F481517

General Info

Members Datasets Scaffolds Average Seq Length
803 268 1606 167

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_0554196|Ga0436363_0554196_1198_1713
Length 164
Sequence MTTTTTVARELHIVGFQIGRETYGVPITSLHEIVRVPEITAVPDAPDYMEGVINLRGKIVSVIDLRKRLGEKKRILVVEHNGRLSGLIVDSASEVLKIPVSDVEASPTSLDQGGTQCVTGLGKYKGRLIVLLDMKKLLDLGVPQKSSADGLPGPAASRRATAAK

Samples

Sample ID Description Type Environment
1 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
117 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
118 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
119 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
120 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
188 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
189 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
190 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
191 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
192 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
193 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
194 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
195 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
196 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
198 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
199 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
200 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
201 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
205 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
210 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
211 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
212 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
213 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
214 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
215 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
216 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
217 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
218 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
219 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
220 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
221 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
224 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
225 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
226 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
227 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
228 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
229 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
230 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
231 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
232 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
233 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
234 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
235 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
236 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
237 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
238 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
239 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
240 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
241 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
242 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
243 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
244 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
245 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
246 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
250 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
251 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
254 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
255 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
256 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
257 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
265 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
266 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
267 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.23
Rhizosphere 92.65
Stem 0
Stem Tuber 0
Unclassified 16.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436363_0554196 3300039450 Bacteria 2093
2 MBSR1b_contig_10426571 2162886012 Bacteria 1221
3 JGI24034J26672_10001072 3300002239 Bacteria 3578
4 Ga0065715_10103892 3300005293 Bacteria 3001
5 Ga0065715_10190304 3300005293 Bacteria 1419
6 Ga0070658_10050304 3300005327 Bacteria 3378
7 Ga0070676_10002790 3300005328 Bacteria 9022
8 Ga0070676_10005656 3300005328 Bacteria 6654
9 Ga0070676_11434346 3300005328 Unclassified 530
10 Ga0070683_100008507 3300005329 Bacteria 8718
11 Ga0070683_100025272 3300005329 Bacteria 5331
12 Ga0070683_100039096 3300005329 Bacteria 4353
13 Ga0070683_100272440 3300005329 Bacteria 1610
14 Ga0070690_100003796 3300005330 Bacteria 8322
15 Ga0070690_100095593 3300005330 Bacteria 1962
16 Ga0070670_100001437 3300005331 Bacteria 19162
17 Ga0070670_100014317 3300005331 Bacteria 6805
18 Ga0068869_100017954 3300005334 Bacteria 4808
19 Ga0068869_100038262 3300005334 Bacteria 3418
20 Ga0068869_100122907 3300005334 Bacteria 1987
21 Ga0070666_10029765 3300005335 Bacteria 3592
22 Ga0070666_10098987 3300005335 Bacteria 2008
23 Ga0070666_10103399 3300005335 Bacteria 1965
24 Ga0070682_100014488 3300005337 Bacteria 4558
25 Ga0068868_100003000 3300005338 Bacteria 11731
26 Ga0068868_100011189 3300005338 Bacteria 6533
27 Ga0068868_100013508 3300005338 Bacteria 5988
28 Ga0068868_100018954 3300005338 Bacteria 5150
29 Ga0068868_100042253 3300005338 Bacteria 3556
30 Ga0068868_100302390 3300005338 Bacteria 1359
31 Ga0068868_101241473 3300005338 Unclassified 690
32 Ga0070660_100025702 3300005339 Bacteria 4378
33 Ga0070660_100045003 3300005339 Bacteria 3377
34 Ga0070689_100060534 3300005340 Bacteria 2944
35 Ga0070689_100188875 3300005340 Bacteria 1677
36 Ga0070691_10155261 3300005341 Bacteria 1176
37 Ga0070687_100011158 3300005343 Bacteria 3919
38 Ga0070687_100045842 3300005343 Bacteria 2235
39 Ga0070661_100031750 3300005344 Bacteria 3820
40 Ga0070661_100046715 3300005344 Bacteria 3168
41 Ga0070661_100110884 3300005344 Bacteria 2049
42 Ga0070661_100427033 3300005344 Bacteria 1051
43 Ga0070668_100009738 3300005347 Bacteria 7125
44 Ga0070668_100025830 3300005347 Bacteria 4454
45 Ga0070669_100018549 3300005353 Bacteria 4971
46 Ga0070669_100043880 3300005353 Bacteria 3258
47 Ga0070675_100128770 3300005354 Unclassified 2155
48 Ga0070675_100574157 3300005354 Bacteria 1021
49 Ga0070671_100077440 3300005355 Bacteria 2779
50 Ga0070671_100589563 3300005355 Unclassified 960
51 Ga0070673_100089102 3300005364 Bacteria 2518
52 Ga0070688_100033125 3300005365 Bacteria 3122
53 Ga0070659_100005924 3300005366 Bacteria 8812
54 Ga0070659_100014233 3300005366 Bacteria 5939
55 Ga0070659_100235120 3300005366 Bacteria 1515
56 Ga0070667_100036765 3300005367 Bacteria 4106
57 Ga0070709_10018335 3300005434 Bacteria 4029
58 Ga0070709_10047289 3300005434 Bacteria 2680
59 Ga0070709_10122274 3300005434 Bacteria 1766
60 Ga0070714_100038017 3300005435 Bacteria 4048
61 Ga0070714_100105482 3300005435 Bacteria 2488
62 Ga0070714_100217645 3300005435 Bacteria 1754
63 Ga0070714_100253939 3300005435 Bacteria 1626
64 Ga0070714_100304673 3300005435 Bacteria 1486
65 Ga0070714_100318874 3300005435 Bacteria 1453
66 Ga0070714_100428873 3300005435 Bacteria 1253
67 Ga0070714_100437695 3300005435 Unclassified 1240
68 Ga0070714_101075135 3300005435 Unclassified 784
69 Ga0070713_100001296 3300005436 Bacteria 16002
70 Ga0070713_100014580 3300005436 Bacteria 5844
71 Ga0070713_100038892 3300005436 Bacteria 3858
72 Ga0070713_100040670 3300005436 Bacteria 3781
73 Ga0070713_100050574 3300005436 Bacteria 3434
74 Ga0070713_100088593 3300005436 Bacteria 2656
75 Ga0070713_100370301 3300005436 Bacteria 1333
76 Ga0070713_100536262 3300005436 Unclassified 1107
77 Ga0070713_100640458 3300005436 Unclassified 1012
78 Ga0070713_100668751 3300005436 Bacteria 990
79 Ga0070713_101756764 3300005436 Unclassified 602
80 Ga0070710_10035996 3300005437 Bacteria 2703
81 Ga0070710_10488198 3300005437 Unclassified 841
82 Ga0070701_10137112 3300005438 Unclassified 1395
83 Ga0070711_100009364 3300005439 Bacteria 6031
84 Ga0070711_100072867 3300005439 Bacteria 2424
85 Ga0070711_100159456 3300005439 Bacteria 1709
86 Ga0070711_100217029 3300005439 Bacteria 1484
87 Ga0070711_100398260 3300005439 Unclassified 1117
88 Ga0070711_100548286 3300005439 Unclassified 959
89 Ga0070705_100113968 3300005440 Bacteria 1733
90 Ga0070694_100480012 3300005444 Bacteria 986
91 Ga0070708_100000418 3300005445 Bacteria 31903
92 Ga0070708_100001358 3300005445 Bacteria 18662
93 Ga0070708_100010584 3300005445 Bacteria 7480
94 Ga0070708_100016739 3300005445 Bacteria 6092
95 Ga0070708_100070981 3300005445 Bacteria 3134
96 Ga0070708_100089495 3300005445 Unclassified 2801
97 Ga0070708_100374642 3300005445 Unclassified 1342
98 Ga0070663_100022739 3300005455 Bacteria 4195
99 Ga0070663_100055535 3300005455 Bacteria 2835
100 Ga0070678_100086021 3300005456 Bacteria 2397
101 Ga0070662_100018812 3300005457 Bacteria 4679
102 Ga0070662_100028395 3300005457 Bacteria 3892
103 Ga0070662_100197554 3300005457 Bacteria 1594
104 Ga0070681_10000055 3300005458 Bacteria 80179
105 Ga0070681_10011019 3300005458 Bacteria 8937
106 Ga0070681_10042775 3300005458 Bacteria 4539
107 Ga0068867_100009324 3300005459 Bacteria 6926
108 Ga0068867_100358162 3300005459 Bacteria 1219
109 Ga0068867_101032252 3300005459 Unclassified 747
110 Ga0070685_10005938 3300005466 Bacteria 6213
111 Ga0070685_10104295 3300005466 Bacteria 1736
112 Ga0070706_100000173 3300005467 Bacteria 81500
113 Ga0070706_100001295 3300005467 Bacteria 26667
114 Ga0070707_100000719 3300005468 Bacteria 33081
115 Ga0070707_100031701 3300005468 Bacteria 5036
116 Ga0070707_100036828 3300005468 Bacteria 4670
117 Ga0070707_100170640 3300005468 Bacteria 2120
118 Ga0070707_100351400 3300005468 Bacteria 1432
119 Ga0070707_100553558 3300005468 Bacteria 1112
120 Ga0070707_100572293 3300005468 Bacteria 1092
121 Ga0070698_100000162 3300005471 Bacteria 61345
122 Ga0070698_100105353 3300005471 Bacteria 2790
123 Ga0070699_100002540 3300005518 Bacteria 16392
124 Ga0070699_100004218 3300005518 Bacteria 12713
125 Ga0070699_100030838 3300005518 Bacteria 4629
126 Ga0070679_100149618 3300005530 Bacteria 2312
127 Ga0070679_100500982 3300005530 Bacteria 1158
128 Ga0070679_100767231 3300005530 Unclassified 907
129 Ga0070679_101520268 3300005530 Unclassified 616
130 Ga0070684_100006304 3300005535 Bacteria 9166
131 Ga0070684_100117641 3300005535 Bacteria 2388
132 Ga0070684_100122109 3300005535 Bacteria 2344
133 Ga0070697_100000872 3300005536 Bacteria 22677
134 Ga0070697_100001177 3300005536 Bacteria 19808
135 Ga0070697_100001505 3300005536 Bacteria 17701
136 Ga0070697_100004369 3300005536 Bacteria 10845
137 Ga0070697_100122896 3300005536 Bacteria 2172
138 Ga0070697_100263377 3300005536 Unclassified 1476
139 Ga0070697_100718373 3300005536 Bacteria 882
140 Ga0068853_100024159 3300005539 Bacteria 5094
141 Ga0068853_100060553 3300005539 Unclassified 3271
142 Ga0068853_100189928 3300005539 Bacteria 1866
143 Ga0068853_100216302 3300005539 Bacteria 1748
144 Ga0068853_100508166 3300005539 Bacteria 1138
145 Ga0068853_101203358 3300005539 Unclassified 731
146 Ga0070672_100025283 3300005543 Bacteria 4401
147 Ga0070686_100018375 3300005544 Bacteria 4102
148 Ga0070686_100019750 3300005544 Bacteria 3976
149 Ga0070695_100151969 3300005545 Bacteria 1617
150 Ga0070695_100166683 3300005545 Bacteria 1551
151 Ga0070696_100742795 3300005546 Unclassified 803
152 Ga0070693_100014551 3300005547 Bacteria 4034
153 Ga0070693_100328181 3300005547 Bacteria 1040
154 Ga0070704_100855257 3300005549 Bacteria 816
155 Ga0068855_100005054 3300005563 Bacteria 16100
156 Ga0068855_100013834 3300005563 Bacteria 9730
157 Ga0068855_100024439 3300005563 Bacteria 7229
158 Ga0068855_100152588 3300005563 Bacteria 2626
159 Ga0070664_100001796 3300005564 Bacteria 17205
160 Ga0070664_100012980 3300005564 Bacteria 6778
161 Ga0070664_100023619 3300005564 Bacteria 5079
162 Ga0070664_100037976 3300005564 Bacteria 4051
163 Ga0068857_100000041 3300005577 Bacteria 70173
164 Ga0068857_100002662 3300005577 Bacteria 14661
165 Ga0068857_100438763 3300005577 Bacteria 1219
166 Ga0068854_100007188 3300005578 Bacteria 7111
167 Ga0068854_100013355 3300005578 Bacteria 5387
168 Ga0068854_100051906 3300005578 Bacteria 2939
169 Ga0068854_100067646 3300005578 Bacteria 2603
170 Ga0068854_100076758 3300005578 Unclassified 2456
171 Ga0068854_100165874 3300005578 Bacteria 1715
172 Ga0068854_100478714 3300005578 Unclassified 1045
173 Ga0068856_100000355 3300005614 Bacteria 49986
174 Ga0068856_100001245 3300005614 Bacteria 26739
175 Ga0068856_100001397 3300005614 Bacteria 25289
176 Ga0068856_100004843 3300005614 Bacteria 13344
177 Ga0068856_100078529 3300005614 Unclassified 3272
178 Ga0068856_100199529 3300005614 Bacteria 2015
179 Ga0068856_100289124 3300005614 Bacteria 1656
180 Ga0068856_100391152 3300005614 Bacteria 1410
181 Ga0068856_100414650 3300005614 Bacteria 1367
182 Ga0068856_100432434 3300005614 Bacteria 1336
183 Ga0068856_100625693 3300005614 Unclassified 1097
184 Ga0070702_100004820 3300005615 Bacteria 6201
185 Ga0070702_100047211 3300005615 Bacteria 2445
186 Ga0068852_100027680 3300005616 Bacteria 4624
187 Ga0068852_100066133 3300005616 Bacteria 3156
188 Ga0068852_100199069 3300005616 Bacteria 1895
189 Ga0068859_100002075 3300005617 Bacteria 20448
190 Ga0068859_100030694 3300005617 Bacteria 5393
191 Ga0068864_100002938 3300005618 Bacteria 14093
192 Ga0068864_100050144 3300005618 Bacteria 3592
193 Ga0068864_100202597 3300005618 Bacteria 1824
194 Ga0068866_10001944 3300005718 Bacteria 8612
195 Ga0068866_10048476 3300005718 Bacteria 2148
196 Ga0068866_10063871 3300005718 Bacteria 1920
197 Ga0068866_10071272 3300005718 Bacteria 1837
198 Ga0068866_10091035 3300005718 Bacteria 1661
199 Ga0068861_100149815 3300005719 Bacteria 1913
200 Ga0068851_10008933 3300005834 Unclassified 4647
201 Ga0068870_10025939 3300005840 Bacteria 2915
202 Ga0068870_10028704 3300005840 Bacteria 2796
203 Ga0068863_100009977 3300005841 Bacteria 9246
204 Ga0068863_100060320 3300005841 Bacteria 3588
205 Ga0068863_100082639 3300005841 Bacteria 3044
206 Ga0068863_100108816 3300005841 Bacteria 2638
207 Ga0068863_100212470 3300005841 Bacteria 1863
208 Ga0068858_100005503 3300005842 Bacteria 12401
209 Ga0068858_100018536 3300005842 Bacteria 6516
210 Ga0068858_100022981 3300005842 Bacteria 5815
211 Ga0068858_100860054 3300005842 Unclassified 886
212 Ga0068858_101012158 3300005842 Bacteria 814
213 Ga0068860_100034790 3300005843 Bacteria 4833
214 Ga0068860_100044135 3300005843 Bacteria 4250
215 Ga0068860_100120511 3300005843 Bacteria 2512
216 Ga0068860_100146578 3300005843 Bacteria 2271
217 Ga0068860_100923853 3300005843 Unclassified 889
218 Ga0068862_100038124 3300005844 Bacteria 4075
219 Ga0068862_100079797 3300005844 Bacteria 2837
220 Ga0068862_100452739 3300005844 Bacteria 1210
221 Ga0068862_100487151 3300005844 Unclassified 1168
222 Ga0070717_10000612 3300006028 Bacteria 22915
223 Ga0070717_10001449 3300006028 Bacteria 16366
224 Ga0070717_10014281 3300006028 Bacteria 6107
225 Ga0070717_10037492 3300006028 Bacteria 3936
226 Ga0070717_10080901 3300006028 Bacteria 2726
227 Ga0070717_10759438 3300006028 Bacteria 881
228 Ga0070715_10161117 3300006163 Bacteria 1109
229 Ga0070715_10179028 3300006163 Bacteria 1062
230 Ga0070716_100000315 3300006173 Bacteria 19472
231 Ga0070716_100009262 3300006173 Bacteria 4907
232 Ga0070716_100106773 3300006173 Bacteria 1727
233 Ga0070716_100131492 3300006173 Bacteria 1583
234 Ga0070716_100304584 3300006173 Unclassified 1110
235 Ga0070716_100547347 3300006173 Unclassified 862
236 Ga0070716_100748319 3300006173 Unclassified 752
237 Ga0070712_100025709 3300006175 Bacteria 3915
238 Ga0070712_100031836 3300006175 Bacteria 3556
239 Ga0070712_100036638 3300006175 Bacteria 3339
240 Ga0070712_100242421 3300006175 Bacteria 1436
241 Ga0070712_100337718 3300006175 Bacteria 1229
242 Ga0070712_100357842 3300006175 Bacteria 1196
243 Ga0070712_100399050 3300006175 Unclassified 1135
244 Ga0070712_101467105 3300006175 Bacteria 596
245 Ga0097621_100000533 3300006237 Bacteria 26715
246 Ga0097621_100000581 3300006237 Bacteria 25739
247 Ga0097621_100003314 3300006237 Bacteria 11079
248 Ga0097621_100008160 3300006237 Bacteria 7529
249 Ga0097621_100022422 3300006237 Bacteria 4902
250 Ga0097621_100058974 3300006237 Bacteria 3141
251 Ga0097621_100095417 3300006237 Bacteria 2494
252 Ga0097621_100349215 3300006237 Bacteria 1315
253 Ga0097621_101250151 3300006237 Unclassified 700
254 Ga0097621_101394909 3300006237 Unclassified 663
255 Ga0068871_100000664 3300006358 Bacteria 23618
256 Ga0068871_100010089 3300006358 Bacteria 6872
257 Ga0068871_100011784 3300006358 Bacteria 6425
258 Ga0068871_100013426 3300006358 Bacteria 6080
259 Ga0068871_100016938 3300006358 Bacteria 5503
260 Ga0068871_100059625 3300006358 Bacteria 3110
261 Ga0068871_100138074 3300006358 Bacteria 2071
262 Ga0068871_100139443 3300006358 Bacteria 2061
263 Ga0075433_10001164 3300006852 Bacteria 19108
264 Ga0075433_10170259 3300006852 Bacteria 1938
265 Ga0075434_100000041 3300006871 Bacteria 59536
266 Ga0075434_100002766 3300006871 Bacteria 15521
267 Ga0075434_100072900 3300006871 Bacteria 3426
268 Ga0075434_100493021 3300006871 Bacteria 1246
269 Ga0068865_100020621 3300006881 Bacteria 4276
270 Ga0068865_100023609 3300006881 Bacteria 4028
271 Ga0068865_100053678 3300006881 Bacteria 2797
272 Ga0068865_100120095 3300006881 Bacteria 1952
273 Ga0068865_100247432 3300006881 Bacteria 1406
274 Ga0075436_100000572 3300006914 Bacteria 24071
275 Ga0075436_100017155 3300006914 Bacteria 4956
276 Ga0075436_100121078 3300006914 Bacteria 1831
277 Ga0075436_100124677 3300006914 Bacteria 1804
278 Ga0097620_100002075 3300006931 Bacteria 20448
279 Ga0097620_100030693 3300006931 Bacteria 5393
280 Ga0075435_100000105 3300007076 Bacteria 45736
281 Ga0075435_100056238 3300007076 Bacteria 3180
282 Ga0075435_100072735 3300007076 Bacteria 2809
283 Ga0075435_100132852 3300007076 Bacteria 2083
284 Ga0075435_100326877 3300007076 Bacteria 1313
285 Ga0075435_100418923 3300007076 Unclassified 1153
286 Ga0099794_10159544 3300007265 Bacteria 1147
287 Ga0099795_10271170 3300007788 Unclassified 738
288 Ga0105240_10021132 3300009093 Bacteria 8664
289 Ga0105240_10049302 3300009093 Bacteria 5316
290 Ga0105240_10085351 3300009093 Bacteria 3868
291 Ga0105240_10258650 3300009093 Bacteria 2009
292 Ga0105240_10362650 3300009093 Bacteria 1641
293 Ga0105240_10407913 3300009093 Bacteria 1529
294 Ga0105240_10411035 3300009093 Bacteria 1522
295 Ga0105240_10654376 3300009093 Unclassified 1151
296 Ga0105240_10815083 3300009093 Unclassified 1010
297 Ga0105245_10030044 3300009098 Bacteria 4804
298 Ga0105245_10048691 3300009098 Bacteria 3791
299 Ga0105245_10058109 3300009098 Bacteria 3481
300 Ga0105245_10067483 3300009098 Bacteria 3239
301 Ga0105245_10422403 3300009098 Bacteria 1336
302 Ga0105247_10128443 3300009101 Bacteria 1650
303 Ga0114129_10110216 3300009147 Bacteria 3800
304 Ga0105243_10219956 3300009148 Unclassified 1678
305 Ga0105243_10227423 3300009148 Bacteria 1653
306 Ga0105243_10662360 3300009148 Unclassified 1013
307 Ga0105241_10000916 3300009174 Bacteria 22311
308 Ga0105241_10003223 3300009174 Bacteria 12142
309 Ga0105241_10005248 3300009174 Bacteria 9568
310 Ga0105241_10018499 3300009174 Bacteria 5125
311 Ga0105241_10072708 3300009174 Bacteria 2673
312 Ga0105241_10148980 3300009174 Bacteria 1912
313 Ga0105241_10527763 3300009174 Bacteria 1056
314 Ga0105241_10709454 3300009174 Unclassified 919
315 Ga0105241_11465848 3300009174 Unclassified 656
316 Ga0105242_10051705 3300009176 Unclassified 3349
317 Ga0105242_10066979 3300009176 Bacteria 2967
318 Ga0105242_10129597 3300009176 Bacteria 2175
319 Ga0105242_10559883 3300009176 Bacteria 1098
320 Ga0105248_10028944 3300009177 Bacteria 6175
321 Ga0105248_10044221 3300009177 Bacteria 4995
322 Ga0105248_10317523 3300009177 Bacteria 1755
323 Ga0105248_10628682 3300009177 Unclassified 1211
324 Ga0105237_10017834 3300009545 Bacteria 7359
325 Ga0105237_10450842 3300009545 Bacteria 1292
326 Ga0105237_10598090 3300009545 Bacteria 1110
327 Ga0105237_10665022 3300009545 Bacteria 1048
328 Ga0105238_10000533 3300009551 Bacteria 39822
329 Ga0105238_10011687 3300009551 Bacteria 8850
330 Ga0105238_10042307 3300009551 Bacteria 4614
331 Ga0105238_11550851 3300009551 Unclassified 692
332 Ga0105249_10053432 3300009553 Bacteria 3693
333 Ga0105249_10221525 3300009553 Unclassified 1862
334 Ga0105249_11087092 3300009553 Unclassified 870
335 Ga0105239_10028794 3300010375 Bacteria 6108
336 Ga0105239_10038771 3300010375 Bacteria 5220
337 Ga0105239_10206975 3300010375 Bacteria 2198
338 Ga0105239_10214096 3300010375 Bacteria 2160
339 Ga0105246_10035400 3300011119 Bacteria 3337
340 Ga0157373_10000288 3300013100 Bacteria 40421
341 Ga0157373_10004158 3300013100 Bacteria 10914
342 Ga0157373_10201894 3300013100 Bacteria 1402
343 Ga0157371_10004724 3300013102 Bacteria 11769
344 Ga0157371_10033925 3300013102 Bacteria 3665
345 Ga0157371_10090001 3300013102 Bacteria 2174
346 Ga0157371_10159591 3300013102 Bacteria 1610
347 Ga0157370_10010473 3300013104 Bacteria 9764
348 Ga0157370_10204758 3300013104 Bacteria 1830
349 Ga0157370_10810788 3300013104 Unclassified 851
350 Ga0157369_10000170 3300013105 Bacteria 91583
351 Ga0157369_10008623 3300013105 Bacteria 11692
352 Ga0157369_10036722 3300013105 Bacteria 5367
353 Ga0157369_10069172 3300013105 Bacteria 3793
354 Ga0157369_10158619 3300013105 Bacteria 2389
355 Ga0157369_10160581 3300013105 Bacteria 2372
356 Ga0157369_10165306 3300013105 Bacteria 2334
357 Ga0157374_10000316 3300013296 Bacteria 44946
358 Ga0157374_10002063 3300013296 Bacteria 16893
359 Ga0157374_10046665 3300013296 Bacteria 4013
360 Ga0157374_10051152 3300013296 Bacteria 3844
361 Ga0157374_10108358 3300013296 Bacteria 2670
362 Ga0157374_10115790 3300013296 Bacteria 2582
363 Ga0157374_10213963 3300013296 Bacteria 1890
364 Ga0157374_10284115 3300013296 Bacteria 1634
365 Ga0157374_10378925 3300013296 Unclassified 1409
366 Ga0157374_11060955 3300013296 Unclassified 830
367 Ga0157378_10000085 3300013297 Bacteria 87651
368 Ga0157378_10000182 3300013297 Bacteria 60024
369 Ga0157378_10000924 3300013297 Bacteria 27038
370 Ga0157378_10010049 3300013297 Bacteria 8247
371 Ga0157378_10016408 3300013297 Bacteria 6485
372 Ga0157378_10209013 3300013297 Bacteria 1850
373 Ga0157378_10651852 3300013297 Bacteria 1069
374 Ga0157378_11367835 3300013297 Unclassified 750
375 Ga0163162_10001077 3300013306 Bacteria 25415
376 Ga0163162_10082406 3300013306 Bacteria 3289
377 Ga0163162_10100957 3300013306 Bacteria 2977
378 Ga0163162_10404979 3300013306 Bacteria 1497
379 Ga0157372_10000620 3300013307 Bacteria 38778
380 Ga0157372_10001563 3300013307 Bacteria 24933
381 Ga0157372_10015183 3300013307 Bacteria 8245
382 Ga0157372_10032667 3300013307 Bacteria 5708
383 Ga0157372_10066528 3300013307 Bacteria 4049
384 Ga0157372_10085575 3300013307 Bacteria 3576
385 Ga0157372_10109224 3300013307 Bacteria 3167
386 Ga0157372_10144089 3300013307 Bacteria 2747
387 Ga0157372_10232023 3300013307 Bacteria 2140
388 Ga0157372_10389124 3300013307 Unclassified 1625
389 Ga0157372_10696315 3300013307 Bacteria 1182
390 Ga0157375_10002000 3300013308 Bacteria 17578
391 Ga0157375_10111416 3300013308 Bacteria 2835
392 Ga0157375_10497711 3300013308 Bacteria 1383
393 Ga0163163_10172295 3300014325 Bacteria 2211
394 Ga0163163_10173248 3300014325 Bacteria 2204
395 Ga0163163_10322317 3300014325 Bacteria 1599
396 Ga0182008_10004982 3300014497 Bacteria 7644
397 Ga0157377_10001020 3300014745 Bacteria 11815
398 Ga0157379_10000791 3300014968 Bacteria 25671
399 Ga0157379_10010531 3300014968 Bacteria 8061
400 Ga0157379_10014150 3300014968 Bacteria 6996
401 Ga0157379_10078734 3300014968 Bacteria 2952
402 Ga0157376_10056458 3300014969 Bacteria 3280
403 Ga0157376_10059670 3300014969 Bacteria 3199
404 Ga0157376_10106166 3300014969 Bacteria 2463
405 Ga0157376_10108990 3300014969 Bacteria 2434
406 Ga0157376_10249643 3300014969 Bacteria 1656
407 Ga0157376_11389175 3300014969 Bacteria 734
408 Ga0182007_10003288 3300015262 Bacteria 7672
409 Ga0163161_10007272 3300017792 Bacteria 7645
410 Ga0213874_10075058 3300021377 Bacteria 1086
411 Ga0213876_10168337 3300021384 Unclassified 1166
412 Ga0224569_101075 3300022732 Bacteria 2327
413 Ga0224572_1010279 3300024225 Bacteria 1757
414 Ga0228598_1000222 3300024227 Bacteria 10731
415 Ga0207697_10025446 3300025315 Bacteria 2419
416 Ga0207656_10043180 3300025321 Bacteria 1921
417 Ga0207682_10078619 3300025893 Bacteria 1410
418 Ga0207692_10005811 3300025898 Bacteria 4969
419 Ga0207692_10012634 3300025898 Bacteria 3634
420 Ga0207692_10149731 3300025898 Bacteria 1335
421 Ga0207642_10105537 3300025899 Bacteria 1424
422 Ga0207642_10178228 3300025899 Unclassified 1156
423 Ga0207688_10024685 3300025901 Bacteria 3298
424 Ga0207680_10238470 3300025903 Bacteria 1252
425 Ga0207647_10003441 3300025904 Bacteria 11878
426 Ga0207647_10006704 3300025904 Bacteria 8367
427 Ga0207685_10010386 3300025905 Unclassified 2748
428 Ga0207685_10084799 3300025905 Unclassified 1320
429 Ga0207685_10180510 3300025905 Bacteria 978
430 Ga0207699_10021573 3300025906 Bacteria 3474
431 Ga0207699_10041331 3300025906 Bacteria 2662
432 Ga0207699_10079722 3300025906 Unclassified 2027
433 Ga0207699_10144076 3300025906 Unclassified 1569
434 Ga0207699_10154163 3300025906 Bacteria 1523
435 Ga0207645_10000181 3300025907 Bacteria 50200
436 Ga0207645_10007967 3300025907 Bacteria 7435
437 Ga0207645_11122225 3300025907 Unclassified 530
438 Ga0207643_10001458 3300025908 Bacteria 13565
439 Ga0207643_10039713 3300025908 Bacteria 2647
440 Ga0207643_10229876 3300025908 Bacteria 1137
441 Ga0207705_10034513 3300025909 Bacteria 3617
442 Ga0207684_10000267 3300025910 Bacteria 77172
443 Ga0207684_10006270 3300025910 Bacteria 10851
444 Ga0207684_10241725 3300025910 Bacteria 1558
445 Ga0207654_10006338 3300025911 Bacteria 5949
446 Ga0207654_10009540 3300025911 Bacteria 4932
447 Ga0207654_10039496 3300025911 Bacteria 2655
448 Ga0207654_10118041 3300025911 Bacteria 1661
449 Ga0207654_10151060 3300025911 Bacteria 1491
450 Ga0207707_10000739 3300025912 Bacteria 32307
451 Ga0207707_10003872 3300025912 Bacteria 13278
452 Ga0207707_10067914 3300025912 Bacteria 3106
453 Ga0207695_10032122 3300025913 Bacteria 5749
454 Ga0207695_10037723 3300025913 Bacteria 5212
455 Ga0207695_10039212 3300025913 Bacteria 5092
456 Ga0207695_10059474 3300025913 Bacteria 3962
457 Ga0207695_10131525 3300025913 Unclassified 2460
458 Ga0207695_10473423 3300025913 Unclassified 1135
459 Ga0207671_10404050 3300025914 Bacteria 1086
460 Ga0207693_10007165 3300025915 Bacteria 9190
461 Ga0207693_10025159 3300025915 Bacteria 4721
462 Ga0207693_10098859 3300025915 Bacteria 2288
463 Ga0207693_10149444 3300025915 Bacteria 1837
464 Ga0207693_10371778 3300025915 Bacteria 1118
465 Ga0207693_11215201 3300025915 Bacteria 568
466 Ga0207663_10002155 3300025916 Bacteria 9394
467 Ga0207663_10027148 3300025916 Bacteria 3333
468 Ga0207663_10098411 3300025916 Unclassified 1958
469 Ga0207663_10111539 3300025916 Bacteria 1856
470 Ga0207663_10129565 3300025916 Bacteria 1741
471 Ga0207663_10134177 3300025916 Bacteria 1715
472 Ga0207663_10440053 3300025916 Bacteria 1004
473 Ga0207662_10013877 3300025918 Bacteria 4510
474 Ga0207657_10000535 3300025919 Bacteria 40427
475 Ga0207657_10010586 3300025919 Bacteria 9195
476 Ga0207649_10000350 3300025920 Bacteria 34881
477 Ga0207649_10020997 3300025920 Bacteria 3751
478 Ga0207649_10113314 3300025920 Bacteria 1816
479 Ga0207652_10130649 3300025921 Bacteria 2240
480 Ga0207652_10233893 3300025921 Bacteria 1656
481 Ga0207652_11093540 3300025921 Unclassified 698
482 Ga0207646_10000296 3300025922 Bacteria 67683
483 Ga0207646_10055621 3300025922 Bacteria 3538
484 Ga0207646_10144851 3300025922 Bacteria 2141
485 Ga0207646_10168905 3300025922 Bacteria 1975
486 Ga0207646_10290260 3300025922 Bacteria 1478
487 Ga0207646_10435569 3300025922 Unclassified 1183
488 Ga0207646_10825017 3300025922 Bacteria 825
489 Ga0207694_10001172 3300025924 Bacteria 22716
490 Ga0207694_10299756 3300025924 Bacteria 1323
491 Ga0207694_10343665 3300025924 Bacteria 1234
492 Ga0207650_10000223 3300025925 Bacteria 64087
493 Ga0207659_10611716 3300025926 Bacteria 929
494 Ga0207687_10061173 3300025927 Bacteria 2659
495 Ga0207687_10232116 3300025927 Unclassified 1458
496 Ga0207687_10528995 3300025927 Unclassified 987
497 Ga0207687_10653408 3300025927 Bacteria 890
498 Ga0207687_11120693 3300025927 Unclassified 676
499 Ga0207700_10003847 3300025928 Bacteria 8775
500 Ga0207700_10096003 3300025928 Bacteria 2352
501 Ga0207700_10217579 3300025928 Bacteria 1618
502 Ga0207700_10327392 3300025928 Bacteria 1329
503 Ga0207700_10393509 3300025928 Bacteria 1213
504 Ga0207700_10442191 3300025928 Bacteria 1145
505 Ga0207700_10527637 3300025928 Bacteria 1046
506 Ga0207700_10837864 3300025928 Unclassified 823
507 Ga0207664_10003882 3300025929 Bacteria 10040
508 Ga0207664_10104610 3300025929 Bacteria 2344
509 Ga0207664_10139652 3300025929 Bacteria 2048
510 Ga0207664_10294431 3300025929 Bacteria 1427
511 Ga0207664_10313810 3300025929 Bacteria 1382
512 Ga0207664_10529614 3300025929 Bacteria 1056
513 Ga0207664_10539230 3300025929 Bacteria 1046
514 Ga0207664_10543955 3300025929 Bacteria 1042
515 Ga0207664_10762094 3300025929 Bacteria 870
516 Ga0207664_10922300 3300025929 Unclassified 784
517 Ga0207664_11280204 3300025929 Bacteria 652
518 Ga0207644_10010014 3300025931 Bacteria 6240
519 Ga0207644_10050845 3300025931 Bacteria 2972
520 Ga0207690_10021279 3300025932 Bacteria 4020
521 Ga0207690_10237622 3300025932 Bacteria 1402
522 Ga0207690_11114301 3300025932 Unclassified 658
523 Ga0207706_10000670 3300025933 Bacteria 35982
524 Ga0207706_10009803 3300025933 Bacteria 8789
525 Ga0207706_10097072 3300025933 Bacteria 2591
526 Ga0207686_10150787 3300025934 Bacteria 1618
527 Ga0207686_10167536 3300025934 Bacteria 1546
528 Ga0207709_10678276 3300025935 Unclassified 823
529 Ga0207670_10028033 3300025936 Bacteria 3569
530 Ga0207670_10327909 3300025936 Bacteria 1206
531 Ga0207669_10215903 3300025937 Bacteria 1404
532 Ga0207704_10040278 3300025938 Bacteria 2729
533 Ga0207704_10173937 3300025938 Bacteria 1548
534 Ga0207704_10600206 3300025938 Unclassified 901
535 Ga0207665_10001184 3300025939 Bacteria 17548
536 Ga0207665_10001917 3300025939 Bacteria 14012
537 Ga0207665_10012063 3300025939 Bacteria 5673
538 Ga0207665_10063391 3300025939 Bacteria 2510
539 Ga0207665_10099310 3300025939 Bacteria 2030
540 Ga0207665_10416594 3300025939 Unclassified 1025
541 Ga0207665_10443016 3300025939 Unclassified 996
542 Ga0207691_10000345 3300025940 Bacteria 46775
543 Ga0207711_10025030 3300025941 Bacteria 5007
544 Ga0207711_10057834 3300025941 Unclassified 3334
545 Ga0207711_10218740 3300025941 Bacteria 1741
546 Ga0207711_10221415 3300025941 Bacteria 1731
547 Ga0207689_10000499 3300025942 Bacteria 37043
548 Ga0207689_10016380 3300025942 Bacteria 6276
549 Ga0207689_10285176 3300025942 Bacteria 1367
550 Ga0207661_10006500 3300025944 Bacteria 8264
551 Ga0207661_10017888 3300025944 Bacteria 5256
552 Ga0207661_10027882 3300025944 Bacteria 4319
553 Ga0207661_10199949 3300025944 Bacteria 1756
554 Ga0207679_10000115 3300025945 Bacteria 64466
555 Ga0207679_10023538 3300025945 Bacteria 4213
556 Ga0207679_10030170 3300025945 Bacteria 3784
557 Ga0207667_10000785 3300025949 Bacteria 41249
558 Ga0207667_10017971 3300025949 Bacteria 7946
559 Ga0207667_10051084 3300025949 Bacteria 4359
560 Ga0207667_10298857 3300025949 Bacteria 1645
561 Ga0207667_10460565 3300025949 Bacteria 1291
562 Ga0207667_11208393 3300025949 Unclassified 735
563 Ga0207651_10003270 3300025960 Bacteria 7932
564 Ga0207651_10064212 3300025960 Bacteria 2568
565 Ga0207651_10857473 3300025960 Unclassified 807
566 Ga0207712_10181181 3300025961 Bacteria 1655
567 Ga0207668_10144178 3300025972 Bacteria 1835
568 Ga0207640_10004885 3300025981 Bacteria 7283
569 Ga0207640_10020814 3300025981 Bacteria 3899
570 Ga0207640_10060894 3300025981 Unclassified 2497
571 Ga0207640_10094289 3300025981 Bacteria 2081
572 Ga0207640_10269193 3300025981 Bacteria 1332
573 Ga0207640_10465024 3300025981 Unclassified 1046
574 Ga0207658_10405184 3300025986 Bacteria 1199
575 Ga0207677_10002530 3300026023 Bacteria 9583
576 Ga0207677_10003252 3300026023 Bacteria 8581
577 Ga0207677_10004943 3300026023 Bacteria 7200
578 Ga0207677_10007366 3300026023 Bacteria 6082
579 Ga0207677_10010950 3300026023 Bacteria 5151
580 Ga0207677_10025441 3300026023 Bacteria 3694
581 Ga0207703_10007943 3300026035 Bacteria 8385
582 Ga0207703_10015108 3300026035 Bacteria 6026
583 Ga0207703_10025723 3300026035 Bacteria 4630
584 Ga0207703_10050419 3300026035 Unclassified 3369
585 Ga0207703_10134321 3300026035 Bacteria 2140
586 Ga0207703_10762820 3300026035 Bacteria 922
587 Ga0207639_10089233 3300026041 Bacteria 2463
588 Ga0207639_10763191 3300026041 Unclassified 900
589 Ga0207639_10858976 3300026041 Bacteria 847
590 Ga0207678_10000130 3300026067 Bacteria 63279
591 Ga0207678_10001418 3300026067 Bacteria 21972
592 Ga0207702_10000089 3300026078 Bacteria 105440
593 Ga0207702_10001792 3300026078 Bacteria 21146
594 Ga0207702_10002571 3300026078 Bacteria 17059
595 Ga0207702_10003470 3300026078 Bacteria 14365
596 Ga0207702_10076242 3300026078 Bacteria 2898
597 Ga0207702_10175781 3300026078 Bacteria 1967
598 Ga0207702_10205274 3300026078 Bacteria 1829
599 Ga0207702_10430703 3300026078 Unclassified 1277
600 Ga0207702_11099664 3300026078 Unclassified 789
601 Ga0207641_10000287 3300026088 Bacteria 63251
602 Ga0207641_10012276 3300026088 Bacteria 7029
603 Ga0207641_10032164 3300026088 Bacteria 4355
604 Ga0207641_10050545 3300026088 Unclassified 3517
605 Ga0207641_10425124 3300026088 Bacteria 1280
606 Ga0207648_10001253 3300026089 Bacteria 28381
607 Ga0207648_10065321 3300026089 Bacteria 3172
608 Ga0207648_10133384 3300026089 Bacteria 2186
609 Ga0207648_10482814 3300026089 Unclassified 1132
610 Ga0207676_10000115 3300026095 Bacteria 71633
611 Ga0207676_10001385 3300026095 Bacteria 18052
612 Ga0207676_10188227 3300026095 Bacteria 1814
613 Ga0207674_10000309 3300026116 Bacteria 62067
614 Ga0207674_10001340 3300026116 Bacteria 31912
615 Ga0207674_10008419 3300026116 Bacteria 11914
616 Ga0207674_10049213 3300026116 Bacteria 4312
617 Ga0207675_100013993 3300026118 Bacteria 7480
618 Ga0207675_100033439 3300026118 Bacteria 4791
619 Ga0207683_10000217 3300026121 Bacteria 50192
620 Ga0207683_10020372 3300026121 Bacteria 5672
621 Ga0207683_10182995 3300026121 Bacteria 1900
622 Ga0207698_10022987 3300026142 Bacteria 4349
623 Ga0207698_10118744 3300026142 Bacteria 2234
624 Ga0268266_10008412 3300028379 Bacteria 9174
625 Ga0268266_10017646 3300028379 Bacteria 6085
626 Ga0268266_10279410 3300028379 Bacteria 1552
627 Ga0268265_10060540 3300028380 Bacteria 2902
628 Ga0268265_10137853 3300028380 Unclassified 2038
629 Ga0268264_10016234 3300028381 Bacteria 6097
630 Ga0268264_10030440 3300028381 Bacteria 4423
631 Ga0268264_10111481 3300028381 Bacteria 2397
632 Ga0268264_10389682 3300028381 Bacteria 1336
633 Ga0268264_10520271 3300028381 Unclassified 1163
634 Ga0268264_10692102 3300028381 Unclassified 1012
635 Ga0373930_0058712 3300034816 Unclassified 854
636 Ga0373948_0037683 3300034817 Unclassified 1001
637 Ga0373926_0001920 3300035083 Bacteria 6499
638 Ga0373929_0012660 3300035085 Bacteria 1606
639 Ga0373929_0049865 3300035085 Unclassified 954
640 Ga0373934_0283818 3300035086 Unclassified 686
641 Ga0373940_0032982 3300035088 Bacteria 1391
642 Ga0373949_0070820 3300035090 Bacteria 913
643 Ga0373952_0124129 3300035092 Bacteria 703
644 Ga0373932_0132025 3300035112 Unclassified 842
645 Ga0373936_0030903 3300035113 Bacteria 2113
646 Ga0373936_0053131 3300035113 Bacteria 1642
647 Ga0373941_0104955 3300035115 Bacteria 989
648 Ga0373960_0025394 3300035121 Bacteria 1611
649 Ga0373943_0016579 3300035170 Bacteria 3362
650 Ga0373946_0112103 3300035171 Bacteria 1236
651 Ga0373946_0397788 3300035171 Unclassified 695
652 Ga0373924_0009439 3300035410 Bacteria 3574
653 Ga0373931_0025499 3300035691 Bacteria 3003
654 Ga0373931_0109085 3300035691 Bacteria 1568
655 Ga0373931_0143344 3300035691 Unclassified 1386
656 Ga0373931_0243491 3300035691 Unclassified 1091
657 Ga0373931_1021405 3300035691 Unclassified 560
658 Ga0373935_0001139 3300035692 Bacteria 14526
659 Ga0373935_0099192 3300035692 Bacteria 1918
660 Ga0373935_0172120 3300035692 Bacteria 1482
661 Ga0373935_0889907 3300035692 Bacteria 659
662 Ga0373927_0042873 3300035695 Bacteria 2932
663 Ga0373927_0169860 3300035695 Unclassified 1429
664 Ga0373933_0039746 3300035724 Bacteria 2768
665 Ga0373933_0115228 3300035724 Bacteria 1679
666 Ga0373947_0001752 3300035725 Bacteria 13271
667 Ga0373947_0028437 3300035725 Bacteria 3278
668 Ga0373947_0331598 3300035725 Bacteria 1019
669 Ga0373937_0011016 3300036401 Bacteria 7926
670 Ga0373937_0020421 3300036401 Bacteria 5939
671 Ga0373937_0152399 3300036401 Bacteria 2166
672 Ga0373937_1268228 3300036401 Unclassified 685
673 Ga0373925_0011229 3300037068 Bacteria 6495
674 Ga0373925_0023844 3300037068 Bacteria 4464
675 Ga0373925_0543010 3300037068 Unclassified 956
676 Ga0373925_0722444 3300037068 Unclassified 821
677 Ga0373925_1288146 3300037068 Unclassified 600
678 Ga0436364_0932990 3300037853 Unclassified 794
679 Ga0436365_0987110 3300039437 Bacteria 3723
680 Ga0436365_1666219 3300039437 Bacteria 1372
681 Ga0436363_0502380 3300039450 Bacteria 1927
682 Ga0436363_0952513 3300039450 Unclassified 833
683 Ga0436362_1059074 3300039453 Unclassified 605
684 Ga0439448_0033911 3300042005 Bacteria 1630
685 Ga0466965_0338383 3300044683 Bacteria 822
686 Ga0466966_0029532 3300044684 Bacteria 3566
687 Ga0466961_0110258 3300044693 Bacteria 1732
688 Ga0466963_0108580 3300044694 Bacteria 1903
689 Ga0453684_0884403 3300044712 Bacteria 958
690 Ga0466957_0405287 3300044842 Bacteria 933
691 Ga0466959_0075922 3300045049 Bacteria 2427
692 Ga0451576_1100667 3300045051 Unclassified 831
693 Ga0466958_0131548 3300045836 Bacteria 1571
694 Ga0466967_0006951 3300045976 Bacteria 8095
695 Ga0466967_0041357 3300045976 Bacteria 3974
696 Ga0466967_0045044 3300045976 Bacteria 3831
697 Ga0466967_1367972 3300045976 Unclassified 705
698 Ga0495603_0338594 3300046455 Bacteria 863
699 Ga0495603_0620346 3300046455 Bacteria 619
700 Ga0495641_0265216 3300046461 Unclassified 773
701 Ga0495580_0001027 3300046472 Bacteria 24495
702 Ga0495580_0003785 3300046472 Bacteria 12813
703 Ga0495580_0004216 3300046472 Bacteria 12090
704 Ga0495580_0009936 3300046472 Bacteria 7449
705 Ga0495580_0031980 3300046472 Bacteria 3799
706 Ga0495580_0034929 3300046472 Bacteria 3617
707 Ga0495580_0037771 3300046472 Bacteria 3463
708 Ga0495580_0046791 3300046472 Bacteria 3068
709 Ga0495580_0076801 3300046472 Bacteria 2329
710 Ga0495580_0160872 3300046472 Unclassified 1554
711 Ga0495580_0181368 3300046472 Bacteria 1454
712 Ga0495582_0000483 3300046473 Bacteria 21799
713 Ga0495608_0686808 3300046511 Unclassified 610
714 Ga0495630_0409036 3300046517 Bacteria 1040
715 Ga0495666_0013907 3300046526 Bacteria 4013
716 Ga0495642_0155839 3300046528 Unclassified 989
717 Ga0495652_0559858 3300046529 Unclassified 785
718 Ga0495665_0005902 3300046531 Bacteria 6594
719 Ga0495640_0237025 3300046533 Bacteria 1146
720 Ga0495587_0119462 3300046536 Unclassified 1510
721 Ga0495634_0327039 3300046642 Bacteria 922
722 Ga0495635_0200674 3300046663 Bacteria 1353
723 Ga0495588_0132784 3300046674 Bacteria 1314
724 Ga0495657_0217611 3300046675 Bacteria 1159
725 Ga0495623_0049233 3300046679 Bacteria 2671
726 Ga0495623_0074669 3300046679 Bacteria 2107
727 Ga0495647_0115126 3300046681 Bacteria 1126
728 Ga0495658_0677216 3300046683 Unclassified 661
729 Ga0495669_0059801 3300046684 Unclassified 1722
730 Ga0495581_0143826 3300047315 Bacteria 1391
731 Ga0495684_0125107 3300047471 Unclassified 1935
732 Ga0495602_0056927 3300048088 Bacteria 3434
733 Ga0495602_0066143 3300048088 Bacteria 3116
734 Ga0495602_0081235 3300048088 Bacteria 2726
735 Ga0495602_0425633 3300048088 Bacteria 942
736 Ga0496100_0397970 3300048903 Unclassified 1048
737 Ga0496100_0751695 3300048903 Unclassified 763
738 Ga0496101_0126288 3300048904 Unclassified 1938
739 Ga0496101_0337916 3300048904 Bacteria 1182
740 Ga0496101_0531868 3300048904 Unclassified 929
741 Ga0496101_0703237 3300048904 Bacteria 798
742 Ga0496102_0001424 3300048905 Bacteria 21214
743 Ga0496102_0119938 3300048905 Bacteria 2456
744 Ga0496102_0659411 3300048905 Bacteria 969
745 Ga0496102_0846268 3300048905 Unclassified 837
746 Ga0496103_0004119 3300048906 Bacteria 8825
747 Ga0496103_0052305 3300048906 Bacteria 2530
748 Ga0496103_0291661 3300048906 Bacteria 1049
749 Ga0496103_0393792 3300048906 Unclassified 890
750 Ga0496104_0045318 3300048907 Bacteria 4135
751 Ga0496104_0079617 3300048907 Bacteria 3123
752 Ga0496104_0111999 3300048907 Bacteria 2617
753 Ga0496104_0219147 3300048907 Bacteria 1815
754 Ga0496104_0244755 3300048907 Bacteria 1706
755 Ga0496104_0292369 3300048907 Bacteria 1542
756 Ga0496104_0451327 3300048907 Bacteria 1197
757 Ga0496105_0163450 3300048908 Bacteria 1827
758 Ga0496105_0202207 3300048908 Bacteria 1621
759 Ga0496105_0468329 3300048908 Unclassified 993
760 Ga0496106_0062366 3300048909 Bacteria 2830
761 Ga0496106_0132837 3300048909 Bacteria 1953
762 Ga0496107_0092225 3300048910 Bacteria 2214
763 Ga0496107_0110267 3300048910 Bacteria 2022
764 Ga0496107_0122901 3300048910 Bacteria 1913
765 Ga0496107_0473051 3300048910 Unclassified 930
766 Ga0496108_0000325 3300048911 Bacteria 40507
767 Ga0496108_0781545 3300048911 Unclassified 824
768 Ga0496109_0000117 3300048912 Bacteria 82245
769 Ga0496109_0303076 3300048912 Bacteria 1507
770 Ga0496109_0479010 3300048912 Unclassified 1175
771 Ga0496109_0502194 3300048912 Bacteria 1145
772 Ga0496110_0004256 3300048913 Bacteria 11075
773 Ga0496111_0116292 3300048914 Unclassified 1972
774 Ga0496111_0674374 3300048914 Unclassified 753
775 Ga0496112_0000283 3300048915 Bacteria 32864
776 Ga0496112_0024260 3300048915 Bacteria 5805
777 Ga0496112_0036157 3300048915 Bacteria 4816
778 Ga0496112_0068132 3300048915 Bacteria 3514
779 Ga0496112_0086369 3300048915 Bacteria 3104
780 Ga0496113_0002193 3300048916 Bacteria 11259
781 Ga0496113_0302887 3300048916 Unclassified 1280
782 Ga0496114_0026849 3300048917 Bacteria 4717
783 Ga0496115_0003148 3300048918 Bacteria 11863
784 Ga0496115_0025896 3300048918 Bacteria 4571
785 Ga0496115_0068765 3300048918 Bacteria 2868
786 Ga0496126_0407986 3300048929 Bacteria 1101
787 nmdc:mga0n895_15801_c1 3300050512 Bacteria 6902
788 nmdc:mga0n895_445489_c1 3300050512 Bacteria 1308
789 nmdc:mga0n895_47_c1 3300050512 Bacteria 73703
790 nmdc:mga0n895_72112_c1 3300050512 Bacteria 3426
791 nmdc:mga0rr50_14437_c1 3300050513 Bacteria 5181
792 nmdc:mga0rr50_190208_c1 3300050513 Bacteria 1681
793 nmdc:mga0rr50_284_c1 3300050513 Bacteria 27442
794 nmdc:mga0rr50_7786_c1 3300050513 Bacteria 6639
795 nmdc:mga0rr50_8644_c1 3300050513 Bacteria 6348
796 nmdc:mga08x19_119109_c1 3300050514 Bacteria 1768
797 nmdc:mga08x19_14300_c1 3300050514 Bacteria 4813
798 nmdc:mga08x19_1511_c1 3300050514 Bacteria 14413
799 nmdc:mga0a205_378_c1 3300050515 Bacteria 33792
800 nmdc:mga0a205_57122_c1 3300050515 Bacteria 3768
801 Ga0495612_0089401 3300053078 Bacteria 1302
802 Ga0495619_0121489 3300053085 Bacteria 1791
803 Ga0495619_0462876 3300053085 Unclassified 874
804 Ga0436363_0554196
805 MBSR1b_contig_10426571
806 JGI24034J26672_10001072
807 Ga0065715_10103892
808 Ga0065715_10190304
809 Ga0070658_10050304
810 Ga0070676_10002790
811 Ga0070676_10005656
812 Ga0070676_11434346
813 Ga0070683_100008507
814 Ga0070683_100025272
815 Ga0070683_100039096
816 Ga0070683_100272440
817 Ga0070690_100003796
818 Ga0070690_100095593
819 Ga0070670_100001437
820 Ga0070670_100014317
821 Ga0068869_100017954
822 Ga0068869_100038262
823 Ga0068869_100122907
824 Ga0070666_10029765
825 Ga0070666_10098987
826 Ga0070666_10103399
827 Ga0070682_100014488
828 Ga0068868_100003000
829 Ga0068868_100011189
830 Ga0068868_100013508
831 Ga0068868_100018954
832 Ga0068868_100042253
833 Ga0068868_100302390
834 Ga0068868_101241473
835 Ga0070660_100025702
836 Ga0070660_100045003
837 Ga0070689_100060534
838 Ga0070689_100188875
839 Ga0070691_10155261
840 Ga0070687_100011158
841 Ga0070687_100045842
842 Ga0070661_100031750
843 Ga0070661_100046715
844 Ga0070661_100110884
845 Ga0070661_100427033
846 Ga0070668_100009738
847 Ga0070668_100025830
848 Ga0070669_100018549
849 Ga0070669_100043880
850 Ga0070675_100128770
851 Ga0070675_100574157
852 Ga0070671_100077440
853 Ga0070671_100589563
854 Ga0070673_100089102
855 Ga0070688_100033125
856 Ga0070659_100005924
857 Ga0070659_100014233
858 Ga0070659_100235120
859 Ga0070667_100036765
860 Ga0070709_10018335
861 Ga0070709_10047289
862 Ga0070709_10122274
863 Ga0070714_100038017
864 Ga0070714_100105482
865 Ga0070714_100217645
866 Ga0070714_100253939
867 Ga0070714_100304673
868 Ga0070714_100318874
869 Ga0070714_100428873
870 Ga0070714_100437695
871 Ga0070714_101075135
872 Ga0070713_100001296
873 Ga0070713_100014580
874 Ga0070713_100038892
875 Ga0070713_100040670
876 Ga0070713_100050574
877 Ga0070713_100088593
878 Ga0070713_100370301
879 Ga0070713_100536262
880 Ga0070713_100640458
881 Ga0070713_100668751
882 Ga0070713_101756764
883 Ga0070710_10035996
884 Ga0070710_10488198
885 Ga0070701_10137112
886 Ga0070711_100009364
887 Ga0070711_100072867
888 Ga0070711_100159456
889 Ga0070711_100217029
890 Ga0070711_100398260
891 Ga0070711_100548286
892 Ga0070705_100113968
893 Ga0070694_100480012
894 Ga0070708_100000418
895 Ga0070708_100001358
896 Ga0070708_100010584
897 Ga0070708_100016739
898 Ga0070708_100070981
899 Ga0070708_100089495
900 Ga0070708_100374642
901 Ga0070663_100022739
902 Ga0070663_100055535
903 Ga0070678_100086021
904 Ga0070662_100018812
905 Ga0070662_100028395
906 Ga0070662_100197554
907 Ga0070681_10000055
908 Ga0070681_10011019
909 Ga0070681_10042775
910 Ga0068867_100009324
911 Ga0068867_100358162
912 Ga0068867_101032252
913 Ga0070685_10005938
914 Ga0070685_10104295
915 Ga0070706_100000173
916 Ga0070706_100001295
917 Ga0070707_100000719
918 Ga0070707_100031701
919 Ga0070707_100036828
920 Ga0070707_100170640
921 Ga0070707_100351400
922 Ga0070707_100553558
923 Ga0070707_100572293
924 Ga0070698_100000162
925 Ga0070698_100105353
926 Ga0070699_100002540
927 Ga0070699_100004218
928 Ga0070699_100030838
929 Ga0070679_100149618
930 Ga0070679_100500982
931 Ga0070679_100767231
932 Ga0070679_101520268
933 Ga0070684_100006304
934 Ga0070684_100117641
935 Ga0070684_100122109
936 Ga0070697_100000872
937 Ga0070697_100001177
938 Ga0070697_100001505
939 Ga0070697_100004369
940 Ga0070697_100122896
941 Ga0070697_100263377
942 Ga0070697_100718373
943 Ga0068853_100024159
944 Ga0068853_100060553
945 Ga0068853_100189928
946 Ga0068853_100216302
947 Ga0068853_100508166
948 Ga0068853_101203358
949 Ga0070672_100025283
950 Ga0070686_100018375
951 Ga0070686_100019750
952 Ga0070695_100151969
953 Ga0070695_100166683
954 Ga0070696_100742795
955 Ga0070693_100014551
956 Ga0070693_100328181
957 Ga0070704_100855257
958 Ga0068855_100005054
959 Ga0068855_100013834
960 Ga0068855_100024439
961 Ga0068855_100152588
962 Ga0070664_100001796
963 Ga0070664_100012980
964 Ga0070664_100023619
965 Ga0070664_100037976
966 Ga0068857_100000041
967 Ga0068857_100002662
968 Ga0068857_100438763
969 Ga0068854_100007188
970 Ga0068854_100013355
971 Ga0068854_100051906
972 Ga0068854_100067646
973 Ga0068854_100076758
974 Ga0068854_100165874
975 Ga0068854_100478714
976 Ga0068856_100000355
977 Ga0068856_100001245
978 Ga0068856_100001397
979 Ga0068856_100004843
980 Ga0068856_100078529
981 Ga0068856_100199529
982 Ga0068856_100289124
983 Ga0068856_100391152
984 Ga0068856_100414650
985 Ga0068856_100432434
986 Ga0068856_100625693
987 Ga0070702_100004820
988 Ga0070702_100047211
989 Ga0068852_100027680
990 Ga0068852_100066133
991 Ga0068852_100199069
992 Ga0068859_100002075
993 Ga0068859_100030694
994 Ga0068864_100002938
995 Ga0068864_100050144
996 Ga0068864_100202597
997 Ga0068866_10001944
998 Ga0068866_10048476
999 Ga0068866_10063871
1000 Ga0068866_10071272
1001 Ga0068866_10091035
1002 Ga0068861_100149815
1003 Ga0068851_10008933
1004 Ga0068870_10025939
1005 Ga0068870_10028704
1006 Ga0068863_100009977
1007 Ga0068863_100060320
1008 Ga0068863_100082639
1009 Ga0068863_100108816
1010 Ga0068863_100212470
1011 Ga0068858_100005503
1012 Ga0068858_100018536
1013 Ga0068858_100022981
1014 Ga0068858_100860054
1015 Ga0068858_101012158
1016 Ga0068860_100034790
1017 Ga0068860_100044135
1018 Ga0068860_100120511
1019 Ga0068860_100146578
1020 Ga0068860_100923853
1021 Ga0068862_100038124
1022 Ga0068862_100079797
1023 Ga0068862_100452739
1024 Ga0068862_100487151
1025 Ga0070717_10000612
1026 Ga0070717_10001449
1027 Ga0070717_10014281
1028 Ga0070717_10037492
1029 Ga0070717_10080901
1030 Ga0070717_10759438
1031 Ga0070715_10161117
1032 Ga0070715_10179028
1033 Ga0070716_100000315
1034 Ga0070716_100009262
1035 Ga0070716_100106773
1036 Ga0070716_100131492
1037 Ga0070716_100304584
1038 Ga0070716_100547347
1039 Ga0070716_100748319
1040 Ga0070712_100025709
1041 Ga0070712_100031836
1042 Ga0070712_100036638
1043 Ga0070712_100242421
1044 Ga0070712_100337718
1045 Ga0070712_100357842
1046 Ga0070712_100399050
1047 Ga0070712_101467105
1048 Ga0097621_100000533
1049 Ga0097621_100000581
1050 Ga0097621_100003314
1051 Ga0097621_100008160
1052 Ga0097621_100022422
1053 Ga0097621_100058974
1054 Ga0097621_100095417
1055 Ga0097621_100349215
1056 Ga0097621_101250151
1057 Ga0097621_101394909
1058 Ga0068871_100000664
1059 Ga0068871_100010089
1060 Ga0068871_100011784
1061 Ga0068871_100013426
1062 Ga0068871_100016938
1063 Ga0068871_100059625
1064 Ga0068871_100138074
1065 Ga0068871_100139443
1066 Ga0075433_10001164
1067 Ga0075433_10170259
1068 Ga0075434_100000041
1069 Ga0075434_100002766
1070 Ga0075434_100072900
1071 Ga0075434_100493021
1072 Ga0068865_100020621
1073 Ga0068865_100023609
1074 Ga0068865_100053678
1075 Ga0068865_100120095
1076 Ga0068865_100247432
1077 Ga0075436_100000572
1078 Ga0075436_100017155
1079 Ga0075436_100121078
1080 Ga0075436_100124677
1081 Ga0097620_100002075
1082 Ga0097620_100030693
1083 Ga0075435_100000105
1084 Ga0075435_100056238
1085 Ga0075435_100072735
1086 Ga0075435_100132852
1087 Ga0075435_100326877
1088 Ga0075435_100418923
1089 Ga0099794_10159544
1090 Ga0099795_10271170
1091 Ga0105240_10021132
1092 Ga0105240_10049302
1093 Ga0105240_10085351
1094 Ga0105240_10258650
1095 Ga0105240_10362650
1096 Ga0105240_10407913
1097 Ga0105240_10411035
1098 Ga0105240_10654376
1099 Ga0105240_10815083
1100 Ga0105245_10030044
1101 Ga0105245_10048691
1102 Ga0105245_10058109
1103 Ga0105245_10067483
1104 Ga0105245_10422403
1105 Ga0105247_10128443
1106 Ga0114129_10110216
1107 Ga0105243_10219956
1108 Ga0105243_10227423
1109 Ga0105243_10662360
1110 Ga0105241_10000916
1111 Ga0105241_10003223
1112 Ga0105241_10005248
1113 Ga0105241_10018499
1114 Ga0105241_10072708
1115 Ga0105241_10148980
1116 Ga0105241_10527763
1117 Ga0105241_10709454
1118 Ga0105241_11465848
1119 Ga0105242_10051705
1120 Ga0105242_10066979
1121 Ga0105242_10129597
1122 Ga0105242_10559883
1123 Ga0105248_10028944
1124 Ga0105248_10044221
1125 Ga0105248_10317523
1126 Ga0105248_10628682
1127 Ga0105237_10017834
1128 Ga0105237_10450842
1129 Ga0105237_10598090
1130 Ga0105237_10665022
1131 Ga0105238_10000533
1132 Ga0105238_10011687
1133 Ga0105238_10042307
1134 Ga0105238_11550851
1135 Ga0105249_10053432
1136 Ga0105249_10221525
1137 Ga0105249_11087092
1138 Ga0105239_10028794
1139 Ga0105239_10038771
1140 Ga0105239_10206975
1141 Ga0105239_10214096
1142 Ga0105246_10035400
1143 Ga0157373_10000288
1144 Ga0157373_10004158
1145 Ga0157373_10201894
1146 Ga0157371_10004724
1147 Ga0157371_10033925
1148 Ga0157371_10090001
1149 Ga0157371_10159591
1150 Ga0157370_10010473
1151 Ga0157370_10204758
1152 Ga0157370_10810788
1153 Ga0157369_10000170
1154 Ga0157369_10008623
1155 Ga0157369_10036722
1156 Ga0157369_10069172
1157 Ga0157369_10158619
1158 Ga0157369_10160581
1159 Ga0157369_10165306
1160 Ga0157374_10000316
1161 Ga0157374_10002063
1162 Ga0157374_10046665
1163 Ga0157374_10051152
1164 Ga0157374_10108358
1165 Ga0157374_10115790
1166 Ga0157374_10213963
1167 Ga0157374_10284115
1168 Ga0157374_10378925
1169 Ga0157374_11060955
1170 Ga0157378_10000085
1171 Ga0157378_10000182
1172 Ga0157378_10000924
1173 Ga0157378_10010049
1174 Ga0157378_10016408
1175 Ga0157378_10209013
1176 Ga0157378_10651852
1177 Ga0157378_11367835
1178 Ga0163162_10001077
1179 Ga0163162_10082406
1180 Ga0163162_10100957
1181 Ga0163162_10404979
1182 Ga0157372_10000620
1183 Ga0157372_10001563
1184 Ga0157372_10015183
1185 Ga0157372_10032667
1186 Ga0157372_10066528
1187 Ga0157372_10085575
1188 Ga0157372_10109224
1189 Ga0157372_10144089
1190 Ga0157372_10232023
1191 Ga0157372_10389124
1192 Ga0157372_10696315
1193 Ga0157375_10002000
1194 Ga0157375_10111416
1195 Ga0157375_10497711
1196 Ga0163163_10172295
1197 Ga0163163_10173248
1198 Ga0163163_10322317
1199 Ga0182008_10004982
1200 Ga0157377_10001020
1201 Ga0157379_10000791
1202 Ga0157379_10010531
1203 Ga0157379_10014150
1204 Ga0157379_10078734
1205 Ga0157376_10056458
1206 Ga0157376_10059670
1207 Ga0157376_10106166
1208 Ga0157376_10108990
1209 Ga0157376_10249643
1210 Ga0157376_11389175
1211 Ga0182007_10003288
1212 Ga0163161_10007272
1213 Ga0213874_10075058
1214 Ga0213876_10168337
1215 Ga0224569_101075
1216 Ga0224572_1010279
1217 Ga0228598_1000222
1218 Ga0207697_10025446
1219 Ga0207656_10043180
1220 Ga0207682_10078619
1221 Ga0207692_10005811
1222 Ga0207692_10012634
1223 Ga0207692_10149731
1224 Ga0207642_10105537
1225 Ga0207642_10178228
1226 Ga0207688_10024685
1227 Ga0207680_10238470
1228 Ga0207647_10003441
1229 Ga0207647_10006704
1230 Ga0207685_10010386
1231 Ga0207685_10084799
1232 Ga0207685_10180510
1233 Ga0207699_10021573
1234 Ga0207699_10041331
1235 Ga0207699_10079722
1236 Ga0207699_10144076
1237 Ga0207699_10154163
1238 Ga0207645_10000181
1239 Ga0207645_10007967
1240 Ga0207645_11122225
1241 Ga0207643_10001458
1242 Ga0207643_10039713
1243 Ga0207643_10229876
1244 Ga0207705_10034513
1245 Ga0207684_10000267
1246 Ga0207684_10006270
1247 Ga0207684_10241725
1248 Ga0207654_10006338
1249 Ga0207654_10009540
1250 Ga0207654_10039496
1251 Ga0207654_10118041
1252 Ga0207654_10151060
1253 Ga0207707_10000739
1254 Ga0207707_10003872
1255 Ga0207707_10067914
1256 Ga0207695_10032122
1257 Ga0207695_10037723
1258 Ga0207695_10039212
1259 Ga0207695_10059474
1260 Ga0207695_10131525
1261 Ga0207695_10473423
1262 Ga0207671_10404050
1263 Ga0207693_10007165
1264 Ga0207693_10025159
1265 Ga0207693_10098859
1266 Ga0207693_10149444
1267 Ga0207693_10371778
1268 Ga0207693_11215201
1269 Ga0207663_10002155
1270 Ga0207663_10027148
1271 Ga0207663_10098411
1272 Ga0207663_10111539
1273 Ga0207663_10129565
1274 Ga0207663_10134177
1275 Ga0207663_10440053
1276 Ga0207662_10013877
1277 Ga0207657_10000535
1278 Ga0207657_10010586
1279 Ga0207649_10000350
1280 Ga0207649_10020997
1281 Ga0207649_10113314
1282 Ga0207652_10130649
1283 Ga0207652_10233893
1284 Ga0207652_11093540
1285 Ga0207646_10000296
1286 Ga0207646_10055621
1287 Ga0207646_10144851
1288 Ga0207646_10168905
1289 Ga0207646_10290260
1290 Ga0207646_10435569
1291 Ga0207646_10825017
1292 Ga0207694_10001172
1293 Ga0207694_10299756
1294 Ga0207694_10343665
1295 Ga0207650_10000223
1296 Ga0207659_10611716
1297 Ga0207687_10061173
1298 Ga0207687_10232116
1299 Ga0207687_10528995
1300 Ga0207687_10653408
1301 Ga0207687_11120693
1302 Ga0207700_10003847
1303 Ga0207700_10096003
1304 Ga0207700_10217579
1305 Ga0207700_10327392
1306 Ga0207700_10393509
1307 Ga0207700_10442191
1308 Ga0207700_10527637
1309 Ga0207700_10837864
1310 Ga0207664_10003882
1311 Ga0207664_10104610
1312 Ga0207664_10139652
1313 Ga0207664_10294431
1314 Ga0207664_10313810
1315 Ga0207664_10529614
1316 Ga0207664_10539230
1317 Ga0207664_10543955
1318 Ga0207664_10762094
1319 Ga0207664_10922300
1320 Ga0207664_11280204
1321 Ga0207644_10010014
1322 Ga0207644_10050845
1323 Ga0207690_10021279
1324 Ga0207690_10237622
1325 Ga0207690_11114301
1326 Ga0207706_10000670
1327 Ga0207706_10009803
1328 Ga0207706_10097072
1329 Ga0207686_10150787
1330 Ga0207686_10167536
1331 Ga0207709_10678276
1332 Ga0207670_10028033
1333 Ga0207670_10327909
1334 Ga0207669_10215903
1335 Ga0207704_10040278
1336 Ga0207704_10173937
1337 Ga0207704_10600206
1338 Ga0207665_10001184
1339 Ga0207665_10001917
1340 Ga0207665_10012063
1341 Ga0207665_10063391
1342 Ga0207665_10099310
1343 Ga0207665_10416594
1344 Ga0207665_10443016
1345 Ga0207691_10000345
1346 Ga0207711_10025030
1347 Ga0207711_10057834
1348 Ga0207711_10218740
1349 Ga0207711_10221415
1350 Ga0207689_10000499
1351 Ga0207689_10016380
1352 Ga0207689_10285176
1353 Ga0207661_10006500
1354 Ga0207661_10017888
1355 Ga0207661_10027882
1356 Ga0207661_10199949
1357 Ga0207679_10000115
1358 Ga0207679_10023538
1359 Ga0207679_10030170
1360 Ga0207667_10000785
1361 Ga0207667_10017971
1362 Ga0207667_10051084
1363 Ga0207667_10298857
1364 Ga0207667_10460565
1365 Ga0207667_11208393
1366 Ga0207651_10003270
1367 Ga0207651_10064212
1368 Ga0207651_10857473
1369 Ga0207712_10181181
1370 Ga0207668_10144178
1371 Ga0207640_10004885
1372 Ga0207640_10020814
1373 Ga0207640_10060894
1374 Ga0207640_10094289
1375 Ga0207640_10269193
1376 Ga0207640_10465024
1377 Ga0207658_10405184
1378 Ga0207677_10002530
1379 Ga0207677_10003252
1380 Ga0207677_10004943
1381 Ga0207677_10007366
1382 Ga0207677_10010950
1383 Ga0207677_10025441
1384 Ga0207703_10007943
1385 Ga0207703_10015108
1386 Ga0207703_10025723
1387 Ga0207703_10050419
1388 Ga0207703_10134321
1389 Ga0207703_10762820
1390 Ga0207639_10089233
1391 Ga0207639_10763191
1392 Ga0207639_10858976
1393 Ga0207678_10000130
1394 Ga0207678_10001418
1395 Ga0207702_10000089
1396 Ga0207702_10001792
1397 Ga0207702_10002571
1398 Ga0207702_10003470
1399 Ga0207702_10076242
1400 Ga0207702_10175781
1401 Ga0207702_10205274
1402 Ga0207702_10430703
1403 Ga0207702_11099664
1404 Ga0207641_10000287
1405 Ga0207641_10012276
1406 Ga0207641_10032164
1407 Ga0207641_10050545
1408 Ga0207641_10425124
1409 Ga0207648_10001253
1410 Ga0207648_10065321
1411 Ga0207648_10133384
1412 Ga0207648_10482814
1413 Ga0207676_10000115
1414 Ga0207676_10001385
1415 Ga0207676_10188227
1416 Ga0207674_10000309
1417 Ga0207674_10001340
1418 Ga0207674_10008419
1419 Ga0207674_10049213
1420 Ga0207675_100013993
1421 Ga0207675_100033439
1422 Ga0207683_10000217
1423 Ga0207683_10020372
1424 Ga0207683_10182995
1425 Ga0207698_10022987
1426 Ga0207698_10118744
1427 Ga0268266_10008412
1428 Ga0268266_10017646
1429 Ga0268266_10279410
1430 Ga0268265_10060540
1431 Ga0268265_10137853
1432 Ga0268264_10016234
1433 Ga0268264_10030440
1434 Ga0268264_10111481
1435 Ga0268264_10389682
1436 Ga0268264_10520271
1437 Ga0268264_10692102
1438 Ga0373930_0058712
1439 Ga0373948_0037683
1440 Ga0373926_0001920
1441 Ga0373929_0012660
1442 Ga0373929_0049865
1443 Ga0373934_0283818
1444 Ga0373940_0032982
1445 Ga0373949_0070820
1446 Ga0373952_0124129
1447 Ga0373932_0132025
1448 Ga0373936_0030903
1449 Ga0373936_0053131
1450 Ga0373941_0104955
1451 Ga0373960_0025394
1452 Ga0373943_0016579
1453 Ga0373946_0112103
1454 Ga0373946_0397788
1455 Ga0373924_0009439
1456 Ga0373931_0025499
1457 Ga0373931_0109085
1458 Ga0373931_0143344
1459 Ga0373931_0243491
1460 Ga0373931_1021405
1461 Ga0373935_0001139
1462 Ga0373935_0099192
1463 Ga0373935_0172120
1464 Ga0373935_0889907
1465 Ga0373927_0042873
1466 Ga0373927_0169860
1467 Ga0373933_0039746
1468 Ga0373933_0115228
1469 Ga0373947_0001752
1470 Ga0373947_0028437
1471 Ga0373947_0331598
1472 Ga0373937_0011016
1473 Ga0373937_0020421
1474 Ga0373937_0152399
1475 Ga0373937_1268228
1476 Ga0373925_0011229
1477 Ga0373925_0023844
1478 Ga0373925_0543010
1479 Ga0373925_0722444
1480 Ga0373925_1288146
1481 Ga0436364_0932990
1482 Ga0436365_0987110
1483 Ga0436365_1666219
1484 Ga0436363_0502380
1485 Ga0436363_0952513
1486 Ga0436362_1059074
1487 Ga0439448_0033911
1488 Ga0466965_0338383
1489 Ga0466966_0029532
1490 Ga0466961_0110258
1491 Ga0466963_0108580
1492 Ga0453684_0884403
1493 Ga0466957_0405287
1494 Ga0466959_0075922
1495 Ga0451576_1100667
1496 Ga0466958_0131548
1497 Ga0466967_0006951
1498 Ga0466967_0041357
1499 Ga0466967_0045044
1500 Ga0466967_1367972
1501 Ga0495603_0338594
1502 Ga0495603_0620346
1503 Ga0495641_0265216
1504 Ga0495580_0001027
1505 Ga0495580_0003785
1506 Ga0495580_0004216
1507 Ga0495580_0009936
1508 Ga0495580_0031980
1509 Ga0495580_0034929
1510 Ga0495580_0037771
1511 Ga0495580_0046791
1512 Ga0495580_0076801
1513 Ga0495580_0160872
1514 Ga0495580_0181368
1515 Ga0495582_0000483
1516 Ga0495608_0686808
1517 Ga0495630_0409036
1518 Ga0495666_0013907
1519 Ga0495642_0155839
1520 Ga0495652_0559858
1521 Ga0495665_0005902
1522 Ga0495640_0237025
1523 Ga0495587_0119462
1524 Ga0495634_0327039
1525 Ga0495635_0200674
1526 Ga0495588_0132784
1527 Ga0495657_0217611
1528 Ga0495623_0049233
1529 Ga0495623_0074669
1530 Ga0495647_0115126
1531 Ga0495658_0677216
1532 Ga0495669_0059801
1533 Ga0495581_0143826
1534 Ga0495684_0125107
1535 Ga0495602_0056927
1536 Ga0495602_0066143
1537 Ga0495602_0081235
1538 Ga0495602_0425633
1539 Ga0496100_0397970
1540 Ga0496100_0751695
1541 Ga0496101_0126288
1542 Ga0496101_0337916
1543 Ga0496101_0531868
1544 Ga0496101_0703237
1545 Ga0496102_0001424
1546 Ga0496102_0119938
1547 Ga0496102_0659411
1548 Ga0496102_0846268
1549 Ga0496103_0004119
1550 Ga0496103_0052305
1551 Ga0496103_0291661
1552 Ga0496103_0393792
1553 Ga0496104_0045318
1554 Ga0496104_0079617
1555 Ga0496104_0111999
1556 Ga0496104_0219147
1557 Ga0496104_0244755
1558 Ga0496104_0292369
1559 Ga0496104_0451327
1560 Ga0496105_0163450
1561 Ga0496105_0202207
1562 Ga0496105_0468329
1563 Ga0496106_0062366
1564 Ga0496106_0132837
1565 Ga0496107_0092225
1566 Ga0496107_0110267
1567 Ga0496107_0122901
1568 Ga0496107_0473051
1569 Ga0496108_0000325
1570 Ga0496108_0781545
1571 Ga0496109_0000117
1572 Ga0496109_0303076
1573 Ga0496109_0479010
1574 Ga0496109_0502194
1575 Ga0496110_0004256
1576 Ga0496111_0116292
1577 Ga0496111_0674374
1578 Ga0496112_0000283
1579 Ga0496112_0024260
1580 Ga0496112_0036157
1581 Ga0496112_0068132
1582 Ga0496112_0086369
1583 Ga0496113_0002193
1584 Ga0496113_0302887
1585 Ga0496114_0026849
1586 Ga0496115_0003148
1587 Ga0496115_0025896
1588 Ga0496115_0068765
1589 Ga0496126_0407986
1590 nmdc:mga0n895_15801_c1
1591 nmdc:mga0n895_445489_c1
1592 nmdc:mga0n895_47_c1
1593 nmdc:mga0n895_72112_c1
1594 nmdc:mga0rr50_14437_c1
1595 nmdc:mga0rr50_190208_c1
1596 nmdc:mga0rr50_284_c1
1597 nmdc:mga0rr50_7786_c1
1598 nmdc:mga0rr50_8644_c1
1599 nmdc:mga08x19_119109_c1
1600 nmdc:mga08x19_14300_c1
1601 nmdc:mga08x19_1511_c1
1602 nmdc:mga0a205_378_c1
1603 nmdc:mga0a205_57122_c1
1604 Ga0495612_0089401
1605 Ga0495619_0121489
1606 Ga0495619_0462876

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01584

CheW

CheW-like domain

12

141

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c5v-assembly1.cif.gz_H chemotaxis core signalling unit from e protein lysed e. coli cells 0.8465 5 141
2qdl-assembly2.cif.gz_B crystal structure of scaffolding protein ttchew from thermoanaerobacter tengcongensis 0.8457 3 135
2qdl-assembly1.cif.gz_A crystal structure of scaffolding protein ttchew from thermoanaerobacter tengcongensis 0.8365 1 135
4jpb-assembly1.cif.gz_A the structure of a ternary complex between chea domains p4 and p5 with chew and with an unzipped fragment of tm14, a chemoreceptor analog from thermotoga maritima. 0.8256 3 133
2ch4-assembly2.cif.gz_B complex between bacterial chemotaxis histidine kinase chea domains p4 and p5 and receptor-adaptor protein chew 0.8217 3 134
ID Description Score Start End Superfamily
2qdlB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 0.8066 25 91 2.40.50.180
1b3qA04 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 0.804 27 90 2.40.50.180
1b3qB04 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 0.7996 27 90 2.40.50.180
af_P0A964_36_100_2.40.50.180 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 0.7906 24 87 2.40.50.180
2ch4W02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 0.7724 23 91 2.40.50.180
ID Description Score Start End GO Terms
AF-A0A5C6AWX5-F1-model_v4 Chemotaxis protein CheW 0.8917 2 140 GO:0005829
GO:0006935
GO:0007165
AF-A0A142Y888-F1-model_v4 Chemotaxis protein CheW 0.8884 1 139 GO:0005829
GO:0006935
GO:0007165
AF-A0A1I3CK13-F1-model_v4 Purine-binding chemotaxis protein CheW 0.8855 2 140 GO:0005829
GO:0006935
GO:0007165
AF-A0A7X8MFH2-F1-model_v4 Purine-binding chemotaxis protein CheW 0.8821 4 136 GO:0005829
GO:0006935
GO:0007165
AF-A0A7X8JV69-F1-model_v4 Purine-binding chemotaxis protein CheW 0.8813 1 136 GO:0005829
GO:0006935
GO:0007165

Map