_0000137
1247 Ga0495654_0000702
1248 Ga0495654_0001756
1249 Ga0495654_0001984
1250 Ga0495654_0002874
1251 Ga0495654_0006574
1252 Ga0495654_0017627
1253 Ga0495654_0066898
1254 Ga0495654_0078117
1255 Ga0495654_0125423
1256 Ga0495654_0126028
1257 Ga0495654_0152622
1258 Ga0495654_0167663
1259 Ga0495654_0246112
1260 Ga0495654_0268292
1261 Ga0495654_0435259
1262 Ga0495587_0024842
1263 Ga0495587_0400769
1264 Ga0495609_0005190
1265 Ga0495609_0123817
1266 Ga0495609_0144116
1267 Ga0495609_0195302
1268 Ga0495597_0002668
1269 Ga0495597_0022891
1270 Ga0495597_0026804
1271 Ga0495597_0043299
1272 Ga0495597_0103375
1273 Ga0495597_0142584
1274 Ga0495597_0153746
1275 Ga0495597_0192568
1276 Ga0495645_0471088
1277 Ga0495622_0000225
1278 Ga0495622_0000482
1279 Ga0495622_0530092
1280 Ga0495633_0042610
1281 Ga0495633_0092960
1282 Ga0495656_0053907
1283 Ga0495656_0498348
1284 Ga0495668_0004667
1285 Ga0495634_0001331
1286 Ga0495634_0240611
1287 Ga0495611_0000286
1288 Ga0495611_0164639
1289 Ga0495611_0172298
1290 Ga0495611_0456080
1291 Ga0495611_0513826
1292 Ga0495625_0004277
1293 Ga0495625_0004376
1294 Ga0495625_0005240
1295 Ga0495625_0043158
1296 Ga0495625_0126733
1297 Ga0495625_0335587
1298 Ga0495625_0476914
1299 Ga0495625_0508580
1300 Ga0495625_0544727
1301 Ga0495625_0705576
1302 Ga0495625_0769650
1303 Ga0495625_0850858
1304 Ga0495635_0012749
1305 Ga0495659_0000110
1306 Ga0495659_0001576
1307 Ga0495661_0000575
1308 Ga0495661_0005029
1309 Ga0495661_0010957
1310 Ga0495661_0027806
1311 Ga0495661_0043715
1312 Ga0495661_0071638
1313 Ga0495661_0076772
1314 Ga0495661_0165290
1315 Ga0495661_0503309
1316 Ga0495661_0551326
1317 Ga0495623_0039669
1318 Ga0495646_0048365
1319 Ga0495646_0259173
1320 Ga0495646_0302648
1321 Ga0495669_0416525
1322 Ga0495613_0102116
1323 Ga0495613_0115248
1324 Ga0495613_0480537
1325 Ga0495624_0069379
1326 Ga0495670_0000889
1327 Ga0495670_0001208
1328 Ga0495670_0001590
1329 Ga0495670_0138749
1330 Ga0495670_0236420
1331 Ga0495670_0372873
1332 Ga0495670_0491348
1333 Ga0495670_0797440
1334 Ga0495671_0001223
1335 Ga0495671_0007222
1336 Ga0495671_0063793
1337 Ga0495671_0073457
1338 Ga0495671_0129516
1339 Ga0495671_0139930
1340 Ga0495671_0153282
1341 Ga0495671_0162126
1342 Ga0495671_0241039
1343 Ga0495671_0621529
1344 Ga0495671_0646821
1345 Ga0495649_0001059
1346 Ga0495649_0024331
1347 Ga0495649_0027004
1348 Ga0495649_0037588
1349 Ga0495649_0045439
1350 Ga0495649_0048301
1351 Ga0495649_0049008
1352 Ga0495649_0065793
1353 Ga0495649_0152480
1354 Ga0495649_0189622
1355 Ga0495649_0191486
1356 Ga0495649_0213841
1357 Ga0495649_0336203
1358 Ga0495649_0576014
1359 Ga0495589_0000667
1360 Ga0495589_0008464
1361 Ga0495589_0031454
1362 Ga0495589_0096754
1363 Ga0495589_0241521
1364 Ga0495589_0295406
1365 Ga0495589_0319762
1366 Ga0495600_0132456
1367 Ga0495660_0003097
1368 Ga0495660_0007035
1369 Ga0495660_0023919
1370 Ga0495660_0053801
1371 Ga0495660_0057835
1372 Ga0495660_0062523
1373 Ga0495660_0063183
1374 Ga0495660_0090130
1375 Ga0495660_0141652
1376 Ga0495660_0162198
1377 Ga0495660_0206851
1378 Ga0495660_0309170
1379 Ga0495660_0413634
1380 Ga0495581_0034121
1381 Ga0495604_0006964
1382 Ga0495604_0055222
1383 Ga0495672_0001938
1384 Ga0495672_0002030
1385 Ga0495672_0002566
1386 Ga0495672_0003500
1387 Ga0495672_0004290
1388 Ga0495672_0011806
1389 Ga0495672_0024807
1390 Ga0495672_0306926
1391 Ga0495672_0381998
1392 Ga0495672_0395000
1393 Ga0495676_0004850
1394 Ga0495676_0005794
1395 Ga0495676_0322992
1396 Ga0495680_0008909
1397 Ga0495680_0097803
1398 Ga0495680_0625977
1399 Ga0495683_0000675
1400 Ga0495683_0000686
1401 Ga0495683_0014343
1402 Ga0495683_0020679
1403 Ga0495683_0037979
1404 Ga0495683_0054379
1405 Ga0495683_0056562
1406 Ga0495683_0059766
1407 Ga0495683_0170053
1408 Ga0495683_0186118
1409 Ga0495683_0199726
1410 Ga0495683_0306781
1411 Ga0495683_0469158
1412 Ga0495687_005180
1413 Ga0495675_0215042
1414 Ga0495677_0325716
1415 Ga0495679_002492
1416 Ga0495679_015478
1417 Ga0495679_018322
1418 Ga0495679_052278
1419 Ga0495679_083014
1420 Ga0495679_084574
1421 Ga0495673_0002498
1422 Ga0495673_0009330
1423 Ga0495673_0018088
1424 Ga0495673_0026193
1425 Ga0495673_0027354
1426 Ga0495673_0074143
1427 Ga0495673_0225199
1428 Ga0495681_0000966
1429 Ga0495681_0001799
1430 Ga0495681_0004294
1431 Ga0495681_0007071
1432 Ga0495681_0017801
1433 Ga0495681_0060216
1434 Ga0495681_0221200
1435 Ga0495681_0248276
1436 Ga0495681_0404612
1437 Ga0495684_0146357
1438 Ga0495686_0006558
1439 Ga0495686_0020032
1440 Ga0495686_0072326
1441 Ga0495686_0189832
1442 Ga0495686_0208888
1443 Ga0495686_0445613
1444 Ga0495593_0051598
1445 Ga0495593_0078967
1446 Ga0495593_0090837
1447 Ga0495593_0218026
1448 Ga0495602_0107582
1449 Ga0495614_0259853
1450 Ga0495626_0001018
1451 Ga0495626_0002062
1452 Ga0495626_0010179
1453 Ga0495626_0018056
1454 Ga0495626_0024546
1455 Ga0495626_0137169
1456 Ga0495626_0168982
1457 Ga0495626_0296648
1458 Ga0495626_0399528
1459 Ga0496101_0460807
1460 Ga0496102_0000963
1461 Ga0496103_0002945
1462 Ga0496104_0511590
1463 Ga0496105_0641153
1464 Ga0496106_0352417
1465 Ga0496107_0491462
1466 Ga0496110_0071726
1467 Ga0496113_1319088
1468 Ga0496114_0429770
1469 Ga0496115_0333671
1470 Ga0496116_0000824
1471 Ga0496116_0001464
1472 Ga0496116_0005891
1473 Ga0496116_0011922
1474 Ga0496116_0067220
1475 Ga0496117_0006785
1476 Ga0496117_0008064
1477 Ga0496117_0087105
1478 Ga0496117_0091484
1479 Ga0496117_0183792
1480 Ga0496117_0190496
1481 Ga0496117_0194471
1482 Ga0496117_0339962
1483 Ga0496117_0368451
1484 Ga0496118_0009042
1485 Ga0496118_0022925
1486 Ga0496118_0030037
1487 Ga0496118_0031218
1488 Ga0496118_0085582
1489 Ga0496118_0196630
1490 Ga0496118_0227027
1491 Ga0496119_0164257
1492 Ga0496119_0410488
1493 Ga0496120_0157672
1494 Ga0496120_0205568
1495 Ga0496120_0243911
1496 Ga0496120_0275099
1497 Ga0496120_0353450
1498 Ga0496121_0009775
1499 Ga0496121_0029238
1500 Ga0496121_0037117
1501 Ga0496121_0066951
1502 Ga0496121_0089185
1503 Ga0496121_0410827
1504 Ga0496121_0635784
1505 Ga0496122_0001608
1506 Ga0496122_0048394
1507 Ga0496122_0173587
1508 Ga0496122_0265822
1509 Ga0496122_0333317
1510 Ga0496123_0008778
1511 Ga0496123_0138023
1512 Ga0496123_0245112
1513 Ga0496123_0342018
1514 Ga0496124_0003600
1515 Ga0496124_0015291
1516 Ga0496124_0130380
1517 Ga0496124_0141186
1518 Ga0496124_0395766
1519 Ga0496125_0004482
1520 Ga0496125_0126332
1521 Ga0496125_0139962
1522 Ga0496125_0240892
1523 Ga0496125_0280507
1524 Ga0496125_0464184
1525 Ga0496125_0561338
1526 Ga0496126_0044008
1527 Ga0496126_0438960
1528 Ga0495678_000992
1529 Ga0495678_004782
1530 Ga0495678_007695
1531 Ga0495678_008128
1532 Ga0495678_011559
1533 Ga0495678_029518
1534 Ga0495678_035982
1535 Ga0495678_090819
1536 Ga0495678_095274
1537 Ga0495678_225492
1538 Ga0495682_0001863
1539 Ga0495682_0070463
1540 Ga0495682_0118400
1541 Ga0495682_0120217
1542 Ga0495682_0271138
1543 Ga0501241_000096
1544 nmdc:mga00v17_380421_c1
1545 Ga0500572_007230
1546 Ga0500618_005147
1547 Ga0500586_116210
1548 Ga0500589_289260
1549 Ga0500634_0004624
1550 2511253680
1551 2511272844
1552 2511275218
1553 2511288453
1554 2511293720
1555 2511327656
1556 2511330641
1557 2511364773
1558 2511367910
1559 2511413002
1560 2597861920
1561 2597867653
1562 2599397462
1563 2599449460
1564 2599510802
1565 2599519708
1566 2599883956
1567 2599890177
1568 2599950334
1569 2601801168
1570 2606073253
1571 2606126137
1572 2624482743
1573 2624490183
1574 2643869282
1575 2677898487
1576 2715755440
1577 2738808708
1578 2738896068
1579 2739314376
1580 2774138489
1581 2784262480
1582 2808974781
1583 2808991580
1584 2819654151
1585 2834028621
1586 2852616010
1587 2852662996
1588 2852670978
1589 2860344615
1590 2878034675
1591 2880235323
1592 2904521697
1593 2908447289
1594 2919069409
1595 2919702247
1596 2931391638
1597 2931397384
1598 2945929909
1599 2945961090
1600 2946028896
1601 2969309490
1602 3007617996
1603 3007624050
1604 3007723448
1605 8019780088
1606 8054289260
1607 8054504228
1608 8056150822
1609 8056158068
1610 8056161575
1611 8056179877
1612 8056574724

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map