F480809

General Info

Members Datasets Scaffolds Average Seq Length
786 292 1572 192

Family's Representative Sequence

Representative Sequence 3300049775|Ga0501279_018572|Ga0501279_018572_168_842
Length 224
Sequence METFIAVELREKTAAETQTARQAMSLILINVIPSAARDLLLIDPQLARRIRFVGFDVDGVLTDGGIYLGASDDPTRRLEFKRYDIQDGIGMEFLRIAGLRLGVITGRVSESVRLRAKELNIEDVAQDAQAMKLIGLQRILDERQIGWDDVAFVGDDFPDMPIMRKVGLPVAVGNATPEVRAIAKVQLTREGGRGAVREFAELLLKARGDWETTWNSYVDKRSKT

Samples

Sample ID Description Type Environment
1 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
157 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
160 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
163 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
164 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
177 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
178 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
179 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
180 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
181 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
182 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
183 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
184 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
200 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
201 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
202 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
203 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
204 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
205 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
206 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
207 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
208 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
209 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
210 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
211 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
212 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
213 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
216 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
219 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
220 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
221 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
222 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
223 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
224 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
225 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
226 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
227 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
228 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
229 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
230 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
231 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
232 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
235 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
236 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
237 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
238 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
239 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
240 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
241 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
242 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
243 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
244 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
245 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
246 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
247 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
248 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
249 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
250 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
251 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
252 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
253 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
254 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
255 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
256 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
257 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
258 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
261 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
262 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
263 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
264 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
265 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
266 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
267 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
268 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
278 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
279 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
280 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
282 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
283 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
284 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
285 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
286 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
287 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
288 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
289 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
290 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
291 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
292 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.13
Nodule 0
Rhizoplane 2.29
Rhizosphere 96.95
Stem 0
Stem Tuber 0
Unclassified 5.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501279_018572 3300049775 Bacteria 980
2 Ga0070658_10001114 3300005327 Bacteria 22934
3 Ga0070658_10016156 3300005327 Bacteria 5972
4 Ga0070658_10017067 3300005327 Bacteria 5810
5 Ga0070658_10043965 3300005327 Bacteria 3609
6 Ga0070658_10072209 3300005327 Bacteria 2827
7 Ga0070658_10093241 3300005327 Bacteria 2484
8 Ga0070658_10306050 3300005327 Bacteria 1356
9 Ga0070658_10316350 3300005327 Bacteria 1332
10 Ga0070683_100000998 3300005329 Bacteria 21199
11 Ga0070683_100008809 3300005329 Bacteria 8581
12 Ga0070683_100015102 3300005329 Bacteria 6777
13 Ga0070683_100019446 3300005329 Bacteria 6032
14 Ga0070683_100199543 3300005329 Bacteria 1900
15 Ga0070683_100210482 3300005329 Bacteria 1847
16 Ga0070683_100223644 3300005329 Bacteria 1789
17 Ga0070683_100227482 3300005329 Bacteria 1773
18 Ga0070683_100232986 3300005329 Bacteria 1751
19 Ga0070683_100393343 3300005329 Bacteria 1322
20 Ga0070683_100479142 3300005329 Bacteria 1188
21 Ga0070683_100843265 3300005329 Bacteria 879
22 Ga0070690_100014935 3300005330 Bacteria 4619
23 Ga0070670_100661641 3300005331 Unclassified 937
24 Ga0070670_100754590 3300005331 Bacteria 877
25 Ga0070666_10511767 3300005335 Bacteria 871
26 Ga0070680_100000074 3300005336 Bacteria 53742
27 Ga0070680_100003658 3300005336 Bacteria 11490
28 Ga0070680_100003960 3300005336 Bacteria 11077
29 Ga0070680_100026672 3300005336 Bacteria 4620
30 Ga0070680_100202430 3300005336 Bacteria 1674
31 Ga0070680_100219057 3300005336 Bacteria 1606
32 Ga0070680_100369607 3300005336 Unclassified 1220
33 Ga0070680_100632491 3300005336 Bacteria 919
34 Ga0070680_100842895 3300005336 Bacteria 790
35 Ga0070682_100084901 3300005337 Unclassified 2058
36 Ga0070660_100052639 3300005339 Bacteria 3139
37 Ga0070660_100068194 3300005339 Bacteria 2772
38 Ga0070660_100093893 3300005339 Bacteria 2369
39 Ga0070689_100020281 3300005340 Bacteria 4930
40 Ga0070689_101079320 3300005340 Bacteria 717
41 Ga0070691_10011786 3300005341 Bacteria 4000
42 Ga0070691_10176586 3300005341 Bacteria 1109
43 Ga0070687_100004415 3300005343 Bacteria 5605
44 Ga0070687_100387326 3300005343 Bacteria 913
45 Ga0070687_100584887 3300005343 Bacteria 765
46 Ga0070661_100026826 3300005344 Bacteria 4145
47 Ga0070661_100064353 3300005344 Bacteria 2695
48 Ga0070661_100403208 3300005344 Unclassified 1081
49 Ga0070692_10419801 3300005345 Bacteria 849
50 Ga0070668_100007114 3300005347 Bacteria 8291
51 Ga0070668_100539753 3300005347 Bacteria 1014
52 Ga0070668_101124115 3300005347 Bacteria 710
53 Ga0070669_100001817 3300005353 Bacteria 15371
54 Ga0070675_100015038 3300005354 Bacteria 6112
55 Ga0070675_100250901 3300005354 Bacteria 1549
56 Ga0070675_100252509 3300005354 Bacteria 1544
57 Ga0070671_100889530 3300005355 Bacteria 778
58 Ga0070673_100058772 3300005364 Bacteria 3042
59 Ga0070673_100182262 3300005364 Bacteria 1798
60 Ga0070673_100768698 3300005364 Unclassified 888
61 Ga0070673_101125293 3300005364 Bacteria 734
62 Ga0070673_101282380 3300005364 Bacteria 688
63 Ga0070659_100056811 3300005366 Bacteria 3085
64 Ga0070659_100389511 3300005366 Bacteria 1175
65 Ga0070667_100119608 3300005367 Bacteria 2291
66 Ga0070703_10025305 3300005406 Bacteria 1760
67 Ga0070709_10000646 3300005434 Bacteria 19800
68 Ga0070709_10006074 3300005434 Bacteria 6573
69 Ga0070709_10008582 3300005434 Bacteria 5617
70 Ga0070709_10024803 3300005434 Bacteria 3535
71 Ga0070709_10096649 3300005434 Bacteria 1959
72 Ga0070714_100004300 3300005435 Bacteria 10732
73 Ga0070714_100005439 3300005435 Bacteria 9722
74 Ga0070714_100016581 3300005435 Bacteria 5954
75 Ga0070714_100023562 3300005435 Bacteria 5061
76 Ga0070714_100057067 3300005435 Bacteria 3341
77 Ga0070714_100338290 3300005435 Bacteria 1411
78 Ga0070714_100377979 3300005435 Bacteria 1335
79 Ga0070713_100001395 3300005436 Bacteria 15475
80 Ga0070713_100002934 3300005436 Bacteria 11180
81 Ga0070713_100086419 3300005436 Bacteria 2689
82 Ga0070713_100188291 3300005436 Bacteria 1858
83 Ga0070713_100949609 3300005436 Bacteria 828
84 Ga0070710_10107088 3300005437 Bacteria 1674
85 Ga0070710_10447674 3300005437 Unclassified 875
86 Ga0070701_10055714 3300005438 Bacteria 2066
87 Ga0070711_100111220 3300005439 Bacteria 2011
88 Ga0070711_100224870 3300005439 Bacteria 1461
89 Ga0070700_100050729 3300005441 Bacteria 2580
90 Ga0070708_100000170 3300005445 Bacteria 46089
91 Ga0070662_100350816 3300005457 Bacteria 1209
92 Ga0070662_100551488 3300005457 Bacteria 966
93 Ga0070681_10000841 3300005458 Bacteria 25746
94 Ga0070681_10006114 3300005458 Bacteria 11683
95 Ga0070681_10043822 3300005458 Bacteria 4479
96 Ga0070681_10060924 3300005458 Bacteria 3750
97 Ga0070681_10065424 3300005458 Bacteria 3604
98 Ga0070681_10073945 3300005458 Bacteria 3370
99 Ga0070681_10075749 3300005458 Bacteria 3325
100 Ga0070681_11094153 3300005458 Unclassified 718
101 Ga0068867_100076644 3300005459 Bacteria 2511
102 Ga0068867_100426113 3300005459 Bacteria 1125
103 Ga0068867_100494985 3300005459 Bacteria 1050
104 Ga0070685_10073459 3300005466 Bacteria 2033
105 Ga0070706_100083519 3300005467 Bacteria 2959
106 Ga0070706_100293179 3300005467 Bacteria 1518
107 Ga0070707_100393903 3300005468 Unclassified 1345
108 Ga0070707_100403272 3300005468 Bacteria 1327
109 Ga0070698_100017608 3300005471 Bacteria 7529
110 Ga0070698_100381053 3300005471 Bacteria 1343
111 Ga0070698_100617579 3300005471 Bacteria 1025
112 Ga0070699_100088282 3300005518 Bacteria 2708
113 Ga0070679_100002482 3300005530 Bacteria 16711
114 Ga0070679_100007958 3300005530 Bacteria 9949
115 Ga0070679_100013752 3300005530 Bacteria 7754
116 Ga0070679_100020935 3300005530 Bacteria 6380
117 Ga0070679_100086496 3300005530 Bacteria 3121
118 Ga0070679_100122960 3300005530 Bacteria 2579
119 Ga0070679_100125582 3300005530 Bacteria 2548
120 Ga0070679_100153281 3300005530 Bacteria 2280
121 Ga0070679_100205280 3300005530 Unclassified 1935
122 Ga0070679_100274331 3300005530 Bacteria 1640
123 Ga0070679_100281769 3300005530 Bacteria 1615
124 Ga0070684_100003297 3300005535 Bacteria 12087
125 Ga0070684_100006265 3300005535 Bacteria 9185
126 Ga0070684_100022419 3300005535 Bacteria 5267
127 Ga0070684_100054990 3300005535 Bacteria 3468
128 Ga0070684_100169041 3300005535 Bacteria 1986
129 Ga0070684_100177422 3300005535 Bacteria 1936
130 Ga0070684_100210071 3300005535 Bacteria 1774
131 Ga0070684_100326620 3300005535 Bacteria 1410
132 Ga0070684_100940508 3300005535 Bacteria 810
133 Ga0068853_100025689 3300005539 Bacteria 4943
134 Ga0068853_100109396 3300005539 Bacteria 2453
135 Ga0068853_100166696 3300005539 Bacteria 1991
136 Ga0068853_100656163 3300005539 Bacteria 999
137 Ga0070672_100065129 3300005543 Bacteria 2882
138 Ga0070672_100200213 3300005543 Bacteria 1670
139 Ga0070672_100576622 3300005543 Bacteria 978
140 Ga0070686_100000021 3300005544 Bacteria 131944
141 Ga0070696_100012696 3300005546 Bacteria 5657
142 Ga0070693_100009669 3300005547 Bacteria 4801
143 Ga0070693_100067090 3300005547 Bacteria 2102
144 Ga0070693_100182342 3300005547 Bacteria 1352
145 Ga0070693_100276434 3300005547 Bacteria 1123
146 Ga0070665_101046555 3300005548 Unclassified 828
147 Ga0068855_100015470 3300005563 Bacteria 9185
148 Ga0068855_100059684 3300005563 Bacteria 4462
149 Ga0068855_100096106 3300005563 Bacteria 3415
150 Ga0068855_100182611 3300005563 Bacteria 2371
151 Ga0068855_100522443 3300005563 Bacteria 1288
152 Ga0068855_100908172 3300005563 Bacteria 930
153 Ga0068855_101200256 3300005563 Unclassified 789
154 Ga0070664_100033185 3300005564 Bacteria 4322
155 Ga0070664_100183157 3300005564 Bacteria 1862
156 Ga0070664_100226709 3300005564 Bacteria 1674
157 Ga0070664_100492079 3300005564 Bacteria 1130
158 Ga0070664_101015484 3300005564 Unclassified 780
159 Ga0068857_100055885 3300005577 Bacteria 3502
160 Ga0068857_100130752 3300005577 Bacteria 2264
161 Ga0068856_100060772 3300005614 Bacteria 3733
162 Ga0068856_100479948 3300005614 Bacteria 1264
163 Ga0068852_100033825 3300005616 Bacteria 4249
164 Ga0068852_100049557 3300005616 Bacteria 3593
165 Ga0068852_100283845 3300005616 Bacteria 1597
166 Ga0068859_100005677 3300005617 Bacteria 12699
167 Ga0068861_100346815 3300005719 Bacteria 1301
168 Ga0068870_10024463 3300005840 Bacteria 2988
169 Ga0068870_10083398 3300005840 Bacteria 1772
170 Ga0068858_100224032 3300005842 Bacteria 1782
171 Ga0068860_100258769 3300005843 Bacteria 1696
172 Ga0068862_100166260 3300005844 Bacteria 1972
173 Ga0081539_10000103 3300005985 Bacteria 197839
174 Ga0081539_10008986 3300005985 Bacteria 8498
175 Ga0070717_10000724 3300006028 Bacteria 21453
176 Ga0070717_10672451 3300006028 Bacteria 940
177 Ga0070715_10317804 3300006163 Bacteria 839
178 Ga0070716_100074076 3300006173 Bacteria 2011
179 Ga0070712_100074665 3300006175 Bacteria 2436
180 Ga0097621_100120255 3300006237 Bacteria 2227
181 Ga0097621_100498320 3300006237 Bacteria 1103
182 Ga0075428_100919835 3300006844 Bacteria 927
183 Ga0075430_100112056 3300006846 Unclassified 2274
184 Ga0075431_100098747 3300006847 Bacteria 3014
185 Ga0075431_100904014 3300006847 Bacteria 852
186 Ga0075433_10598239 3300006852 Bacteria 968
187 Ga0075434_100205814 3300006871 Bacteria 1988
188 Ga0075434_100348431 3300006871 Unclassified 1502
189 Ga0075434_100701808 3300006871 Bacteria 1029
190 Ga0075429_100025987 3300006880 Bacteria 5082
191 Ga0068865_100635508 3300006881 Bacteria 906
192 Ga0075436_100030353 3300006914 Bacteria 3720
193 Ga0075436_100093235 3300006914 Bacteria 2094
194 Ga0075436_100790505 3300006914 Bacteria 706
195 Ga0097620_100005677 3300006931 Bacteria 12699
196 Ga0075435_100144836 3300007076 Bacteria 1995
197 Ga0105240_10037020 3300009093 Bacteria 6272
198 Ga0105240_10048266 3300009093 Bacteria 5382
199 Ga0105240_10155081 3300009093 Bacteria 2724
200 Ga0105240_10211763 3300009093 Bacteria 2264
201 Ga0111539_10005908 3300009094 Bacteria 15813
202 Ga0111539_10036530 3300009094 Bacteria 5938
203 Ga0111539_10100096 3300009094 Bacteria 3404
204 Ga0114129_10307526 3300009147 Bacteria 2111
205 Ga0114129_10434649 3300009147 Bacteria 1724
206 Ga0114129_10610697 3300009147 Bacteria 1412
207 Ga0105243_10119936 3300009148 Bacteria 2215
208 Ga0105243_10672022 3300009148 Bacteria 1006
209 Ga0105241_10416643 3300009174 Bacteria 1181
210 Ga0105241_11072979 3300009174 Bacteria 757
211 Ga0105242_10037572 3300009176 Bacteria 3890
212 Ga0105242_11952149 3300009176 Bacteria 628
213 Ga0105248_10087348 3300009177 Bacteria 3509
214 Ga0105248_10287822 3300009177 Bacteria 1850
215 Ga0105248_10423595 3300009177 Bacteria 1499
216 Ga0105237_10276207 3300009545 Bacteria 1683
217 Ga0105237_10726408 3300009545 Bacteria 1000
218 Ga0105238_10000003 3300009551 Bacteria 422077
219 Ga0105238_10011457 3300009551 Bacteria 8929
220 Ga0105238_10088332 3300009551 Bacteria 3086
221 Ga0105238_10286082 3300009551 Unclassified 1630
222 Ga0105238_10297241 3300009551 Bacteria 1598
223 Ga0105238_10414898 3300009551 Unclassified 1340
224 Ga0105249_10001200 3300009553 Bacteria 22851
225 Ga0105246_10700600 3300011119 Bacteria 888
226 Ga0157373_10070324 3300013100 Bacteria 2473
227 Ga0157373_10122613 3300013100 Bacteria 1827
228 Ga0157373_10187445 3300013100 Bacteria 1457
229 Ga0157373_10332785 3300013100 Bacteria 1081
230 Ga0157373_10607530 3300013100 Bacteria 796
231 Ga0157371_10017382 3300013102 Bacteria 5345
232 Ga0157370_10079623 3300013104 Bacteria 3085
233 Ga0157370_10090536 3300013104 Bacteria 2872
234 Ga0157370_10107804 3300013104 Bacteria 2605
235 Ga0157370_10192130 3300013104 Bacteria 1895
236 Ga0157370_10328074 3300013104 Bacteria 1411
237 Ga0157369_10010646 3300013105 Bacteria 10469
238 Ga0157369_10026031 3300013105 Bacteria 6491
239 Ga0157369_10061680 3300013105 Bacteria 4041
240 Ga0157369_10089654 3300013105 Bacteria 3283
241 Ga0157369_10225070 3300013105 Bacteria 1962
242 Ga0157369_10573417 3300013105 Unclassified 1165
243 Ga0157369_10684485 3300013105 Unclassified 1056
244 Ga0157369_10892523 3300013105 Bacteria 912
245 Ga0157374_10130527 3300013296 Bacteria 2432
246 Ga0157378_10752149 3300013297 Bacteria 998
247 Ga0157372_10012773 3300013307 Bacteria 8947
248 Ga0157372_10015276 3300013307 Bacteria 8224
249 Ga0157372_10020075 3300013307 Bacteria 7205
250 Ga0157372_10036203 3300013307 Bacteria 5439
251 Ga0157372_10048996 3300013307 Bacteria 4696
252 Ga0157372_10050427 3300013307 Bacteria 4630
253 Ga0157372_10067368 3300013307 Bacteria 4023
254 Ga0157372_10125203 3300013307 Bacteria 2954
255 Ga0157372_10150857 3300013307 Bacteria 2683
256 Ga0157372_10346235 3300013307 Bacteria 1731
257 Ga0157372_10460341 3300013307 Bacteria 1482
258 Ga0157372_10516695 3300013307 Bacteria 1392
259 Ga0157372_10949494 3300013307 Bacteria 997
260 Ga0157372_11104411 3300013307 Bacteria 917
261 Ga0157375_10160376 3300013308 Bacteria 2390
262 Ga0157375_10234838 3300013308 Bacteria 1993
263 Ga0157375_10648486 3300013308 Bacteria 1212
264 Ga0163163_10237345 3300014325 Bacteria 1873
265 Ga0157380_10068133 3300014326 Bacteria 2868
266 Ga0182008_10016937 3300014497 Bacteria 3781
267 Ga0157377_10125966 3300014745 Bacteria 1558
268 Ga0157376_10874452 3300014969 Bacteria 915
269 Ga0206354_10213265 3300020081 Bacteria 1081
270 Ga0213875_10005055 3300021388 Bacteria 7144
271 Ga0207692_10107629 3300025898 Bacteria 1541
272 Ga0207692_10581889 3300025898 Unclassified 718
273 Ga0207688_10278518 3300025901 Bacteria 1018
274 Ga0207680_10077657 3300025903 Bacteria 2078
275 Ga0207680_10102704 3300025903 Bacteria 1840
276 Ga0207699_10000738 3300025906 Bacteria 15599
277 Ga0207699_10004727 3300025906 Bacteria 6506
278 Ga0207699_10021815 3300025906 Bacteria 3460
279 Ga0207699_10134004 3300025906 Bacteria 1620
280 Ga0207643_10006505 3300025908 Bacteria 6257
281 Ga0207705_10001545 3300025909 Bacteria 18273
282 Ga0207705_10010786 3300025909 Bacteria 6633
283 Ga0207705_10013296 3300025909 Bacteria 5939
284 Ga0207705_10016267 3300025909 Bacteria 5335
285 Ga0207705_10154244 3300025909 Bacteria 1722
286 Ga0207705_10155869 3300025909 Bacteria 1713
287 Ga0207684_10258279 3300025910 Bacteria 1503
288 Ga0207654_10084884 3300025911 Unclassified 1915
289 Ga0207707_10002577 3300025912 Bacteria 16238
290 Ga0207707_10002663 3300025912 Bacteria 15948
291 Ga0207707_10003507 3300025912 Bacteria 13889
292 Ga0207707_10037764 3300025912 Bacteria 4220
293 Ga0207707_10043443 3300025912 Bacteria 3921
294 Ga0207707_10055278 3300025912 Bacteria 3453
295 Ga0207707_10079817 3300025912 Bacteria 2857
296 Ga0207707_10157300 3300025912 Bacteria 1987
297 Ga0207707_10853664 3300025912 Bacteria 755
298 Ga0207695_10003984 3300025913 Bacteria 20376
299 Ga0207695_10006746 3300025913 Bacteria 14808
300 Ga0207695_10204929 3300025913 Bacteria 1885
301 Ga0207671_10627262 3300025914 Bacteria 856
302 Ga0207693_10009238 3300025915 Bacteria 8049
303 Ga0207663_10126006 3300025916 Bacteria 1762
304 Ga0207663_10934726 3300025916 Bacteria 694
305 Ga0207660_10000017 3300025917 Bacteria 75942
306 Ga0207660_10029655 3300025917 Bacteria 3755
307 Ga0207660_10037620 3300025917 Bacteria 3373
308 Ga0207660_10137220 3300025917 Bacteria 1867
309 Ga0207660_10159420 3300025917 Bacteria 1740
310 Ga0207660_10263525 3300025917 Unclassified 1364
311 Ga0207660_10312267 3300025917 Bacteria 1254
312 Ga0207660_10484996 3300025917 Bacteria 1002
313 Ga0207662_10002951 3300025918 Bacteria 8646
314 Ga0207662_10116902 3300025918 Bacteria 1668
315 Ga0207662_10379274 3300025918 Bacteria 955
316 Ga0207657_10000432 3300025919 Bacteria 44554
317 Ga0207657_10013214 3300025919 Bacteria 8104
318 Ga0207657_10035819 3300025919 Bacteria 4446
319 Ga0207657_10100473 3300025919 Bacteria 2401
320 Ga0207649_10048932 3300025920 Bacteria 2608
321 Ga0207649_10207371 3300025920 Bacteria 1388
322 Ga0207649_10369845 3300025920 Bacteria 1066
323 Ga0207652_10001247 3300025921 Bacteria 22702
324 Ga0207652_10008342 3300025921 Bacteria 8332
325 Ga0207652_10014004 3300025921 Bacteria 6493
326 Ga0207652_10017172 3300025921 Bacteria 5919
327 Ga0207652_10027382 3300025921 Bacteria 4750
328 Ga0207652_10122304 3300025921 Bacteria 2316
329 Ga0207652_10127472 3300025921 Bacteria 2268
330 Ga0207652_10147585 3300025921 Bacteria 2105
331 Ga0207652_10232053 3300025921 Bacteria 1663
332 Ga0207652_10397350 3300025921 Bacteria 1244
333 Ga0207646_10369183 3300025922 Bacteria 1296
334 Ga0207681_10729964 3300025923 Unclassified 825
335 Ga0207681_10882123 3300025923 Bacteria 749
336 Ga0207694_10000020 3300025924 Bacteria 310240
337 Ga0207694_10061398 3300025924 Bacteria 2925
338 Ga0207694_10210447 3300025924 Unclassified 1584
339 Ga0207650_10767580 3300025925 Bacteria 816
340 Ga0207650_10912116 3300025925 Bacteria 746
341 Ga0207659_10023641 3300025926 Bacteria 4105
342 Ga0207659_10107093 3300025926 Bacteria 2118
343 Ga0207659_10400836 3300025926 Bacteria 1147
344 Ga0207659_10439906 3300025926 Bacteria 1097
345 Ga0207659_10465969 3300025926 Bacteria 1066
346 Ga0207700_10002524 3300025928 Bacteria 10503
347 Ga0207700_10082368 3300025928 Bacteria 2516
348 Ga0207700_10116059 3300025928 Bacteria 2163
349 Ga0207700_10813602 3300025928 Bacteria 836
350 Ga0207664_10004730 3300025929 Bacteria 9242
351 Ga0207664_10027071 3300025929 Bacteria 4342
352 Ga0207664_10040832 3300025929 Bacteria 3611
353 Ga0207664_10078561 3300025929 Bacteria 2676
354 Ga0207664_10088798 3300025929 Bacteria 2530
355 Ga0207664_10296521 3300025929 Bacteria 1422
356 Ga0207644_10301846 3300025931 Unclassified 1291
357 Ga0207644_10459833 3300025931 Bacteria 1046
358 Ga0207644_10832480 3300025931 Bacteria 772
359 Ga0207690_10017280 3300025932 Bacteria 4401
360 Ga0207690_10143673 3300025932 Bacteria 1761
361 Ga0207706_10001933 3300025933 Bacteria 20354
362 Ga0207686_10026449 3300025934 Bacteria 3384
363 Ga0207686_10142930 3300025934 Bacteria 1656
364 Ga0207670_10012374 3300025936 Bacteria 4992
365 Ga0207669_10817158 3300025937 Bacteria 774
366 Ga0207704_10053287 3300025938 Bacteria 2458
367 Ga0207704_10091210 3300025938 Bacteria 2002
368 Ga0207665_10192651 3300025939 Bacteria 1482
369 Ga0207691_10062943 3300025940 Bacteria 3365
370 Ga0207691_10095956 3300025940 Bacteria 2652
371 Ga0207691_10275520 3300025940 Bacteria 1448
372 Ga0207691_10362944 3300025940 Bacteria 1238
373 Ga0207691_10510182 3300025940 Bacteria 1021
374 Ga0207711_10151949 3300025941 Bacteria 2090
375 Ga0207711_10161537 3300025941 Bacteria 2028
376 Ga0207711_10246461 3300025941 Bacteria 1639
377 Ga0207711_10638071 3300025941 Bacteria 994
378 Ga0207689_10049296 3300025942 Bacteria 3474
379 Ga0207661_10008513 3300025944 Bacteria 7333
380 Ga0207661_10015919 3300025944 Bacteria 5541
381 Ga0207661_10048848 3300025944 Bacteria 3365
382 Ga0207661_10064683 3300025944 Bacteria 2966
383 Ga0207661_10066801 3300025944 Bacteria 2922
384 Ga0207661_10119171 3300025944 Bacteria 2245
385 Ga0207661_10165881 3300025944 Bacteria 1919
386 Ga0207661_10206284 3300025944 Bacteria 1730
387 Ga0207661_10328948 3300025944 Bacteria 1375
388 Ga0207661_10416831 3300025944 Bacteria 1219
389 Ga0207679_10032268 3300025945 Bacteria 3674
390 Ga0207679_10152954 3300025945 Bacteria 1880
391 Ga0207679_10590827 3300025945 Bacteria 999
392 Ga0207679_10681369 3300025945 Unclassified 932
393 Ga0207667_10079541 3300025949 Bacteria 3397
394 Ga0207667_10279732 3300025949 Bacteria 1705
395 Ga0207667_10462838 3300025949 Bacteria 1288
396 Ga0207667_10650194 3300025949 Unclassified 1060
397 Ga0207667_10708480 3300025949 Bacteria 1009
398 Ga0207651_10408915 3300025960 Bacteria 1156
399 Ga0207651_10574278 3300025960 Bacteria 983
400 Ga0207712_10000079 3300025961 Bacteria 115164
401 Ga0207668_10013667 3300025972 Bacteria 5008
402 Ga0207668_10047474 3300025972 Bacteria 2940
403 Ga0207640_10411536 3300025981 Bacteria 1104
404 Ga0207658_10234705 3300025986 Bacteria 1550
405 Ga0207658_10561744 3300025986 Bacteria 1022
406 Ga0207703_11070643 3300026035 Bacteria 774
407 Ga0207639_10012186 3300026041 Bacteria 5983
408 Ga0207639_10028362 3300026041 Bacteria 4086
409 Ga0207678_10069283 3300026067 Bacteria 3024
410 Ga0207708_10065630 3300026075 Bacteria 2775
411 Ga0207708_10250838 3300026075 Bacteria 1426
412 Ga0207702_10795855 3300026078 Bacteria 934
413 Ga0207648_10048988 3300026089 Bacteria 3699
414 Ga0207648_10232162 3300026089 Bacteria 1641
415 Ga0207674_10011695 3300026116 Bacteria 9851
416 Ga0207674_10058570 3300026116 Bacteria 3901
417 Ga0207675_100292630 3300026118 Bacteria 1584
418 Ga0207675_100410597 3300026118 Bacteria 1336
419 Ga0207683_10456647 3300026121 Bacteria 1178
420 Ga0207698_10012614 3300026142 Bacteria 5537
421 Ga0207698_10222046 3300026142 Bacteria 1708
422 Ga0207698_11152233 3300026142 Bacteria 789
423 Ga0207698_11167994 3300026142 Bacteria 783
424 Ga0207428_10065994 3300027907 Bacteria 2852
425 Ga0268266_10606613 3300028379 Bacteria 1052
426 Ga0265332_10077541 3300031238 Bacteria 1411
427 Ga0265331_10108666 3300031250 Bacteria 1273
428 Ga0307408_100041816 3300031548 Bacteria 3251
429 Ga0307408_100069207 3300031548 Bacteria 2602
430 Ga0307408_100300070 3300031548 Bacteria 1345
431 Ga0307408_100310367 3300031548 Bacteria 1325
432 Ga0307408_100996742 3300031548 Unclassified 772
433 Ga0316575_10037271 3300031665 Bacteria 1915
434 Ga0316579_10098519 3300031691 Bacteria 1399
435 Ga0265314_10008084 3300031711 Bacteria 9052
436 Ga0265342_10025984 3300031712 Bacteria 3674
437 Ga0316576_10112962 3300031727 Bacteria 2037
438 Ga0316578_10093533 3300031728 Bacteria 1798
439 Ga0316578_10239939 3300031728 Bacteria 1088
440 Ga0307405_10000062 3300031731 Bacteria 51691
441 Ga0307405_10047709 3300031731 Bacteria 2638
442 Ga0307405_10246789 3300031731 Bacteria 1326
443 Ga0307405_10862795 3300031731 Unclassified 763
444 Ga0307413_10003328 3300031824 Bacteria 6752
445 Ga0307413_10006199 3300031824 Bacteria 5433
446 Ga0307413_10015718 3300031824 Bacteria 3886
447 Ga0307413_10306730 3300031824 Bacteria 1206
448 Ga0307413_10391437 3300031824 Bacteria 1086
449 Ga0307413_10565419 3300031824 Bacteria 925
450 Ga0307410_10005403 3300031852 Bacteria 6757
451 Ga0307410_10006923 3300031852 Bacteria 6163
452 Ga0307410_10044713 3300031852 Bacteria 2943
453 Ga0307410_10096233 3300031852 Bacteria 2113
454 Ga0307410_10243270 3300031852 Bacteria 1395
455 Ga0307410_10252697 3300031852 Bacteria 1371
456 Ga0307410_10288186 3300031852 Bacteria 1291
457 Ga0307410_10535599 3300031852 Bacteria 968
458 Ga0307406_10002199 3300031901 Bacteria 10617
459 Ga0307406_10010801 3300031901 Bacteria 5159
460 Ga0307406_10036945 3300031901 Bacteria 3012
461 Ga0307406_10143080 3300031901 Bacteria 1696
462 Ga0307406_10797810 3300031901 Bacteria 796
463 Ga0307407_10000240 3300031903 Bacteria 16149
464 Ga0307407_10008711 3300031903 Bacteria 4675
465 Ga0307407_10030401 3300031903 Bacteria 2913
466 Ga0307407_10069936 3300031903 Bacteria 2085
467 Ga0307407_10075374 3300031903 Bacteria 2022
468 Ga0307407_10186532 3300031903 Bacteria 1379
469 Ga0307407_10433412 3300031903 Bacteria 950
470 Ga0307407_10438873 3300031903 Bacteria 945
471 Ga0307412_10004393 3300031911 Bacteria 7859
472 Ga0307412_10096301 3300031911 Bacteria 2083
473 Ga0307412_10210271 3300031911 Bacteria 1484
474 Ga0307412_10353387 3300031911 Bacteria 1181
475 Ga0307409_100000540 3300031995 Bacteria 16375
476 Ga0307409_100000760 3300031995 Bacteria 14560
477 Ga0307409_100002331 3300031995 Bacteria 9867
478 Ga0307409_100050922 3300031995 Bacteria 3166
479 Ga0307409_100075528 3300031995 Bacteria 2698
480 Ga0307409_100165070 3300031995 Bacteria 1942
481 Ga0307409_100208369 3300031995 Bacteria 1755
482 Ga0307409_100402781 3300031995 Bacteria 1307
483 Ga0307409_100526505 3300031995 Bacteria 1156
484 Ga0307409_100763154 3300031995 Bacteria 972
485 Ga0307416_100000492 3300032002 Bacteria 20070
486 Ga0307416_100003946 3300032002 Bacteria 8834
487 Ga0307416_100069290 3300032002 Bacteria 2918
488 Ga0307416_100220611 3300032002 Bacteria 1818
489 Ga0307416_100304485 3300032002 Unclassified 1586
490 Ga0307416_100802741 3300032002 Unclassified 1037
491 Ga0307414_10018514 3300032004 Bacteria 4291
492 Ga0307414_10037427 3300032004 Bacteria 3249
493 Ga0307414_10052536 3300032004 Bacteria 2836
494 Ga0307414_10266115 3300032004 Bacteria 1433
495 Ga0307411_10003192 3300032005 Bacteria 7544
496 Ga0307411_10007372 3300032005 Bacteria 5596
497 Ga0307411_10040521 3300032005 Bacteria 2955
498 Ga0307411_10070680 3300032005 Bacteria 2363
499 Ga0307415_100000261 3300032126 Bacteria 22792
500 Ga0307415_100048453 3300032126 Bacteria 2867
501 Ga0307415_100166478 3300032126 Bacteria 1714
502 Ga0307415_100176734 3300032126 Unclassified 1671
503 Ga0307415_100179811 3300032126 Bacteria 1658
504 Ga0307415_100333592 3300032126 Bacteria 1270
505 Ga0373959_0000021 3300034820 Bacteria 38598
506 Ga0373926_0004775 3300035083 Bacteria 4455
507 Ga0373926_0016086 3300035083 Bacteria 2555
508 Ga0373934_0004782 3300035086 Bacteria 5009
509 Ga0373934_0077664 3300035086 Bacteria 1332
510 Ga0373934_0102276 3300035086 Unclassified 1158
511 Ga0373934_0421612 3300035086 Bacteria 558
512 Ga0373944_0021890 3300035089 Bacteria 1854
513 Ga0373941_0105352 3300035115 Bacteria 987
514 Ga0373945_0108100 3300035116 Bacteria 1095
515 Ga0373953_0005414 3300035117 Bacteria 4142
516 Ga0373953_0046730 3300035117 Bacteria 1739
517 Ga0373954_0011057 3300035118 Bacteria 3995
518 Ga0373956_0009050 3300035119 Bacteria 4038
519 Ga0373956_0025572 3300035119 Bacteria 2553
520 Ga0373943_0004278 3300035170 Bacteria 6483
521 Ga0373943_0090607 3300035170 Bacteria 1583
522 Ga0373943_0491175 3300035170 Bacteria 717
523 Ga0373946_0281286 3300035171 Unclassified 818
524 Ga0373946_0328089 3300035171 Bacteria 761
525 Ga0373955_0019000 3300035172 Bacteria 3427
526 Ga0373955_0024565 3300035172 Bacteria 3083
527 Ga0373955_0556613 3300035172 Bacteria 702
528 Ga0373924_0012723 3300035410 Bacteria 3148
529 Ga0373935_0006879 3300035692 Bacteria 6792
530 Ga0373935_0089525 3300035692 Bacteria 2013
531 Ga0373935_0288925 3300035692 Bacteria 1156
532 Ga0373935_0384007 3300035692 Bacteria 1006
533 Ga0373927_0006407 3300035695 Bacteria 8020
534 Ga0373927_0208955 3300035695 Bacteria 1282
535 Ga0373933_0000353 3300035724 Bacteria 29440
536 Ga0373933_0196962 3300035724 Unclassified 1288
537 Ga0373933_0364215 3300035724 Bacteria 940
538 Ga0373947_0005140 3300035725 Bacteria 7664
539 Ga0373937_0000195 3300036401 Bacteria 59262
540 Ga0373937_0002043 3300036401 Bacteria 16865
541 Ga0373937_0235537 3300036401 Bacteria 1724
542 Ga0373937_0522586 3300036401 Bacteria 1128
543 Ga0316584_0098890 3300036712 Bacteria 2184
544 Ga0373925_0011281 3300037068 Bacteria 6481
545 Ga0373925_0029128 3300037068 Bacteria 4050
546 Ga0373925_0041765 3300037068 Bacteria 3401
547 Ga0373925_0587063 3300037068 Unclassified 917
548 Ga0395899_0427719 3300037312 Bacteria 871
549 Ga0395898_0260225 3300037466 Bacteria 1655
550 Ga0395905_0107545 3300037471 Bacteria 2618
551 Ga0436364_0844897 3300037853 Bacteria 921
552 Ga0436364_1042167 3300037853 Bacteria 11868
553 Ga0436365_0805490 3300039437 Bacteria 2730
554 Ga0436365_1488001 3300039437 Unclassified 830
555 Ga0439446_0105574 3300042156 Bacteria 894
556 Ga0439434_0007080 3300042435 Bacteria 3278
557 Ga0439434_0055446 3300042435 Bacteria 1234
558 Ga0451577_0020671 3300042876 Bacteria 6037
559 Ga0451577_0094319 3300042876 Bacteria 2672
560 Ga0451577_0126674 3300042876 Bacteria 2288
561 Ga0466969_0080256 3300044656 Bacteria 1558
562 Ga0466966_0063029 3300044684 Bacteria 2337
563 Ga0466961_0002277 3300044693 Bacteria 11912
564 Ga0466961_0438187 3300044693 Bacteria 791
565 Ga0466963_0167691 3300044694 Bacteria 1530
566 Ga0453684_0000886 3300044712 Bacteria 100081
567 Ga0453684_0036403 3300044712 Bacteria 6784
568 Ga0453684_0080579 3300044712 Bacteria 4064
569 Ga0451576_0143901 3300045051 Bacteria 2486
570 Ga0451576_0183611 3300045051 Bacteria 2184
571 Ga0451576_0316319 3300045051 Bacteria 1633
572 Ga0451576_1320381 3300045051 Bacteria 752
573 Ga0466958_0050919 3300045836 Bacteria 2507
574 Ga0466967_0037527 3300045976 Bacteria 4148
575 Ga0466967_0043141 3300045976 Bacteria 3904
576 Ga0466967_0061864 3300045976 Bacteria 3322
577 Ga0466967_0118299 3300045976 Bacteria 2444
578 Ga0466967_1242466 3300045976 Bacteria 742
579 Ga0495592_0018023 3300046454 Bacteria 5363
580 Ga0495592_0060271 3300046454 Bacteria 2792
581 Ga0495592_0123862 3300046454 Bacteria 1816
582 Ga0495603_0016475 3300046455 Bacteria 4472
583 Ga0495603_0156692 3300046455 Bacteria 1322
584 Ga0495603_0245089 3300046455 Bacteria 1032
585 Ga0495603_0479653 3300046455 Bacteria 712
586 Ga0495629_0001690 3300046459 Bacteria 17329
587 Ga0495629_0021040 3300046459 Bacteria 4655
588 Ga0495629_0050832 3300046459 Bacteria 2902
589 Ga0495629_0052006 3300046459 Bacteria 2867
590 Ga0495629_0206954 3300046459 Bacteria 1356
591 Ga0495629_0302105 3300046459 Bacteria 1096
592 Ga0495651_0000050 3300046462 Bacteria 87816
593 Ga0495651_0017926 3300046462 Bacteria 5483
594 Ga0495653_0000134 3300046463 Bacteria 61770
595 Ga0495653_0096569 3300046463 Bacteria 2148
596 Ga0495580_0003170 3300046472 Bacteria 14100
597 Ga0495580_0006164 3300046472 Bacteria 9799
598 Ga0495580_0034628 3300046472 Bacteria 3635
599 Ga0495582_0008505 3300046473 Bacteria 5661
600 Ga0495639_0000903 3300046475 Bacteria 13407
601 Ga0495639_0008185 3300046475 Bacteria 4491
602 Ga0495639_0055557 3300046475 Bacteria 1806
603 Ga0495662_0197270 3300046476 Bacteria 992
604 Ga0495662_0294699 3300046476 Bacteria 798
605 Ga0495664_0078750 3300046477 Bacteria 1974
606 Ga0495664_0152691 3300046477 Bacteria 1401
607 Ga0495664_0240849 3300046477 Bacteria 1094
608 Ga0495664_0517703 3300046477 Bacteria 712
609 Ga0495594_0004130 3300046499 Bacteria 7459
610 Ga0495594_0005178 3300046499 Bacteria 6702
611 Ga0495594_0013658 3300046499 Bacteria 4243
612 Ga0495594_0027266 3300046499 Bacteria 3078
613 Ga0495594_0067904 3300046499 Bacteria 1979
614 Ga0495594_0160696 3300046499 Bacteria 1277
615 Ga0495608_0000381 3300046511 Bacteria 30883
616 Ga0495608_0045522 3300046511 Bacteria 2923
617 Ga0495608_0089810 3300046511 Bacteria 1988
618 Ga0495608_0188107 3300046511 Bacteria 1304
619 Ga0495628_0001915 3300046516 Bacteria 18878
620 Ga0495628_0379414 3300046516 Bacteria 1035
621 Ga0495630_0012627 3300046517 Bacteria 6137
622 Ga0495630_0017000 3300046517 Bacteria 5324
623 Ga0495630_0108728 3300046517 Bacteria 2100
624 Ga0495630_0230842 3300046517 Bacteria 1414
625 Ga0495630_0401463 3300046517 Bacteria 1050
626 Ga0495643_0000104 3300046522 Bacteria 140570
627 Ga0495666_0245615 3300046526 Bacteria 816
628 Ga0495652_0001266 3300046529 Bacteria 28253
629 Ga0495652_0031522 3300046529 Bacteria 4642
630 Ga0495652_0207723 3300046529 Bacteria 1481
631 Ga0495652_0605932 3300046529 Bacteria 746
632 Ga0495665_0002117 3300046531 Bacteria 10750
633 Ga0495665_0012951 3300046531 Bacteria 4513
634 Ga0495665_0077287 3300046531 Bacteria 1752
635 Ga0495665_0174464 3300046531 Bacteria 1118
636 Ga0495665_0280242 3300046531 Unclassified 855
637 Ga0495640_0062342 3300046533 Bacteria 2529
638 Ga0495640_0088182 3300046533 Bacteria 2051
639 Ga0495586_0009653 3300046535 Bacteria 5138
640 Ga0495586_0022649 3300046535 Bacteria 3352
641 Ga0495586_0030117 3300046535 Bacteria 2905
642 Ga0495586_0063216 3300046535 Bacteria 2016
643 Ga0495586_0130630 3300046535 Bacteria 1406
644 Ga0495587_0000114 3300046536 Bacteria 61671
645 Ga0495587_0007786 3300046536 Bacteria 6922
646 Ga0495587_0013556 3300046536 Bacteria 5121
647 Ga0495587_0021098 3300046536 Bacteria 4018
648 Ga0495645_0000065 3300046543 Bacteria 73256
649 Ga0495645_0002208 3300046543 Bacteria 13243
650 Ga0495645_0123115 3300046543 Bacteria 1824
651 Ga0495622_0071669 3300046557 Bacteria 1599
652 Ga0495667_0002423 3300046559 Bacteria 12454
653 Ga0495667_0003451 3300046559 Bacteria 10596
654 Ga0495667_0015640 3300046559 Bacteria 5130
655 Ga0495667_0058272 3300046559 Bacteria 2537
656 Ga0495667_0095976 3300046559 Bacteria 1919
657 Ga0495667_0397600 3300046559 Bacteria 868
658 Ga0495634_0109878 3300046642 Bacteria 1774
659 Ga0495635_0003351 3300046663 Bacteria 11077
660 Ga0495635_0043467 3300046663 Bacteria 3100
661 Ga0495635_0116132 3300046663 Bacteria 1827
662 Ga0495635_0180243 3300046663 Bacteria 1436
663 Ga0495635_0396924 3300046663 Bacteria 916
664 Ga0495588_0005919 3300046674 Bacteria 5481
665 Ga0495657_0001662 3300046675 Bacteria 19126
666 Ga0495657_0030783 3300046675 Bacteria 3755
667 Ga0495657_0148454 3300046675 Bacteria 1457
668 Ga0495657_0274031 3300046675 Bacteria 1011
669 Ga0495599_0000754 3300046678 Bacteria 18240
670 Ga0495599_0007473 3300046678 Bacteria 6625
671 Ga0495599_0010353 3300046678 Bacteria 5703
672 Ga0495599_0181390 3300046678 Bacteria 1297
673 Ga0495623_0002056 3300046679 Bacteria 13505
674 Ga0495623_0003506 3300046679 Bacteria 10381
675 Ga0495623_0036760 3300046679 Bacteria 3136
676 Ga0495623_0065317 3300046679 Bacteria 2276
677 Ga0495623_0079263 3300046679 Bacteria 2035
678 Ga0495623_0316908 3300046679 Bacteria 857
679 Ga0495646_0004169 3300046680 Bacteria 9082
680 Ga0495646_0112680 3300046680 Bacteria 1547
681 Ga0495647_0096138 3300046681 Bacteria 1221
682 Ga0495658_0001488 3300046683 Bacteria 12287
683 Ga0495658_0249331 3300046683 Unclassified 1116
684 Ga0495658_0331438 3300046683 Bacteria 966
685 Ga0495613_0014578 3300046689 Bacteria 5829
686 Ga0495613_0059945 3300046689 Bacteria 2788
687 Ga0495613_0155507 3300046689 Bacteria 1629
688 Ga0495613_0570180 3300046689 Bacteria 756
689 Ga0495600_0000023 3300046809 Bacteria 94401
690 Ga0495600_0056058 3300046809 Bacteria 2574
691 Ga0495581_0001793 3300047315 Bacteria 11992
692 Ga0495581_0037017 3300047315 Bacteria 2823
693 Ga0495581_0387812 3300047315 Bacteria 815
694 Ga0495604_0003267 3300047317 Bacteria 12953
695 Ga0495604_0050107 3300047317 Bacteria 3243
696 Ga0495604_0131109 3300047317 Bacteria 1801
697 Ga0495604_0239899 3300047317 Bacteria 1240
698 Ga0495674_0000339 3300047319 Bacteria 41326
699 Ga0495674_0050483 3300047319 Bacteria 3670
700 Ga0495674_0155865 3300047319 Bacteria 1913
701 Ga0495672_0004839 3300047320 Bacteria 10850
702 Ga0495676_0811639 3300047321 Unclassified 602
703 Ga0495680_0001928 3300047322 Bacteria 21805
704 Ga0495680_0063239 3300047322 Bacteria 2842
705 Ga0495680_0223498 3300047322 Bacteria 1343
706 Ga0495675_0009806 3300047444 Bacteria 5971
707 Ga0495675_0027738 3300047444 Bacteria 3609
708 Ga0495675_0039611 3300047444 Bacteria 3001
709 Ga0495675_0096722 3300047444 Bacteria 1851
710 Ga0495675_0168400 3300047444 Bacteria 1346
711 Ga0495675_0179781 3300047444 Bacteria 1295
712 Ga0495684_0000037 3300047471 Bacteria 106933
713 Ga0495684_0002171 3300047471 Bacteria 15715
714 Ga0495684_0008791 3300047471 Bacteria 7806
715 Ga0495684_0159964 3300047471 Bacteria 1680
716 Ga0495684_0275345 3300047471 Bacteria 1216
717 Ga0495684_0306368 3300047471 Bacteria 1139
718 Ga0495593_0001571 3300047673 Bacteria 13485
719 Ga0495593_0059859 3300047673 Bacteria 1995
720 Ga0495602_0010122 3300048088 Bacteria 9789
721 Ga0495602_0049375 3300048088 Bacteria 3769
722 Ga0495602_0103208 3300048088 Bacteria 2335
723 Ga0495614_0025780 3300048089 Bacteria 2535
724 Ga0496100_0278452 3300048903 Bacteria 1246
725 Ga0496101_0025592 3300048904 Bacteria 4096
726 Ga0496104_0035371 3300048907 Bacteria 4664
727 Ga0496104_0117304 3300048907 Bacteria 2555
728 Ga0496104_0501675 3300048907 Bacteria 1125
729 Ga0496106_0101296 3300048909 Bacteria 2234
730 Ga0496106_0320524 3300048909 Bacteria 1244
731 Ga0496107_0123871 3300048910 Bacteria 1905
732 Ga0496107_0389659 3300048910 Bacteria 1036
733 Ga0496108_0247963 3300048911 Bacteria 1549
734 Ga0496109_0246457 3300048912 Bacteria 1682
735 Ga0496109_0831887 3300048912 Bacteria 861
736 Ga0496112_0118778 3300048915 Bacteria 2614
737 Ga0496113_0085136 3300048916 Bacteria 2428
738 Ga0496115_0077783 3300048918 Bacteria 2698
739 Ga0496115_0205543 3300048918 Bacteria 1626
740 Ga0496115_0210651 3300048918 Bacteria 1605
741 Ga0496115_0255073 3300048918 Bacteria 1443
742 Ga0501033_0019269 3300049570 Bacteria 5157
743 Ga0501034_0022952 3300049571 Bacteria 6358
744 Ga0501036_0212319 3300049572 Bacteria 1626
745 Ga0501037_0535953 3300049573 Bacteria 791
746 Ga0501038_0041349 3300049574 Bacteria 4020
747 Ga0501038_0200162 3300049574 Bacteria 1603
748 Ga0501041_0349535 3300049577 Bacteria 934
749 Ga0501043_0028884 3300049579 Bacteria 4353
750 Ga0501043_0073476 3300049579 Bacteria 2686
751 Ga0501046_0107654 3300049580 Bacteria 2133
752 Ga0501047_0146062 3300049581 Bacteria 2242
753 Ga0501047_0155769 3300049581 Bacteria 2158
754 Ga0501047_0326253 3300049581 Bacteria 1374
755 Ga0501070_0048769 3300049586 Bacteria 3517
756 Ga0501070_0076149 3300049586 Bacteria 2778
757 Ga0501070_0207231 3300049586 Bacteria 1610
758 Ga0501249_030386 3300049679 Bacteria 1203
759 Ga0501080_0532003 3300049742 Bacteria 1048
760 Ga0501080_1161016 3300049742 Bacteria 665
761 Ga0501035_0114086 3300049822 Bacteria 2367
762 Ga0501035_0170999 3300049822 Bacteria 1877
763 Ga0501044_0143728 3300049823 Bacteria 2373
764 Ga0501044_0150982 3300049823 Bacteria 2305
765 Ga0501044_0577625 3300049823 Bacteria 1019
766 nmdc:mga06r32_290452_c1 3300050510 Bacteria 1622
767 nmdc:mga08y16_190010_c1 3300050511 Bacteria 2130
768 nmdc:mga08y16_27618_c1 3300050511 Bacteria 5979
769 nmdc:mga0n895_183986_c1 3300050512 Bacteria 2121
770 nmdc:mga0n895_315849_c1 3300050512 Unclassified 1583
771 nmdc:mga0rr50_124474_c1 3300050513 Bacteria 2056
772 nmdc:mga0rr50_879215_c1 3300050513 Unclassified 764
773 nmdc:mga08x19_293797_c1 3300050514 Bacteria 1128
774 nmdc:mga08x19_383913_c1 3300050514 Bacteria 984
775 nmdc:mga08x19_673387_c1 3300050514 Bacteria 734
776 nmdc:mga08x19_76661_c1 3300050514 Bacteria 2188
777 nmdc:mga0a205_571282_c1 3300050515 Bacteria 985
778 Ga0495601_0007462 3300053077 Bacteria 6415
779 Ga0495601_0705722 3300053077 Bacteria 643
780 Ga0495612_0000696 3300053078 Bacteria 13595
781 Ga0495612_0186941 3300053078 Bacteria 911
782 Ga0495595_0005871 3300053084 Bacteria 4977
783 Ga0495619_0006044 3300053085 Bacteria 7670
784 Ga0495619_0162533 3300053085 Bacteria 1543
785 Ga0495619_0433920 3300053085 Bacteria 906
786 Ga0500628_000510 3300053129 Bacteria 7229
787 Ga0501279_018572
788 Ga0070658_10001114
789 Ga0070658_10016156
790 Ga0070658_10017067
791 Ga0070658_10043965
792 Ga0070658_10072209
793 Ga0070658_10093241
794 Ga0070658_10306050
795 Ga0070658_10316350
796 Ga0070683_100000998
797 Ga0070683_100008809
798 Ga0070683_100015102
799 Ga0070683_100019446
800 Ga0070683_100199543
801 Ga0070683_100210482
802 Ga0070683_100223644
803 Ga0070683_100227482
804 Ga0070683_100232986
805 Ga0070683_100393343
806 Ga0070683_100479142
807 Ga0070683_100843265
808 Ga0070690_100014935
809 Ga0070670_100661641
810 Ga0070670_100754590
811 Ga0070666_10511767
812 Ga0070680_100000074
813 Ga0070680_100003658
814 Ga0070680_100003960
815 Ga0070680_100026672
816 Ga0070680_100202430
817 Ga0070680_100219057
818 Ga0070680_100369607
819 Ga0070680_100632491
820 Ga0070680_100842895
821 Ga0070682_100084901
822 Ga0070660_100052639
823 Ga0070660_100068194
824 Ga0070660_100093893
825 Ga0070689_100020281
826 Ga0070689_101079320
827 Ga0070691_10011786
828 Ga0070691_10176586
829 Ga0070687_100004415
830 Ga0070687_100387326
831 Ga0070687_100584887
832 Ga0070661_100026826
833 Ga0070661_100064353
834 Ga0070661_100403208
835 Ga0070692_10419801
836 Ga0070668_100007114
837 Ga0070668_100539753
838 Ga0070668_101124115
839 Ga0070669_100001817
840 Ga0070675_100015038
841 Ga0070675_100250901
842 Ga0070675_100252509
843 Ga0070671_100889530
844 Ga0070673_100058772
845 Ga0070673_100182262
846 Ga0070673_100768698
847 Ga0070673_101125293
848 Ga0070673_101282380
849 Ga0070659_100056811
850 Ga0070659_100389511
851 Ga0070667_100119608
852 Ga0070703_10025305
853 Ga0070709_10000646
854 Ga0070709_10006074
855 Ga0070709_10008582
856 Ga0070709_10024803
857 Ga0070709_10096649
858 Ga0070714_100004300
859 Ga0070714_100005439
860 Ga0070714_100016581
861 Ga0070714_100023562
862 Ga0070714_100057067
863 Ga0070714_100338290
864 Ga0070714_100377979
865 Ga0070713_100001395
866 Ga0070713_100002934
867 Ga0070713_100086419
868 Ga0070713_100188291
869 Ga0070713_100949609
870 Ga0070710_10107088
871 Ga0070710_10447674
872 Ga0070701_10055714
873 Ga0070711_100111220
874 Ga0070711_100224870
875 Ga0070700_100050729
876 Ga0070708_100000170
877 Ga0070662_100350816
878 Ga0070662_100551488
879 Ga0070681_10000841
880 Ga0070681_10006114
881 Ga0070681_10043822
882 Ga0070681_10060924
883 Ga0070681_10065424
884 Ga0070681_10073945
885 Ga0070681_10075749
886 Ga0070681_11094153
887 Ga0068867_100076644
888 Ga0068867_100426113
889 Ga0068867_100494985
890 Ga0070685_10073459
891 Ga0070706_100083519
892 Ga0070706_100293179
893 Ga0070707_100393903
894 Ga0070707_100403272
895 Ga0070698_100017608
896 Ga0070698_100381053
897 Ga0070698_100617579
898 Ga0070699_100088282
899 Ga0070679_100002482
900 Ga0070679_100007958
901 Ga0070679_100013752
902 Ga0070679_100020935
903 Ga0070679_100086496
904 Ga0070679_100122960
905 Ga0070679_100125582
906 Ga0070679_100153281
907 Ga0070679_100205280
908 Ga0070679_100274331
909 Ga0070679_100281769
910 Ga0070684_100003297
911 Ga0070684_100006265
912 Ga0070684_100022419
913 Ga0070684_100054990
914 Ga0070684_100169041
915 Ga0070684_100177422
916 Ga0070684_100210071
917 Ga0070684_100326620
918 Ga0070684_100940508
919 Ga0068853_100025689
920 Ga0068853_100109396
921 Ga0068853_100166696
922 Ga0068853_100656163
923 Ga0070672_100065129
924 Ga0070672_100200213
925 Ga0070672_100576622
926 Ga0070686_100000021
927 Ga0070696_100012696
928 Ga0070693_100009669
929 Ga0070693_100067090
930 Ga0070693_100182342
931 Ga0070693_100276434
932 Ga0070665_101046555
933 Ga0068855_100015470
934 Ga0068855_100059684
935 Ga0068855_100096106
936 Ga0068855_100182611
937 Ga0068855_100522443
938 Ga0068855_100908172
939 Ga0068855_101200256
940 Ga0070664_100033185
941 Ga0070664_100183157
942 Ga0070664_100226709
943 Ga0070664_100492079
944 Ga0070664_101015484
945 Ga0068857_100055885
946 Ga0068857_100130752
947 Ga0068856_100060772
948 Ga0068856_100479948
949 Ga0068852_100033825
950 Ga0068852_100049557
951 Ga0068852_100283845
952 Ga0068859_100005677
953 Ga0068861_100346815
954 Ga0068870_10024463
955 Ga0068870_10083398
956 Ga0068858_100224032
957 Ga0068860_100258769
958 Ga0068862_100166260
959 Ga0081539_10000103
960 Ga0081539_10008986
961 Ga0070717_10000724
962 Ga0070717_10672451
963 Ga0070715_10317804
964 Ga0070716_100074076
965 Ga0070712_100074665
966 Ga0097621_100120255
967 Ga0097621_100498320
968 Ga0075428_100919835
969 Ga0075430_100112056
970 Ga0075431_100098747
971 Ga0075431_100904014
972 Ga0075433_10598239
973 Ga0075434_100205814
974 Ga0075434_100348431
975 Ga0075434_100701808
976 Ga0075429_100025987
977 Ga0068865_100635508
978 Ga0075436_100030353
979 Ga0075436_100093235
980 Ga0075436_100790505
981 Ga0097620_100005677
982 Ga0075435_100144836
983 Ga0105240_10037020
984 Ga0105240_10048266
985 Ga0105240_10155081
986 Ga0105240_10211763
987 Ga0111539_10005908
988 Ga0111539_10036530
989 Ga0111539_10100096
990 Ga0114129_10307526
991 Ga0114129_10434649
992 Ga0114129_10610697
993 Ga0105243_10119936
994 Ga0105243_10672022
995 Ga0105241_10416643
996 Ga0105241_11072979
997 Ga0105242_10037572
998 Ga0105242_11952149
999 Ga0105248_10087348
1000 Ga0105248_10287822
1001 Ga0105248_10423595
1002 Ga0105237_10276207
1003 Ga0105237_10726408
1004 Ga0105238_10000003
1005 Ga0105238_10011457
1006 Ga0105238_10088332
1007 Ga0105238_10286082
1008 Ga0105238_10297241
1009 Ga0105238_10414898
1010 Ga0105249_10001200
1011 Ga0105246_10700600
1012 Ga0157373_10070324
1013 Ga0157373_10122613
1014 Ga0157373_10187445
1015 Ga0157373_10332785
1016 Ga0157373_10607530
1017 Ga0157371_10017382
1018 Ga0157370_10079623
1019 Ga0157370_10090536
1020 Ga0157370_10107804
1021 Ga0157370_10192130
1022 Ga0157370_10328074
1023 Ga0157369_10010646
1024 Ga0157369_10026031
1025 Ga0157369_10061680
1026 Ga0157369_10089654
1027 Ga0157369_10225070
1028 Ga0157369_10573417
1029 Ga0157369_10684485
1030 Ga0157369_10892523
1031 Ga0157374_10130527
1032 Ga0157378_10752149
1033 Ga0157372_10012773
1034 Ga0157372_10015276
1035 Ga0157372_10020075
1036 Ga0157372_10036203
1037 Ga0157372_10048996
1038 Ga0157372_10050427
1039 Ga0157372_10067368
1040 Ga0157372_10125203
1041 Ga0157372_10150857
1042 Ga0157372_10346235
1043 Ga0157372_10460341
1044 Ga0157372_10516695
1045 Ga0157372_10949494
1046 Ga0157372_11104411
1047 Ga0157375_10160376
1048 Ga0157375_10234838
1049 Ga0157375_10648486
1050 Ga0163163_10237345
1051 Ga0157380_10068133
1052 Ga0182008_10016937
1053 Ga0157377_10125966
1054 Ga0157376_10874452
1055 Ga0206354_10213265
1056 Ga0213875_10005055
1057 Ga0207692_10107629
1058 Ga0207692_10581889
1059 Ga0207688_10278518
1060 Ga0207680_10077657
1061 Ga0207680_10102704
1062 Ga0207699_10000738
1063 Ga0207699_10004727
1064 Ga0207699_10021815
1065 Ga0207699_10134004
1066 Ga0207643_10006505
1067 Ga0207705_10001545
1068 Ga0207705_10010786
1069 Ga0207705_10013296
1070 Ga0207705_10016267
1071 Ga0207705_10154244
1072 Ga0207705_10155869
1073 Ga0207684_10258279
1074 Ga0207654_10084884
1075 Ga0207707_10002577
1076 Ga0207707_10002663
1077 Ga0207707_10003507
1078 Ga0207707_10037764
1079 Ga0207707_10043443
1080 Ga0207707_10055278
1081 Ga0207707_10079817
1082 Ga0207707_10157300
1083 Ga0207707_10853664
1084 Ga0207695_10003984
1085 Ga0207695_10006746
1086 Ga0207695_10204929
1087 Ga0207671_10627262
1088 Ga0207693_10009238
1089 Ga0207663_10126006
1090 Ga0207663_10934726
1091 Ga0207660_10000017
1092 Ga0207660_10029655
1093 Ga0207660_10037620
1094 Ga0207660_10137220
1095 Ga0207660_10159420
1096 Ga0207660_10263525
1097 Ga0207660_10312267
1098 Ga0207660_10484996
1099 Ga0207662_10002951
1100 Ga0207662_10116902
1101 Ga0207662_10379274
1102 Ga0207657_10000432
1103 Ga0207657_10013214
1104 Ga0207657_10035819
1105 Ga0207657_10100473
1106 Ga0207649_10048932
1107 Ga0207649_10207371
1108 Ga0207649_10369845
1109 Ga0207652_10001247
1110 Ga0207652_10008342
1111 Ga0207652_10014004
1112 Ga0207652_10017172
1113 Ga0207652_10027382
1114 Ga0207652_10122304
1115 Ga0207652_10127472
1116 Ga0207652_10147585
1117 Ga0207652_10232053
1118 Ga0207652_10397350
1119 Ga0207646_10369183
1120 Ga0207681_10729964
1121 Ga0207681_10882123
1122 Ga0207694_10000020
1123 Ga0207694_10061398
1124 Ga0207694_10210447
1125 Ga0207650_10767580
1126 Ga0207650_10912116
1127 Ga0207659_10023641
1128 Ga0207659_10107093
1129 Ga0207659_10400836
1130 Ga0207659_10439906
1131 Ga0207659_10465969
1132 Ga0207700_10002524
1133 Ga0207700_10082368
1134 Ga0207700_10116059
1135 Ga0207700_10813602
1136 Ga0207664_10004730
1137 Ga0207664_10027071
1138 Ga0207664_10040832
1139 Ga0207664_10078561
1140 Ga0207664_10088798
1141 Ga0207664_10296521
1142 Ga0207644_10301846
1143 Ga0207644_10459833
1144 Ga0207644_10832480
1145 Ga0207690_10017280
1146 Ga0207690_10143673
1147 Ga0207706_10001933
1148 Ga0207686_10026449
1149 Ga0207686_10142930
1150 Ga0207670_10012374
1151 Ga0207669_10817158
1152 Ga0207704_10053287
1153 Ga0207704_10091210
1154 Ga0207665_10192651
1155 Ga0207691_10062943
1156 Ga0207691_10095956
1157 Ga0207691_10275520
1158 Ga0207691_10362944
1159 Ga0207691_10510182
1160 Ga0207711_10151949
1161 Ga0207711_10161537
1162 Ga0207711_10246461
1163 Ga0207711_10638071
1164 Ga0207689_10049296
1165 Ga0207661_10008513
1166 Ga0207661_10015919
1167 Ga0207661_10048848
1168 Ga0207661_10064683
1169 Ga0207661_10066801
1170 Ga0207661_10119171
1171 Ga0207661_10165881
1172 Ga0207661_10206284
1173 Ga0207661_10328948
1174 Ga0207661_10416831
1175 Ga0207679_10032268
1176 Ga0207679_10152954
1177 Ga0207679_10590827
1178 Ga0207679_10681369
1179 Ga0207667_10079541
1180 Ga0207667_10279732
1181 Ga0207667_10462838
1182 Ga0207667_10650194
1183 Ga0207667_10708480
1184 Ga0207651_10408915
1185 Ga0207651_10574278
1186 Ga0207712_10000079
1187 Ga0207668_10013667
1188 Ga0207668_10047474
1189 Ga0207640_10411536
1190 Ga0207658_10234705
1191 Ga0207658_10561744
1192 Ga0207703_11070643
1193 Ga0207639_10012186
1194 Ga0207639_10028362
1195 Ga0207678_10069283
1196 Ga0207708_10065630
1197 Ga0207708_10250838
1198 Ga0207702_10795855
1199 Ga0207648_10048988
1200 Ga0207648_10232162
1201 Ga0207674_10011695
1202 Ga0207674_10058570
1203 Ga0207675_100292630
1204 Ga0207675_100410597
1205 Ga0207683_10456647
1206 Ga0207698_10012614
1207 Ga0207698_10222046
1208 Ga0207698_11152233
1209 Ga0207698_11167994
1210 Ga0207428_10065994
1211 Ga0268266_10606613
1212 Ga0265332_10077541
1213 Ga0265331_10108666
1214 Ga0307408_100041816
1215 Ga0307408_100069207
1216 Ga0307408_100300070
1217 Ga0307408_100310367
1218 Ga0307408_100996742
1219 Ga0316575_10037271
1220 Ga0316579_10098519
1221 Ga0265314_10008084
1222 Ga0265342_10025984
1223 Ga0316576_10112962
1224 Ga0316578_10093533
1225 Ga0316578_10239939
1226 Ga0307405_10000062
1227 Ga0307405_10047709
1228 Ga0307405_10246789
1229 Ga0307405_10862795
1230 Ga0307413_10003328
1231 Ga0307413_10006199
1232 Ga0307413_10015718
1233 Ga0307413_10306730
1234 Ga0307413_10391437
1235 Ga0307413_10565419
1236 Ga0307410_10005403
1237 Ga0307410_10006923
1238 Ga0307410_10044713
1239 Ga0307410_10096233
1240 Ga0307410_10243270
1241 Ga0307410_10252697
1242 Ga0307410_10288186
1243 Ga0307410_10535599
1244 Ga0307406_10002199
1245 Ga0307406_10010801
1246 Ga0307406_10036945
1247 Ga0307406_10143080
1248 Ga0307406_10797810
1249 Ga0307407_10000240
1250 Ga0307407_10008711
1251 Ga0307407_10030401
1252 Ga0307407_10069936
1253 Ga0307407_10075374
1254 Ga0307407_10186532
1255 Ga0307407_10433412
1256 Ga0307407_10438873
1257 Ga0307412_10004393
1258 Ga0307412_10096301
1259 Ga0307412_10210271
1260 Ga0307412_10353387
1261 Ga0307409_100000540
1262 Ga0307409_100000760
1263 Ga0307409_100002331
1264 Ga0307409_100050922
1265 Ga0307409_100075528
1266 Ga0307409_100165070
1267 Ga0307409_100208369
1268 Ga0307409_100402781
1269 Ga0307409_100526505
1270 Ga0307409_100763154
1271 Ga0307416_100000492
1272 Ga0307416_100003946
1273 Ga0307416_100069290
1274 Ga0307416_100220611
1275 Ga0307416_100304485
1276 Ga0307416_100802741
1277 Ga0307414_10018514
1278 Ga0307414_10037427
1279 Ga0307414_10052536
1280 Ga0307414_10266115
1281 Ga0307411_10003192
1282 Ga0307411_10007372
1283 Ga0307411_10040521
1284 Ga0307411_10070680
1285 Ga0307415_100000261
1286 Ga0307415_100048453
1287 Ga0307415_100166478
1288 Ga0307415_100176734
1289 Ga0307415_100179811
1290 Ga0307415_100333592
1291 Ga0373959_0000021
1292 Ga0373926_0004775
1293 Ga0373926_0016086
1294 Ga0373934_0004782
1295 Ga0373934_0077664
1296 Ga0373934_0102276
1297 Ga0373934_0421612
1298 Ga0373944_0021890
1299 Ga0373941_0105352
1300 Ga0373945_0108100
1301 Ga0373953_0005414
1302 Ga0373953_0046730
1303 Ga0373954_0011057
1304 Ga0373956_0009050
1305 Ga0373956_0025572
1306 Ga0373943_0004278
1307 Ga0373943_0090607
1308 Ga0373943_0491175
1309 Ga0373946_0281286
1310 Ga0373946_0328089
1311 Ga0373955_0019000
1312 Ga0373955_0024565
1313 Ga0373955_0556613
1314 Ga0373924_0012723
1315 Ga0373935_0006879
1316 Ga0373935_0089525
1317 Ga0373935_0288925
1318 Ga0373935_0384007
1319 Ga0373927_0006407
1320 Ga0373927_0208955
1321 Ga0373933_0000353
1322 Ga0373933_0196962
1323 Ga0373933_0364215
1324 Ga0373947_0005140
1325 Ga0373937_0000195
1326 Ga0373937_0002043
1327 Ga0373937_0235537
1328 Ga0373937_0522586
1329 Ga0316584_0098890
1330 Ga0373925_0011281
1331 Ga0373925_0029128
1332 Ga0373925_0041765
1333 Ga0373925_0587063
1334 Ga0395899_0427719
1335 Ga0395898_0260225
1336 Ga0395905_0107545
1337 Ga0436364_0844897
1338 Ga0436364_1042167
1339 Ga0436365_0805490
1340 Ga0436365_1488001
1341 Ga0439446_0105574
1342 Ga0439434_0007080
1343 Ga0439434_0055446
1344 Ga0451577_0020671
1345 Ga0451577_0094319
1346 Ga0451577_0126674
1347 Ga0466969_0080256
1348 Ga0466966_0063029
1349 Ga0466961_0002277
1350 Ga0466961_0438187
1351 Ga0466963_0167691
1352 Ga0453684_0000886
1353 Ga0453684_0036403
1354 Ga0453684_0080579
1355 Ga0451576_0143901
1356 Ga0451576_0183611
1357 Ga0451576_0316319
1358 Ga0451576_1320381
1359 Ga0466958_0050919
1360 Ga0466967_0037527
1361 Ga0466967_0043141
1362 Ga0466967_0061864
1363 Ga0466967_0118299
1364 Ga0466967_1242466
1365 Ga0495592_0018023
1366 Ga0495592_0060271
1367 Ga0495592_0123862
1368 Ga0495603_0016475
1369 Ga0495603_0156692
1370 Ga0495603_0245089
1371 Ga0495603_0479653
1372 Ga0495629_0001690
1373 Ga0495629_0021040
1374 Ga0495629_0050832
1375 Ga0495629_0052006
1376 Ga0495629_0206954
1377 Ga0495629_0302105
1378 Ga0495651_0000050
1379 Ga0495651_0017926
1380 Ga0495653_0000134
1381 Ga0495653_0096569
1382 Ga0495580_0003170
1383 Ga0495580_0006164
1384 Ga0495580_0034628
1385 Ga0495582_0008505
1386 Ga0495639_0000903
1387 Ga0495639_0008185
1388 Ga0495639_0055557
1389 Ga0495662_0197270
1390 Ga0495662_0294699
1391 Ga0495664_0078750
1392 Ga0495664_0152691
1393 Ga0495664_0240849
1394 Ga0495664_0517703
1395 Ga0495594_0004130
1396 Ga0495594_0005178
1397 Ga0495594_0013658
1398 Ga0495594_0027266
1399 Ga0495594_0067904
1400 Ga0495594_0160696
1401 Ga0495608_0000381
1402 Ga0495608_0045522
1403 Ga0495608_0089810
1404 Ga0495608_0188107
1405 Ga0495628_0001915
1406 Ga0495628_0379414
1407 Ga0495630_0012627
1408 Ga0495630_0017000
1409 Ga0495630_0108728
1410 Ga0495630_0230842
1411 Ga0495630_0401463
1412 Ga0495643_0000104
1413 Ga0495666_0245615
1414 Ga0495652_0001266
1415 Ga0495652_0031522
1416 Ga0495652_0207723
1417 Ga0495652_0605932
1418 Ga0495665_0002117
1419 Ga0495665_0012951
1420 Ga0495665_0077287
1421 Ga0495665_0174464
1422 Ga0495665_0280242
1423 Ga0495640_0062342
1424 Ga0495640_0088182
1425 Ga0495586_0009653
1426 Ga0495586_0022649
1427 Ga0495586_0030117
1428 Ga0495586_0063216
1429 Ga0495586_0130630
1430 Ga0495587_0000114
1431 Ga0495587_0007786
1432 Ga0495587_0013556
1433 Ga0495587_0021098
1434 Ga0495645_0000065
1435 Ga0495645_0002208
1436 Ga0495645_0123115
1437 Ga0495622_0071669
1438 Ga0495667_0002423
1439 Ga0495667_0003451
1440 Ga0495667_0015640
1441 Ga0495667_0058272
1442 Ga0495667_0095976
1443 Ga0495667_0397600
1444 Ga0495634_0109878
1445 Ga0495635_0003351
1446 Ga0495635_0043467
1447 Ga0495635_0116132
1448 Ga0495635_0180243
1449 Ga0495635_0396924
1450 Ga0495588_0005919
1451 Ga0495657_0001662
1452 Ga0495657_0030783
1453 Ga0495657_0148454
1454 Ga0495657_0274031
1455 Ga0495599_0000754
1456 Ga0495599_0007473
1457 Ga0495599_0010353
1458 Ga0495599_0181390
1459 Ga0495623_0002056
1460 Ga0495623_0003506
1461 Ga0495623_0036760
1462 Ga0495623_0065317
1463 Ga0495623_0079263
1464 Ga0495623_0316908
1465 Ga0495646_0004169
1466 Ga0495646_0112680
1467 Ga0495647_0096138
1468 Ga0495658_0001488
1469 Ga0495658_0249331
1470 Ga0495658_0331438
1471 Ga0495613_0014578
1472 Ga0495613_0059945
1473 Ga0495613_0155507
1474 Ga0495613_0570180
1475 Ga0495600_0000023
1476 Ga0495600_0056058
1477 Ga0495581_0001793
1478 Ga0495581_0037017
1479 Ga0495581_0387812
1480 Ga0495604_0003267
1481 Ga0495604_0050107
1482 Ga0495604_0131109
1483 Ga0495604_0239899
1484 Ga0495674_0000339
1485 Ga0495674_0050483
1486 Ga0495674_0155865
1487 Ga0495672_0004839
1488 Ga0495676_0811639
1489 Ga0495680_0001928
1490 Ga0495680_0063239
1491 Ga0495680_0223498
1492 Ga0495675_0009806
1493 Ga0495675_0027738
1494 Ga0495675_0039611
1495 Ga0495675_0096722
1496 Ga0495675_0168400
1497 Ga0495675_0179781
1498 Ga0495684_0000037
1499 Ga0495684_0002171
1500 Ga0495684_0008791
1501 Ga0495684_0159964
1502 Ga0495684_0275345
1503 Ga0495684_0306368
1504 Ga0495593_0001571
1505 Ga0495593_0059859
1506 Ga0495602_0010122
1507 Ga0495602_0049375
1508 Ga0495602_0103208
1509 Ga0495614_0025780
1510 Ga0496100_0278452
1511 Ga0496101_0025592
1512 Ga0496104_0035371
1513 Ga0496104_0117304
1514 Ga0496104_0501675
1515 Ga0496106_0101296
1516 Ga0496106_0320524
1517 Ga0496107_0123871
1518 Ga0496107_0389659
1519 Ga0496108_0247963
1520 Ga0496109_0246457
1521 Ga0496109_0831887
1522 Ga0496112_0118778
1523 Ga0496113_0085136
1524 Ga0496115_0077783
1525 Ga0496115_0205543
1526 Ga0496115_0210651
1527 Ga0496115_0255073
1528 Ga0501033_0019269
1529 Ga0501034_0022952
1530 Ga0501036_0212319
1531 Ga0501037_0535953
1532 Ga0501038_0041349
1533 Ga0501038_0200162
1534 Ga0501041_0349535
1535 Ga0501043_0028884
1536 Ga0501043_0073476
1537 Ga0501046_0107654
1538 Ga0501047_0146062
1539 Ga0501047_0155769
1540 Ga0501047_0326253
1541 Ga0501070_0048769
1542 Ga0501070_0076149
1543 Ga0501070_0207231
1544 Ga0501249_030386
1545 Ga0501080_0532003
1546 Ga0501080_1161016
1547 Ga0501035_0114086
1548 Ga0501035_0170999
1549 Ga0501044_0143728
1550 Ga0501044_0150982
1551 Ga0501044_0577625
1552 nmdc:mga06r32_290452_c1
1553 nmdc:mga08y16_190010_c1
1554 nmdc:mga08y16_27618_c1
1555 nmdc:mga0n895_183986_c1
1556 nmdc:mga0n895_315849_c1
1557 nmdc:mga0rr50_124474_c1
1558 nmdc:mga0rr50_879215_c1
1559 nmdc:mga08x19_293797_c1
1560 nmdc:mga08x19_383913_c1
1561 nmdc:mga08x19_673387_c1
1562 nmdc:mga08x19_76661_c1
1563 nmdc:mga0a205_571282_c1
1564 Ga0495601_0007462
1565 Ga0495601_0705722
1566 Ga0495612_0000696
1567 Ga0495612_0186941
1568 Ga0495595_0005871
1569 Ga0495619_0006044
1570 Ga0495619_0162533
1571 Ga0495619_0433920
1572 Ga0500628_000510

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08282

Hydrolase_3

haloacid dehalogenase-like hydrolase

124

198

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ij5-assembly1.cif.gz_A 1.95 angstrom resolution crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from yersinia pestis 0.9386 4 169
2p9j-assembly1.cif.gz_D crystal structure of aq2171 from aquifex aeolicus 0.9372 2 165
3n07-assembly1.cif.gz_A-1 structure of putative 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from vibrio cholerae 0.9371 4 167
2p9j-assembly1.cif.gz_F crystal structure of aq2171 from aquifex aeolicus 0.936 4 165
1k1e-assembly5.cif.gz_H structure of the cobalt-bound form of the deoxy-d-mannose-octulosonate 8-phosphate phosphatase (yrbi) from haemophilus influenzae (hi1679) 0.9329 6 168
ID Description Score Start End Superfamily
4um7A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9362 4 175 3.40.50.1000
3ij5D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9349 4 170 3.40.50.1000
2p9jF00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9318 4 165 3.40.50.1000
3mmzB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9292 7 159 3.40.50.1000
4navA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9241 4 175 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A382JX38-F1-model_v4 Phosphotyrosine protein phosphatase I domain-containing protein 0.978 51 182 GO:0008781
GO:0016787
AF-W0RK36-F1-model_v4 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family 0.9712 1 181 GO:0008781
GO:0009103
GO:0016788
GO:0046872
AF-A0A800K5M3-F1-model_v4 Phenylphosphate carboxylase subunit delta 0.9697 2 181 GO:0008781
GO:0009103
GO:0016788
AF-A0A143BK50-F1-model_v4 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase 0.9682 1 180 GO:0008781
GO:0009103
GO:0016788
GO:0046872
AF-A0A651HSM0-F1-model_v4 HAD-IIIA family hydrolase 0.9668 2 182 GO:0008781
GO:0009103
GO:0016788

Map