F480333

General Info

Members Datasets Scaffolds Average Seq Length
776 292 691 214

Family's Representative Sequence

Representative Sequence 3300046513|Ga0495616_0001775|Ga0495616_0001775_5616_6386
Length 256
Sequence MPLWSDIRYLIHVSLTVASQAFDCPRFRLSVTFPHFTVSLSMPLLRLLPAMLFLSLATLFNLTLAYADDTALPRPADWAQSVEVQYNLYQMSPTLYRSALPDKGVVPLLEKLKVATVINFLPEPDSSWLSTPGITQIQLPYRTNHVDDSDVLKAIRAIQTAEAKGPVLMHCKHGSDRTGLMAAMYRVVVQGWSKEDALSEMTQGGFGDSTHFKDGIRYMMQADVDKLRTALANGDCSTSPFASCSMKNWFKSAHVE

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2511231004 Pseudomonas sp. GM102 Isolate Nodule
3 2511231006 Pseudomonas sp. GM17 Isolate Nodule
4 2511231007 Pseudomonas sp. GM18 Isolate Nodule
5 2511231008 Pseudomonas sp. GM21 Isolate Nodule
6 2511231010 Pseudomonas sp. GM25 Isolate Nodule
7 2511231016 Pseudomonas sp. GM50 Isolate Nodule
8 2511231018 Pseudomonas sp. GM60 Isolate Nodule
9 2511231019 Pseudomonas sp. GM67 Isolate Nodule
10 2511231031 Pseudomonas sp. GM16 Isolate Nodule
11 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
12 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
13 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
14 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
15 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
16 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
17 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
18 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
19 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
20 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
21 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
22 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
23 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
24 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
25 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
26 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
27 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
28 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
29 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
30 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
31 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
32 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
33 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
34 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
35 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
36 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
37 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
38 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
39 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
40 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
41 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
42 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
43 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
44 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
45 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
46 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
47 2773857670 Pseudomonas sp. 478 Isolate Unclassified
48 2784132072 Pseudomonas sp. 460 Isolate Unclassified
49 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
50 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
51 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
52 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
53 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
54 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
55 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
56 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
57 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
58 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
59 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
60 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
61 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
62 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
63 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
64 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
65 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
66 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
67 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
68 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
69 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
70 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
71 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
72 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
73 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
74 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
75 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
76 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
77 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
78 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
79 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
80 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
81 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
82 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
83 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
84 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
85 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
86 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
87 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
88 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
89 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
90 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
91 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
94 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
95 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
96 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
112 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
113 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
119 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
120 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
121 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
135 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
136 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
137 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
146 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
147 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
148 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
149 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
150 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
151 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
152 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
153 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
154 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
155 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
156 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
157 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
158 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
159 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
160 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
161 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
162 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
163 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
164 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
165 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
166 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
167 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
168 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
169 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
170 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
171 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
172 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
173 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
174 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
175 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
176 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
177 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
178 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
179 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
180 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
181 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
182 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
183 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
184 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
185 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
186 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
187 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
188 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
189 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
190 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
191 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
192 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
193 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
194 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
195 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
196 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
197 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
198 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
199 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
200 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
201 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
202 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
203 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
204 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
205 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
206 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
207 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
208 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
209 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
210 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
211 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
214 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
215 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
216 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
217 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
218 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
219 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
220 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
221 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
222 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
223 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
224 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
225 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
226 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
227 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
228 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
229 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
230 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
231 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
232 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
233 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
234 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
235 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
236 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
237 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
238 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
239 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
240 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
241 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
242 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
243 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
244 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
245 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
246 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
247 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
248 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
249 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
250 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
251 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
252 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
253 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
254 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
255 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
256 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
257 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
258 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
259 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
260 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
261 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
262 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
263 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
264 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
265 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
266 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
267 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
268 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
269 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
270 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
271 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
272 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
273 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
274 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
275 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
276 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
277 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
278 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
279 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
280 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
281 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
282 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
283 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
284 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
285 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
286 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
287 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
288 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
289 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
290 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
291 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
292 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.05
Metatranscriptomes 0
Isolates 10.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.54
Nodule 1.8
Rhizoplane 4.12
Rhizosphere 79.25
Stem 0
Stem Tuber 0
Unclassified 9.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_126 2124908027 Bacteria 13711
2 MRS2a_Contig_780 2124908027 Bacteria 21015
3 MRS2a_Contig_9063 2124908027 Bacteria 7171
4 JGI25163J39215_1000433 3300002771 Bacteria 12946
5 JGI25164J39214_1000274 3300002772 Bacteria 37790
6 JGI25165J46597_1000175 3300003214 Bacteria 100117
7 Ga0055525_1006866 3300003759 Bacteria 963
8 Ga0055536_1000241 3300003781 Bacteria 43710
9 Ga0055530_10000159 3300003791 Bacteria 61131
10 Ga0055530_10002447 3300003791 Bacteria 11953
11 Ga0055530_10021263 3300003791 Bacteria 1917
12 Ga0055540_1000378 3300003792 Bacteria 37178
13 Ga0055540_1000725 3300003792 Bacteria 22486
14 Ga0055531_10000278 3300003794 Bacteria 52841
15 Ga0065714_10000066 3300005288 Bacteria 13168
16 Ga0065714_10006067 3300005288 Bacteria 3866
17 Ga0065714_10075096 3300005288 Bacteria 2929
18 Ga0065714_10156917 3300005288 Bacteria 1059
19 Ga0065704_10095391 3300005289 Bacteria 2490
20 Ga0065712_10003630 3300005290 Bacteria 6569
21 Ga0065715_10010939 3300005293 Bacteria 4416
22 Ga0070676_10456924 3300005328 Bacteria 899
23 Ga0070665_100087129 3300005548 Bacteria 3128
24 Ga0070665_100365880 3300005548 Bacteria 1448
25 Ga0075364_10061280 3300006051 Bacteria 2467
26 Ga0075364_10133719 3300006051 Bacteria 1666
27 Ga0075364_10161423 3300006051 Bacteria 1513
28 Ga0075364_10239839 3300006051 Bacteria 1231
29 Ga0075364_10304082 3300006051 Bacteria 1086
30 Ga0075432_10008289 3300006058 Bacteria 3542
31 Ga0075432_10011873 3300006058 Bacteria 2960
32 Ga0075436_100085218 3300006914 Bacteria 2193
33 Ga0075436_100337277 3300006914 Bacteria 1085
34 Ga0079104_1000291 3300006946 Bacteria 63569
35 Ga0079104_1013191 3300006946 Bacteria 2559
36 Ga0105251_10000033 3300009011 Bacteria 118905
37 Ga0105251_10001441 3300009011 Bacteria 20465
38 Ga0105251_10015803 3300009011 Bacteria 4108
39 Ga0105251_10093819 3300009011 Bacteria 1377
40 Ga0105251_10121079 3300009011 Bacteria 1189
41 Ga0105244_10001003 3300009036 Bacteria 23674
42 Ga0105244_10004611 3300009036 Bacteria 9434
43 Ga0105244_10007387 3300009036 Bacteria 6985
44 Ga0105244_10015803 3300009036 Bacteria 4320
45 Ga0105244_10021019 3300009036 Bacteria 3616
46 Ga0105244_10041120 3300009036 Bacteria 2396
47 Ga0105244_10044038 3300009036 Bacteria 2300
48 Ga0105244_10070993 3300009036 Bacteria 1736
49 Ga0105250_10000203 3300009092 Bacteria 50306
50 Ga0105250_10006448 3300009092 Bacteria 5126
51 Ga0105250_10023299 3300009092 Bacteria 2494
52 Ga0105245_11116848 3300009098 Bacteria 835
53 Ga0105243_10000075 3300009148 Bacteria 112098
54 Ga0105243_10000823 3300009148 Bacteria 29578
55 Ga0105243_10007583 3300009148 Bacteria 8339
56 Ga0105243_10032759 3300009148 Bacteria 4018
57 Ga0105243_10046493 3300009148 Bacteria 3415
58 Ga0105243_10147065 3300009148 Bacteria 2017
59 Ga0105242_10011641 3300009176 Bacteria 6767
60 Ga0105249_10010831 3300009553 Bacteria 8014
61 Ga0105246_10000131 3300011119 Bacteria 34909
62 Ga0105246_10050273 3300011119 Bacteria 2859
63 Ga0157345_1000404 3300012498 Bacteria 4577
64 Ga0157373_10009904 3300013100 Bacteria 7025
65 Ga0157373_10022035 3300013100 Bacteria 4623
66 Ga0157373_10177855 3300013100 Bacteria 1498
67 Ga0157371_10001263 3300013102 Bacteria 26673
68 Ga0157371_10001943 3300013102 Bacteria 20549
69 Ga0157371_10013654 3300013102 Bacteria 6163
70 Ga0157370_10141604 3300013104 Bacteria 2241
71 Ga0157370_10202119 3300013104 Bacteria 1843
72 Ga0157369_10178257 3300013105 Bacteria 2237
73 Ga0157369_10203334 3300013105 Bacteria 2078
74 Ga0157369_10586115 3300013105 Bacteria 1152
75 Ga0163162_10102300 3300013306 Bacteria 2958
76 Ga0163162_10545029 3300013306 Bacteria 1288
77 Ga0157375_10012327 3300013308 Bacteria 7581
78 Ga0157375_10287862 3300013308 Bacteria 1806
79 Ga0163163_10804000 3300014325 Bacteria 1004
80 Ga0182008_10000367 3300014497 Bacteria 35146
81 Ga0182008_10005997 3300014497 Bacteria 6842
82 Ga0182008_10145082 3300014497 Bacteria 1189
83 Ga0182006_1000961 3300015261 Bacteria 19104
84 Ga0182006_1007030 3300015261 Bacteria 5179
85 Ga0182007_10000742 3300015262 Bacteria 18459
86 Ga0182007_10050738 3300015262 Bacteria 1369
87 Ga0182005_1000885 3300015265 Bacteria 13177
88 Ga0182005_1001322 3300015265 Bacteria 10133
89 Ga0182005_1009073 3300015265 Bacteria 2910
90 Ga0163161_10003752 3300017792 Bacteria 10641
91 Ga0163161_10006852 3300017792 Bacteria 7883
92 Ga0163161_10014499 3300017792 Bacteria 5487
93 Ga0163161_10038640 3300017792 Bacteria 3424
94 Ga0163161_10054637 3300017792 Bacteria 2898
95 Ga0163161_10060564 3300017792 Bacteria 2755
96 Ga0163161_10126849 3300017792 Bacteria 1922
97 Ga0209760_100082 3300025207 Bacteria 76168
98 Ga0209563_100602 3300025230 Bacteria 11746
99 Ga0207427_100005 3300025231 Bacteria 797999
100 Ga0209437_100018 3300025233 Bacteria 694400
101 Ga0209233_1000021 3300025261 Bacteria 798078
102 Ga0209130_1019195 3300025284 Bacteria 1591
103 Ga0209675_1002845 3300025291 Bacteria 8601
104 Ga0209676_1000015 3300025292 Bacteria 784458
105 Ga0209676_1000157 3300025292 Bacteria 163094
106 Ga0209676_1000222 3300025292 Bacteria 124695
107 Ga0209676_1002476 3300025292 Bacteria 13015
108 Ga0209050_1000030 3300025298 Bacteria 463381
109 Ga0209050_1000296 3300025298 Bacteria 104732
110 Ga0209050_1001114 3300025298 Bacteria 32494
111 Ga0209051_1000143 3300025303 Bacteria 135182
112 Ga0209051_1000295 3300025303 Bacteria 79621
113 Ga0209051_1005949 3300025303 Bacteria 6996
114 Ga0209257_1000422 3300025304 Bacteria 81630
115 Ga0207696_1000127 3300025711 Bacteria 135531
116 Ga0207696_1014668 3300025711 Bacteria 2679
117 Ga0207655_1000135 3300025728 Bacteria 143597
118 Ga0207655_1000652 3300025728 Bacteria 41403
119 Ga0207655_1000961 3300025728 Bacteria 29731
120 Ga0207655_1002694 3300025728 Bacteria 13924
121 Ga0207655_1009319 3300025728 Bacteria 6111
122 Ga0207655_1010881 3300025728 Bacteria 5472
123 Ga0207655_1018520 3300025728 Bacteria 3687
124 Ga0207655_1019603 3300025728 Bacteria 3524
125 Ga0207655_1021543 3300025728 Bacteria 3267
126 Ga0207713_1000126 3300025735 Bacteria 118913
127 Ga0207713_1001900 3300025735 Bacteria 15835
128 Ga0207713_1003162 3300025735 Bacteria 11404
129 Ga0207713_1003858 3300025735 Bacteria 10005
130 Ga0207713_1008765 3300025735 Bacteria 5765
131 Ga0207713_1014324 3300025735 Bacteria 4128
132 Ga0207713_1081322 3300025735 Bacteria 1165
133 Ga0207709_10000107 3300025935 Bacteria 129240
134 Ga0207709_10000269 3300025935 Bacteria 61223
135 Ga0207709_10004320 3300025935 Bacteria 8233
136 Ga0207712_10007010 3300025961 Bacteria 7108
137 Ga0209281_1000237 3300027111 Bacteria 112688
138 Ga0209281_1017879 3300027111 Bacteria 1430
139 Ga0209281_1024515 3300027111 Bacteria 1133
140 Ga0207428_10013002 3300027907 Bacteria 7290
141 Ga0207428_10018210 3300027907 Bacteria 6004
142 Ga0207428_10045751 3300027907 Bacteria 3522
143 Ga0268266_10161859 3300028379 Bacteria 2025
144 Ga0307511_10048564 3300030521 Bacteria 3450
145 Ga0307511_10124786 3300030521 Bacteria 1576
146 Ga0316179_1023690 3300030734 Bacteria 5550
147 Ga0316178_1040639 3300030735 Bacteria 15017
148 Ga0307509_10044340 3300031507 Bacteria 4807
149 Ga0307408_100042105 3300031548 Bacteria 3241
150 Ga0307408_100332726 3300031548 Bacteria 1283
151 Ga0307408_100458269 3300031548 Bacteria 1107
152 Ga0307516_10504584 3300031730 Bacteria 864
153 Ga0307412_10008301 3300031911 Bacteria 5919
154 Ga0307412_10014426 3300031911 Bacteria 4660
155 Ga0307409_100019888 3300031995 Bacteria 4560
156 Ga0307416_100028527 3300032002 Bacteria 4152
157 Ga0307414_10007727 3300032004 Bacteria 6058
158 Ga0307414_10319163 3300032004 Bacteria 1321
159 Ga0307411_10023905 3300032005 Bacteria 3631
160 Ga0307510_10003851 3300033180 Bacteria 17591
161 Ga0439438_001361 3300041405 Bacteria 10795
162 Ga0439438_002135 3300041405 Bacteria 8528
163 Ga0439438_003946 3300041405 Bacteria 5837
164 Ga0439438_004173 3300041405 Bacteria 5629
165 Ga0439438_017478 3300041405 Bacteria 2063
166 Ga0439438_019539 3300041405 Bacteria 1913
167 Ga0439438_029721 3300041405 Bacteria 1461
168 Ga0439447_000528 3300041407 Bacteria 14164
169 Ga0439447_002748 3300041407 Bacteria 6361
170 Ga0439447_003112 3300041407 Bacteria 5920
171 Ga0439447_003168 3300041407 Bacteria 5860
172 Ga0439447_007572 3300041407 Bacteria 3431
173 Ga0439447_023496 3300041407 Bacteria 1605
174 Ga0439447_068059 3300041407 Bacteria 830
175 Ga0439466_0000612 3300041411 Bacteria 13423
176 Ga0439466_0000697 3300041411 Bacteria 12686
177 Ga0439466_0002598 3300041411 Bacteria 7069
178 Ga0439466_0006461 3300041411 Bacteria 4455
179 Ga0439466_0007365 3300041411 Bacteria 4168
180 Ga0439466_0029796 3300041411 Bacteria 1875
181 Ga0439466_0033419 3300041411 Bacteria 1747
182 Ga0439466_0072798 3300041411 Bacteria 1092
183 Ga0439465_0020056 3300041413 Bacteria 2091
184 Ga0439442_033579 3300042002 Bacteria 1073
185 Ga0439445_0007773 3300042004 Bacteria 2496
186 Ga0439445_0039917 3300042004 Bacteria 1245
187 Ga0439432_008379 3300042006 Bacteria 3629
188 Ga0439432_011173 3300042006 Bacteria 3094
189 Ga0439451_000759 3300042009 Bacteria 6131
190 Ga0439451_002587 3300042009 Bacteria 3679
191 Ga0439451_011134 3300042009 Bacteria 1814
192 Ga0439451_016879 3300042009 Bacteria 1470
193 Ga0439451_017844 3300042009 Bacteria 1431
194 Ga0439451_030072 3300042009 Bacteria 1092
195 Ga0439452_000435 3300042010 Bacteria 24043
196 Ga0439452_000563 3300042010 Bacteria 19511
197 Ga0439452_001007 3300042010 Bacteria 12489
198 Ga0439452_002477 3300042010 Bacteria 6789
199 Ga0439452_013627 3300042010 Bacteria 2277
200 Ga0439456_000938 3300042013 Bacteria 5829
201 Ga0439456_001936 3300042013 Bacteria 4172
202 Ga0439456_003667 3300042013 Bacteria 3122
203 Ga0439456_015613 3300042013 Bacteria 1586
204 Ga0439463_001255 3300042016 Bacteria 6777
205 Ga0439463_001325 3300042016 Bacteria 6592
206 Ga0439463_009503 3300042016 Bacteria 2393
207 Ga0439463_017788 3300042016 Bacteria 1765
208 Ga0450911_000393 3300042115 Bacteria 14471
209 Ga0450911_001286 3300042115 Bacteria 5977
210 Ga0450919_000266 3300042121 Bacteria 6058
211 Ga0450919_000593 3300042121 Bacteria 4579
212 Ga0450920_003573 3300042122 Bacteria 2703
213 Ga0450922_000085 3300042124 Bacteria 8773
214 Ga0450922_000802 3300042124 Bacteria 3217
215 Ga0450923_009463 3300042125 Bacteria 1705
216 Ga0450900_003697 3300042136 Bacteria 1713
217 Ga0450902_001341 3300042137 Bacteria 3331
218 Ga0450902_003593 3300042137 Bacteria 2276
219 Ga0450902_013598 3300042137 Bacteria 1311
220 Ga0450903_018786 3300042138 Bacteria 1075
221 Ga0450904_002383 3300042139 Bacteria 2256
222 Ga0450904_003083 3300042139 Bacteria 1848
223 Ga0450905_000916 3300042142 Bacteria 3694
224 Ga0450905_009990 3300042142 Bacteria 1310
225 Ga0450906_000778 3300042145 Bacteria 6949
226 Ga0450906_001204 3300042145 Bacteria 5716
227 Ga0450906_001384 3300042145 Bacteria 5296
228 Ga0450907_000357 3300042146 Bacteria 14117
229 Ga0450907_001219 3300042146 Bacteria 5810
230 Ga0450907_002598 3300042146 Bacteria 3382
231 Ga0450907_003449 3300042146 Bacteria 2818
232 Ga0450907_004066 3300042146 Bacteria 2536
233 Ga0450910_000588 3300042147 Bacteria 4330
234 Ga0439446_0024191 3300042156 Bacteria 1731
235 Ga0450908_001021 3300042184 Bacteria 5420
236 Ga0450908_003721 3300042184 Bacteria 2954
237 Ga0450909_001568 3300042185 Bacteria 3193
238 Ga0450909_001829 3300042185 Bacteria 2993
239 Ga0439434_0002979 3300042435 Bacteria 4953
240 Ga0439434_0037124 3300042435 Bacteria 1492
241 Ga0439464_0003574 3300042439 Bacteria 3933
242 Ga0439460_0000423 3300042461 Bacteria 9016
243 Ga0439460_0001249 3300042461 Bacteria 5980
244 Ga0439460_0087706 3300042461 Bacteria 985
245 Ga0450918_000953 3300042531 Bacteria 6044
246 Ga0450918_005517 3300042531 Bacteria 2272
247 Ga0450918_021543 3300042531 Bacteria 1126
248 Ga0450893_0008804 3300042532 Bacteria 1646
249 Ga0450893_0018169 3300042532 Bacteria 1197
250 Ga0439440_0006164 3300042993 Bacteria 2404
251 Ga0495617_000380 3300046452 Bacteria 24621
252 Ga0495617_010148 3300046452 Bacteria 3225
253 Ga0495617_017380 3300046452 Bacteria 2429
254 Ga0495617_018910 3300046452 Bacteria 2331
255 Ga0495617_019285 3300046452 Bacteria 2306
256 Ga0495617_037479 3300046452 Bacteria 1623
257 Ga0495617_118601 3300046452 Bacteria 853
258 Ga0495617_132823 3300046452 Bacteria 797
259 Ga0495627_001044 3300046453 Bacteria 18426
260 Ga0495627_011512 3300046453 Bacteria 3173
261 Ga0495627_065857 3300046453 Bacteria 1064
262 Ga0495603_0021167 3300046455 Bacteria 3937
263 Ga0495603_0043324 3300046455 Bacteria 2688
264 Ga0495590_0002808 3300046457 Bacteria 7192
265 Ga0495590_0033756 3300046457 Bacteria 1788
266 Ga0495590_0105024 3300046457 Bacteria 1005
267 Ga0495591_003848 3300046458 Bacteria 7585
268 Ga0495591_009425 3300046458 Bacteria 3885
269 Ga0495591_013145 3300046458 Bacteria 3045
270 Ga0495591_019691 3300046458 Bacteria 2251
271 Ga0495591_029884 3300046458 Bacteria 1650
272 Ga0495629_0014547 3300046459 Bacteria 5662
273 Ga0495638_0016165 3300046460 Bacteria 5001
274 Ga0495638_0019195 3300046460 Bacteria 4525
275 Ga0495638_0023744 3300046460 Bacteria 4005
276 Ga0495638_0033848 3300046460 Bacteria 3264
277 Ga0495638_0041481 3300046460 Bacteria 2911
278 Ga0495638_0077777 3300046460 Bacteria 2019
279 Ga0495638_0082308 3300046460 Bacteria 1952
280 Ga0495638_0285300 3300046460 Bacteria 895
281 Ga0495653_0013163 3300046463 Bacteria 6745
282 Ga0495653_0049227 3300046463 Bacteria 3247
283 Ga0495650_0010451 3300046471 Bacteria 5178
284 Ga0495650_0013756 3300046471 Bacteria 4256
285 Ga0495650_0018416 3300046471 Bacteria 3470
286 Ga0495650_0033127 3300046471 Bacteria 2302
287 Ga0495582_0011519 3300046473 Bacteria 4874
288 Ga0495605_0001927 3300046474 Bacteria 13197
289 Ga0495605_0010536 3300046474 Bacteria 5170
290 Ga0495605_0030439 3300046474 Bacteria 2768
291 Ga0495605_0034714 3300046474 Bacteria 2553
292 Ga0495605_0045549 3300046474 Bacteria 2161
293 Ga0495605_0049589 3300046474 Bacteria 2050
294 Ga0495605_0051652 3300046474 Bacteria 2001
295 Ga0495605_0158874 3300046474 Bacteria 1004
296 Ga0495639_0000239 3300046475 Bacteria 27346
297 Ga0495639_0011704 3300046475 Bacteria 3784
298 Ga0495639_0120892 3300046475 Bacteria 1249
299 Ga0495584_0003267 3300046491 Bacteria 8984
300 Ga0495584_0003421 3300046491 Bacteria 8741
301 Ga0495584_0004470 3300046491 Bacteria 7521
302 Ga0495584_0008729 3300046491 Bacteria 5241
303 Ga0495584_0009357 3300046491 Bacteria 5048
304 Ga0495584_0015172 3300046491 Bacteria 3924
305 Ga0495584_0022996 3300046491 Bacteria 3162
306 Ga0495584_0036571 3300046491 Bacteria 2480
307 Ga0495584_0077394 3300046491 Bacteria 1673
308 Ga0495584_0167597 3300046491 Bacteria 1116
309 Ga0495585_0000800 3300046492 Bacteria 27448
310 Ga0495585_0010077 3300046492 Bacteria 5645
311 Ga0495585_0021682 3300046492 Bacteria 3688
312 Ga0495585_0035157 3300046492 Bacteria 2833
313 Ga0495585_0050632 3300046492 Bacteria 2303
314 Ga0495594_0025909 3300046499 Bacteria 3153
315 Ga0495594_0155761 3300046499 Bacteria 1297
316 Ga0495594_0185542 3300046499 Bacteria 1184
317 Ga0495596_0009446 3300046500 Bacteria 4288
318 Ga0495607_0002401 3300046501 Bacteria 15280
319 Ga0495607_0014250 3300046501 Bacteria 5183
320 Ga0495607_0017659 3300046501 Bacteria 4572
321 Ga0495607_0023541 3300046501 Bacteria 3854
322 Ga0495607_0032978 3300046501 Bacteria 3154
323 Ga0495607_0074010 3300046501 Bacteria 1892
324 Ga0495583_0001586 3300046506 Bacteria 22403
325 Ga0495583_0020431 3300046506 Bacteria 3431
326 Ga0495583_0022970 3300046506 Bacteria 3167
327 Ga0495583_0040261 3300046506 Bacteria 2196
328 Ga0495583_0046724 3300046506 Bacteria 1995
329 Ga0495606_0006756 3300046507 Bacteria 10498
330 Ga0495606_0020688 3300046507 Bacteria 4842
331 Ga0495606_0024580 3300046507 Bacteria 4336
332 Ga0495606_0053966 3300046507 Bacteria 2605
333 Ga0495606_0087322 3300046507 Bacteria 1925
334 Ga0495610_0014224 3300046512 Bacteria 4685
335 Ga0495610_0015768 3300046512 Bacteria 4377
336 Ga0495610_0016431 3300046512 Bacteria 4259
337 Ga0495610_0017352 3300046512 Bacteria 4106
338 Ga0495610_0020852 3300046512 Bacteria 3623
339 Ga0495610_0039857 3300046512 Bacteria 2372
340 Ga0495610_0042992 3300046512 Bacteria 2254
341 Ga0495610_0086344 3300046512 Bacteria 1429
342 Ga0495616_0001775 3300046513 Bacteria 14672
343 Ga0495616_0006850 3300046513 Bacteria 6864
344 Ga0495616_0028678 3300046513 Bacteria 2945
345 Ga0495616_0033803 3300046513 Bacteria 2660
346 Ga0495616_0042038 3300046513 Bacteria 2328
347 Ga0495616_0087655 3300046513 Bacteria 1478
348 Ga0495616_0119015 3300046513 Bacteria 1221
349 Ga0495620_0004714 3300046515 Bacteria 7663
350 Ga0495620_0006500 3300046515 Bacteria 6417
351 Ga0495620_0010348 3300046515 Bacteria 4922
352 Ga0495620_0029283 3300046515 Bacteria 2550
353 Ga0495620_0067828 3300046515 Bacteria 1466
354 Ga0495630_0062785 3300046517 Bacteria 2790
355 Ga0495630_0119908 3300046517 Bacteria 1995
356 Ga0495630_0174299 3300046517 Bacteria 1639
357 Ga0495630_0328978 3300046517 Bacteria 1168
358 Ga0495631_0001056 3300046518 Bacteria 17098
359 Ga0495631_0014109 3300046518 Bacteria 3862
360 Ga0495631_0029367 3300046518 Bacteria 2501
361 Ga0495631_0045367 3300046518 Bacteria 1935
362 Ga0495631_0046642 3300046518 Bacteria 1904
363 Ga0495631_0060750 3300046518 Bacteria 1639
364 Ga0495632_0000952 3300046519 Bacteria 25300
365 Ga0495632_0002331 3300046519 Bacteria 14584
366 Ga0495632_0004235 3300046519 Bacteria 9801
367 Ga0495632_0006265 3300046519 Bacteria 7688
368 Ga0495632_0018560 3300046519 Bacteria 3814
369 Ga0495632_0019858 3300046519 Bacteria 3651
370 Ga0495632_0024744 3300046519 Bacteria 3184
371 Ga0495632_0026384 3300046519 Bacteria 3058
372 Ga0495632_0114646 3300046519 Bacteria 1263
373 Ga0495632_0164736 3300046519 Bacteria 1020
374 Ga0495637_0001869 3300046520 Bacteria 12034
375 Ga0495637_0003537 3300046520 Bacteria 8280
376 Ga0495637_0006880 3300046520 Bacteria 5679
377 Ga0495637_0007714 3300046520 Bacteria 5322
378 Ga0495637_0008428 3300046520 Bacteria 5065
379 Ga0495637_0013354 3300046520 Bacteria 3897
380 Ga0495637_0033244 3300046520 Bacteria 2266
381 Ga0495637_0034170 3300046520 Bacteria 2228
382 Ga0495637_0043692 3300046520 Bacteria 1911
383 Ga0495637_0092180 3300046520 Bacteria 1193
384 Ga0495643_0005972 3300046522 Bacteria 8126
385 Ga0495643_0021753 3300046522 Bacteria 3671
386 Ga0495643_0029787 3300046522 Bacteria 3051
387 Ga0495644_0018084 3300046523 Bacteria 2691
388 Ga0495644_0174233 3300046523 Bacteria 826
389 Ga0495648_0004730 3300046524 Bacteria 11529
390 Ga0495648_0009264 3300046524 Bacteria 7652
391 Ga0495648_0010536 3300046524 Bacteria 7031
392 Ga0495648_0024416 3300046524 Bacteria 4116
393 Ga0495648_0026432 3300046524 Bacteria 3908
394 Ga0495648_0029419 3300046524 Bacteria 3646
395 Ga0495648_0046402 3300046524 Bacteria 2693
396 Ga0495648_0060441 3300046524 Bacteria 2254
397 Ga0495648_0075231 3300046524 Bacteria 1943
398 Ga0495648_0154831 3300046524 Bacteria 1191
399 Ga0495666_0005622 3300046526 Bacteria 6312
400 Ga0495666_0017177 3300046526 Bacteria 3603
401 Ga0495666_0018165 3300046526 Bacteria 3502
402 Ga0495666_0223262 3300046526 Bacteria 862
403 Ga0495642_0000368 3300046528 Bacteria 24366
404 Ga0495642_0003008 3300046528 Bacteria 6718
405 Ga0495642_0196396 3300046528 Bacteria 879
406 Ga0495652_0264488 3300046529 Bacteria 1268
407 Ga0495654_0004733 3300046530 Bacteria 8005
408 Ga0495654_0006704 3300046530 Bacteria 6518
409 Ga0495654_0007638 3300046530 Bacteria 6020
410 Ga0495654_0011144 3300046530 Bacteria 4881
411 Ga0495654_0014551 3300046530 Bacteria 4186
412 Ga0495654_0015938 3300046530 Bacteria 3982
413 Ga0495654_0070196 3300046530 Bacteria 1661
414 Ga0495654_0072939 3300046530 Bacteria 1624
415 Ga0495654_0105410 3300046530 Bacteria 1292
416 Ga0495654_0107024 3300046530 Bacteria 1279
417 Ga0495654_0136618 3300046530 Bacteria 1096
418 Ga0495654_0152199 3300046530 Bacteria 1022
419 Ga0495586_0138210 3300046535 Bacteria 1366
420 Ga0495587_0004632 3300046536 Bacteria 9039
421 Ga0495587_0052443 3300046536 Bacteria 2406
422 Ga0495609_0000756 3300046538 Bacteria 24390
423 Ga0495609_0009275 3300046538 Bacteria 4767
424 Ga0495609_0010169 3300046538 Bacteria 4523
425 Ga0495609_0024384 3300046538 Bacteria 2775
426 Ga0495609_0025904 3300046538 Bacteria 2686
427 Ga0495609_0049631 3300046538 Bacteria 1872
428 Ga0495609_0073302 3300046538 Bacteria 1502
429 Ga0495597_0013686 3300046542 Bacteria 3880
430 Ga0495597_0027590 3300046542 Bacteria 2603
431 Ga0495597_0065813 3300046542 Bacteria 1571
432 Ga0495597_0165849 3300046542 Bacteria 899
433 Ga0495645_0031563 3300046543 Bacteria 3861
434 Ga0495622_0000466 3300046557 Bacteria 25861
435 Ga0495622_0008678 3300046557 Bacteria 4708
436 Ga0495622_0028872 3300046557 Bacteria 2591
437 Ga0495633_0037972 3300046558 Bacteria 2302
438 Ga0495633_0063709 3300046558 Bacteria 1724
439 Ga0495633_0170388 3300046558 Bacteria 1003
440 Ga0495668_0055260 3300046616 Bacteria 2192
441 Ga0495668_0399741 3300046616 Bacteria 755
442 Ga0495634_0031347 3300046642 Bacteria 3662
443 Ga0495611_0000754 3300046648 Bacteria 18245
444 Ga0495611_0015226 3300046648 Bacteria 3288
445 Ga0495611_0073392 3300046648 Bacteria 1566
446 Ga0495611_0313494 3300046648 Bacteria 722
447 Ga0495611_0356061 3300046648 Bacteria 671
448 Ga0495625_0003106 3300046660 Bacteria 16971
449 Ga0495625_0010646 3300046660 Bacteria 7580
450 Ga0495625_0036242 3300046660 Bacteria 3627
451 Ga0495625_0036979 3300046660 Bacteria 3584
452 Ga0495625_0044071 3300046660 Bacteria 3231
453 Ga0495625_0045876 3300046660 Bacteria 3156
454 Ga0495625_0046549 3300046660 Bacteria 3129
455 Ga0495625_0046654 3300046660 Bacteria 3125
456 Ga0495625_0214353 3300046660 Bacteria 1264
457 Ga0495625_0245245 3300046660 Bacteria 1164
458 Ga0495625_0347342 3300046660 Bacteria 938
459 Ga0495635_0003679 3300046663 Bacteria 10623
460 Ga0495635_0030869 3300046663 Bacteria 3722
461 Ga0495659_0000386 3300046664 Bacteria 16969
462 Ga0495659_0001212 3300046664 Bacteria 8941
463 Ga0495659_0037352 3300046664 Bacteria 1720
464 Ga0495661_0052039 3300046665 Bacteria 2469
465 Ga0495661_0067428 3300046665 Bacteria 2102
466 Ga0495661_0077321 3300046665 Bacteria 1928
467 Ga0495661_0095914 3300046665 Bacteria 1678
468 Ga0495661_0100233 3300046665 Bacteria 1631
469 Ga0495588_0012866 3300046674 Bacteria 3968
470 Ga0495588_0031918 3300046674 Bacteria 2653
471 Ga0495588_0034510 3300046674 Bacteria 2560
472 Ga0495588_0103441 3300046674 Bacteria 1497
473 Ga0495657_0156489 3300046675 Bacteria 1412
474 Ga0495623_0007277 3300046679 Bacteria 7182
475 Ga0495623_0072459 3300046679 Bacteria 2142
476 Ga0495646_0003931 3300046680 Bacteria 9290
477 Ga0495646_0004999 3300046680 Bacteria 8369
478 Ga0495669_0028399 3300046684 Bacteria 2450
479 Ga0495613_0039106 3300046689 Bacteria 3516
480 Ga0495613_0040176 3300046689 Bacteria 3467
481 Ga0495613_0080638 3300046689 Bacteria 2365
482 Ga0495670_0001368 3300046691 Bacteria 11910
483 Ga0495670_0005757 3300046691 Bacteria 6073
484 Ga0495670_0009334 3300046691 Bacteria 4826
485 Ga0495670_0009391 3300046691 Bacteria 4807
486 Ga0495670_0039756 3300046691 Bacteria 2346
487 Ga0495670_0057740 3300046691 Bacteria 1948
488 Ga0495670_0074766 3300046691 Bacteria 1719
489 Ga0495670_0097114 3300046691 Bacteria 1513
490 Ga0495670_0127259 3300046691 Bacteria 1326
491 Ga0495670_0144692 3300046691 Bacteria 1245
492 Ga0495670_0257898 3300046691 Bacteria 930
493 Ga0495671_0000561 3300046692 Bacteria 27871
494 Ga0495671_0006816 3300046692 Bacteria 6562
495 Ga0495671_0019883 3300046692 Bacteria 3544
496 Ga0495671_0020219 3300046692 Bacteria 3509
497 Ga0495671_0026680 3300046692 Bacteria 2992
498 Ga0495671_0033873 3300046692 Bacteria 2600
499 Ga0495671_0041674 3300046692 Bacteria 2310
500 Ga0495671_0069766 3300046692 Bacteria 1727
501 Ga0495671_0083986 3300046692 Bacteria 1560
502 Ga0495649_0001584 3300046694 Bacteria 17031
503 Ga0495649_0002380 3300046694 Bacteria 13304
504 Ga0495649_0006788 3300046694 Bacteria 7087
505 Ga0495649_0008737 3300046694 Bacteria 6078
506 Ga0495649_0012199 3300046694 Bacteria 5010
507 Ga0495649_0017812 3300046694 Bacteria 4004
508 Ga0495649_0022466 3300046694 Bacteria 3529
509 Ga0495649_0025555 3300046694 Bacteria 3289
510 Ga0495649_0044231 3300046694 Bacteria 2431
511 Ga0495649_0231091 3300046694 Bacteria 954
512 Ga0495589_0000245 3300046794 Bacteria 45172
513 Ga0495589_0004328 3300046794 Bacteria 7578
514 Ga0495589_0005871 3300046794 Bacteria 6485
515 Ga0495589_0006208 3300046794 Bacteria 6309
516 Ga0495589_0010114 3300046794 Bacteria 4901
517 Ga0495589_0011587 3300046794 Bacteria 4578
518 Ga0495589_0015823 3300046794 Bacteria 3878
519 Ga0495589_0037256 3300046794 Bacteria 2436
520 Ga0495589_0037861 3300046794 Bacteria 2415
521 Ga0495589_0075844 3300046794 Bacteria 1639
522 Ga0495589_0079938 3300046794 Bacteria 1590
523 Ga0495600_0062942 3300046809 Bacteria 2424
524 Ga0495600_0179256 3300046809 Bacteria 1365
525 Ga0495600_0207266 3300046809 Bacteria 1257
526 Ga0495600_0232990 3300046809 Bacteria 1175
527 Ga0495660_0007063 3300046810 Bacteria 6618
528 Ga0495660_0009761 3300046810 Bacteria 5593
529 Ga0495660_0015524 3300046810 Bacteria 4398
530 Ga0495660_0017472 3300046810 Bacteria 4128
531 Ga0495660_0025166 3300046810 Bacteria 3382
532 Ga0495660_0027733 3300046810 Bacteria 3202
533 Ga0495660_0028829 3300046810 Bacteria 3134
534 Ga0495660_0032411 3300046810 Bacteria 2934
535 Ga0495660_0037886 3300046810 Bacteria 2684
536 Ga0495660_0051962 3300046810 Bacteria 2228
537 Ga0495660_0058447 3300046810 Bacteria 2077
538 Ga0495660_0204703 3300046810 Bacteria 940
539 Ga0495581_0014248 3300047315 Bacteria 4610
540 Ga0495581_0068339 3300047315 Bacteria 2054
541 Ga0495604_0003119 3300047317 Bacteria 13242
542 Ga0495604_0038173 3300047317 Bacteria 3779
543 Ga0495604_0077937 3300047317 Bacteria 2489
544 Ga0495636_0000767 3300047318 Bacteria 11818
545 Ga0495636_0135422 3300047318 Bacteria 1097
546 Ga0495674_0055542 3300047319 Bacteria 3472
547 Ga0495672_0002690 3300047320 Bacteria 15990
548 Ga0495672_0007133 3300047320 Bacteria 8458
549 Ga0495672_0011535 3300047320 Bacteria 6230
550 Ga0495672_0014878 3300047320 Bacteria 5306
551 Ga0495672_0016236 3300047320 Bacteria 5027
552 Ga0495672_0022015 3300047320 Bacteria 4149
553 Ga0495672_0022892 3300047320 Bacteria 4053
554 Ga0495672_0109129 3300047320 Bacteria 1487
555 Ga0495672_0140310 3300047320 Bacteria 1263
556 Ga0495680_0002200 3300047322 Bacteria 20182
557 Ga0495680_0043379 3300047322 Bacteria 3561
558 Ga0495680_0137913 3300047322 Bacteria 1787
559 Ga0495680_0186223 3300047322 Bacteria 1495
560 Ga0495683_0001158 3300047323 Bacteria 18111
561 Ga0495683_0009772 3300047323 Bacteria 5100
562 Ga0495683_0026419 3300047323 Bacteria 2970
563 Ga0495683_0063894 3300047323 Bacteria 1818
564 Ga0495683_0176789 3300047323 Bacteria 977
565 Ga0495687_001396 3300047443 Bacteria 22282
566 Ga0495687_006066 3300047443 Bacteria 7517
567 Ga0495687_015229 3300047443 Bacteria 3921
568 Ga0495687_019767 3300047443 Bacteria 3295
569 Ga0495675_0013112 3300047444 Bacteria 5228
570 Ga0495677_0004139 3300047445 Bacteria 5598
571 Ga0495679_008998 3300047446 Bacteria 4025
572 Ga0495679_009522 3300047446 Bacteria 3884
573 Ga0495679_009724 3300047446 Bacteria 3826
574 Ga0495679_019491 3300047446 Bacteria 2382
575 Ga0495679_024510 3300047446 Bacteria 2031
576 Ga0495685_019579 3300047447 Bacteria 2326
577 Ga0495685_152470 3300047447 Bacteria 750
578 Ga0495673_0001264 3300047469 Bacteria 20818
579 Ga0495673_0002635 3300047469 Bacteria 12426
580 Ga0495673_0004460 3300047469 Bacteria 8754
581 Ga0495673_0015317 3300047469 Bacteria 3953
582 Ga0495673_0016610 3300047469 Bacteria 3759
583 Ga0495673_0016832 3300047469 Bacteria 3726
584 Ga0495673_0016890 3300047469 Bacteria 3720
585 Ga0495673_0047401 3300047469 Bacteria 1899
586 Ga0495673_0050608 3300047469 Bacteria 1822
587 Ga0495673_0072953 3300047469 Bacteria 1439
588 Ga0495681_0000692 3300047470 Bacteria 25721
589 Ga0495681_0003667 3300047470 Bacteria 10663
590 Ga0495681_0006216 3300047470 Bacteria 7875
591 Ga0495681_0006575 3300047470 Bacteria 7613
592 Ga0495681_0013443 3300047470 Bacteria 4746
593 Ga0495681_0017662 3300047470 Bacteria 3953
594 Ga0495681_0035564 3300047470 Bacteria 2472
595 Ga0495681_0101699 3300047470 Bacteria 1255
596 Ga0495684_0010832 3300047471 Bacteria 7050
597 Ga0495686_0057531 3300047472 Bacteria 2426
598 Ga0495593_0028581 3300047673 Bacteria 3062
599 Ga0495593_0067024 3300047673 Bacteria 1869
600 Ga0495593_0077839 3300047673 Bacteria 1718
601 Ga0495602_0180425 3300048088 Bacteria 1629
602 Ga0495626_0000507 3300048091 Bacteria 38997
603 Ga0495626_0000941 3300048091 Bacteria 25315
604 Ga0495626_0001521 3300048091 Bacteria 18215
605 Ga0495626_0003386 3300048091 Bacteria 10262
606 Ga0495626_0007343 3300048091 Bacteria 6140
607 Ga0495626_0008314 3300048091 Bacteria 5703
608 Ga0495626_0015748 3300048091 Bacteria 3861
609 Ga0495626_0077169 3300048091 Bacteria 1485
610 Ga0496102_0051073 3300048905 Bacteria 3767
611 Ga0496102_0204801 3300048905 Bacteria 1860
612 Ga0496103_0052190 3300048906 Bacteria 2532
613 Ga0496104_0525750 3300048907 Bacteria 1094
614 Ga0496106_0108036 3300048909 Bacteria 2164
615 Ga0496110_0071795 3300048913 Bacteria 3070
616 Ga0496111_0053067 3300048914 Bacteria 2928
617 Ga0496116_0000242 3300048919 Bacteria 99455
618 Ga0496116_0001730 3300048919 Bacteria 23848
619 Ga0496116_0032061 3300048919 Bacteria 3751
620 Ga0496116_0054146 3300048919 Bacteria 2645
621 Ga0496116_0075783 3300048919 Bacteria 2109
622 Ga0496117_0000270 3300048920 Bacteria 97077
623 Ga0496117_0005168 3300048920 Bacteria 13927
624 Ga0496117_0019125 3300048920 Bacteria 5639
625 Ga0496117_0027449 3300048920 Bacteria 4437
626 Ga0496117_0042517 3300048920 Bacteria 3315
627 Ga0496117_0062240 3300048920 Bacteria 2558
628 Ga0496117_0065661 3300048920 Bacteria 2465
629 Ga0496117_0090948 3300048920 Bacteria 1964
630 Ga0496117_0092015 3300048920 Bacteria 1949
631 Ga0496118_0010776 3300048921 Bacteria 9011
632 Ga0496118_0020473 3300048921 Bacteria 5865
633 Ga0496118_0043972 3300048921 Bacteria 3503
634 Ga0496118_0057565 3300048921 Bacteria 2912
635 Ga0496118_0065260 3300048921 Bacteria 2664
636 Ga0496118_0107031 3300048921 Bacteria 1868
637 Ga0496119_0068428 3300048922 Bacteria 2090
638 Ga0496119_0265408 3300048922 Bacteria 860
639 Ga0496120_0100983 3300048923 Bacteria 1524
640 Ga0496121_0000318 3300048924 Bacteria 100833
641 Ga0496121_0021091 3300048924 Bacteria 6401
642 Ga0496121_0138041 3300048924 Bacteria 1813
643 Ga0496121_0385169 3300048924 Bacteria 923
644 Ga0496122_0012848 3300048925 Bacteria 8280
645 Ga0496122_0072859 3300048925 Bacteria 2439
646 Ga0496122_0146590 3300048925 Bacteria 1465
647 Ga0496123_0005798 3300048926 Bacteria 12263
648 Ga0496123_0067990 3300048926 Bacteria 2246
649 Ga0496123_0076258 3300048926 Bacteria 2064
650 Ga0496123_0085325 3300048926 Bacteria 1900
651 Ga0496124_0006474 3300048927 Bacteria 12748
652 Ga0496124_0023735 3300048927 Bacteria 5591
653 Ga0496124_0098994 3300048927 Bacteria 2365
654 Ga0496124_0103701 3300048927 Bacteria 2300
655 Ga0496124_0127466 3300048927 Bacteria 2026
656 Ga0496124_0178152 3300048927 Bacteria 1638
657 Ga0496124_0221284 3300048927 Bacteria 1423
658 Ga0496124_0246119 3300048927 Bacteria 1326
659 Ga0496125_0005587 3300048928 Bacteria 13894
660 Ga0496125_0005756 3300048928 Bacteria 13627
661 Ga0496125_0012297 3300048928 Bacteria 8505
662 Ga0496125_0038345 3300048928 Bacteria 4149
663 Ga0496126_0214692 3300048929 Bacteria 1618
664 Ga0495678_005703 3300049459 Bacteria 6774
665 Ga0495678_005802 3300049459 Bacteria 6703
666 Ga0495678_011515 3300049459 Bacteria 4229
667 Ga0495678_012469 3300049459 Bacteria 4027
668 Ga0495678_012911 3300049459 Bacteria 3939
669 Ga0495678_013108 3300049459 Bacteria 3904
670 Ga0495678_019721 3300049459 Bacteria 3000
671 Ga0495678_033248 3300049459 Bacteria 2130
672 Ga0495678_050474 3300049459 Bacteria 1612
673 Ga0495682_0003503 3300049460 Bacteria 6969
674 Ga0495682_0015073 3300049460 Bacteria 2929
675 Ga0495682_0023087 3300049460 Bacteria 2324
676 Ga0495682_0037189 3300049460 Bacteria 1791
677 Ga0495682_0038661 3300049460 Bacteria 1753
678 Ga0495682_0064986 3300049460 Bacteria 1315
679 Ga0495682_0077669 3300049460 Bacteria 1194
680 Ga0501240_000354 3300049673 Bacteria 3631
681 Ga0501241_001531 3300049758 Bacteria 4664
682 nmdc:mga03683_158814_c1 3300050489 Bacteria 1023
683 nmdc:mga03683_16851_c1 3300050489 Bacteria 2755
684 nmdc:mga03683_281514_c1 3300050489 Bacteria 777
685 nmdc:mga03683_91958_c1 3300050489 Bacteria 1324
686 nmdc:mga00v17_24526_c1 3300050491 Bacteria 3500
687 nmdc:mga00v17_41099_c1 3300050491 Bacteria 2776
688 nmdc:mga00v17_54485_c1 3300050491 Bacteria 2440
689 nmdc:mga00v17_70608_c1 3300050491 Bacteria 2163
690 nmdc:mga08x19_139661_c1 3300050514 Bacteria 1636
691 Ga0500586_024376 3300053145 Bacteria 1940

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014497 Ga0182008_10005997 Ga0182008_100059973 205
2 3300015261 Ga0182006_1007030 Ga0182006_10070303 205
3 3300030521 Ga0307511_10048564 Ga0307511_100485642 205
4 3300041405 Ga0439438_001361 Ga0439438_001361_5090_5707 205
5 3300041405 Ga0439438_019539 Ga0439438_019539_703_1320 205
6 3300041407 Ga0439447_000528 Ga0439447_000528_13008_13625 205
7 3300041407 Ga0439447_003168 Ga0439447_003168_3954_4571 205
8 3300041411 Ga0439466_0000612 Ga0439466_0000612_6143_6760 205
9 3300041411 Ga0439466_0007365 Ga0439466_0007365_3059_3676 205
10 3300042002 Ga0439442_033579 Ga0439442_033579_210_827 205
11 3300042006 Ga0439432_011173 Ga0439432_011173_1661_2278 205
12 3300042010 Ga0439452_001007 Ga0439452_001007_6143_6760 205
13 3300042013 Ga0439456_000938 Ga0439456_000938_123_740 205
14 3300042115 Ga0450911_000393 Ga0450911_000393_12487_13104 205
15 3300042137 Ga0450902_013598 Ga0450902_013598_413_1030 205
16 3300042145 Ga0450906_000778 Ga0450906_000778_6053_6670 205
17 3300042146 Ga0450907_001219 Ga0450907_001219_5056_5673 205
18 3300042185 Ga0450909_001829 Ga0450909_001829_1496_2113 205
19 3300042435 Ga0439434_0037124 Ga0439434_0037124_235_852 205
20 3300042439 Ga0439464_0003574 Ga0439464_0003574_2680_3297 205
21 3300042461 Ga0439460_0001249 Ga0439460_0001249_176_793 205
22 3300042531 Ga0450918_000953 Ga0450918_000953_417_1034 205
23 3300046452 Ga0495617_000380 Ga0495617_000380_18166_18786 205
24 3300046452 Ga0495617_037479 Ga0495617_037479_676_1293 205
25 3300046452 Ga0495617_118601 Ga0495617_118601_198_818 205
26 3300046453 Ga0495627_011512 Ga0495627_011512_2476_3093 205
27 3300046453 Ga0495627_065857 Ga0495627_065857_266_883 205
28 3300046458 Ga0495591_003848 Ga0495591_003848_5193_5810 205
29 3300046460 Ga0495638_0023744 Ga0495638_0023744_932_1549 205
30 3300046460 Ga0495638_0033848 Ga0495638_0033848_1748_2365 205
31 3300046460 Ga0495638_0285300 Ga0495638_0285300_83_700 205
32 3300046471 Ga0495650_0010451 Ga0495650_0010451_4069_4689 205
33 3300046471 Ga0495650_0018416 Ga0495650_0018416_1279_1896 205
34 3300046474 Ga0495605_0001927 Ga0495605_0001927_6270_6890 205
35 3300046474 Ga0495605_0030439 Ga0495605_0030439_1394_2011 205
36 3300046474 Ga0495605_0158874 Ga0495605_0158874_162_779 205
37 3300046491 Ga0495584_0003421 Ga0495584_0003421_5696_6316 205
38 3300046492 Ga0495585_0035157 Ga0495585_0035157_1921_2538 205
39 3300046501 Ga0495607_0002401 Ga0495607_0002401_8955_9575 205
40 3300046501 Ga0495607_0014250 Ga0495607_0014250_645_1265 205
41 3300046507 Ga0495606_0024580 Ga0495606_0024580_2074_2691 205
42 3300046512 Ga0495610_0015768 Ga0495610_0015768_1638_2255 205
43 3300046515 Ga0495620_0004714 Ga0495620_0004714_6866_7483 205
44 3300046517 Ga0495630_0174299 Ga0495630_0174299_891_1511 205
45 3300046518 Ga0495631_0029367 Ga0495631_0029367_1662_2279 205
46 3300046519 Ga0495632_0000952 Ga0495632_0000952_18830_19450 205
47 3300046519 Ga0495632_0026384 Ga0495632_0026384_685_1302 205
48 3300046519 Ga0495632_0164736 Ga0495632_0164736_272_889 205
49 3300046520 Ga0495637_0008428 Ga0495637_0008428_4187_4807 205
50 3300046520 Ga0495637_0034170 Ga0495637_0034170_1571_2188 205
51 3300046522 Ga0495643_0005972 Ga0495643_0005972_5059_5679 205
52 3300046524 Ga0495648_0010536 Ga0495648_0010536_5838_6455 205
53 3300046524 Ga0495648_0060441 Ga0495648_0060441_906_1526 205
54 3300046528 Ga0495642_0003008 Ga0495642_0003008_5367_5987 205
55 3300046530 Ga0495654_0007638 Ga0495654_0007638_1848_2468 205
56 3300046530 Ga0495654_0015938 Ga0495654_0015938_2347_3009 205
57 3300046538 Ga0495609_0000756 Ga0495609_0000756_19086_19706 205
58 3300046542 Ga0495597_0013686 Ga0495597_0013686_981_1598 205
59 3300046542 Ga0495597_0065813 Ga0495597_0065813_806_1426 205
60 3300046648 Ga0495611_0000754 Ga0495611_0000754_7057_7698 205
61 3300046648 Ga0495611_0015226 Ga0495611_0015226_377_997 205
62 3300046648 Ga0495611_0356061 Ga0495611_0356061_14_634 205
63 3300046660 Ga0495625_0003106 Ga0495625_0003106_16247_16864 205
64 3300046660 Ga0495625_0046549 Ga0495625_0046549_2350_2967 205
65 3300046664 Ga0495659_0037352 Ga0495659_0037352_21_641 205
66 3300046665 Ga0495661_0095914 Ga0495661_0095914_984_1604 205
67 3300046691 Ga0495670_0005757 Ga0495670_0005757_2766_3386 205
68 3300046691 Ga0495670_0009334 Ga0495670_0009334_3118_3735 205
69 3300046691 Ga0495670_0074766 Ga0495670_0074766_979_1596 205
70 3300046694 Ga0495649_0002380 Ga0495649_0002380_5852_6472 205
71 3300046694 Ga0495649_0044231 Ga0495649_0044231_1645_2262 205
72 3300046794 Ga0495589_0000245 Ga0495589_0000245_26369_26989 205
73 3300046809 Ga0495600_0207266 Ga0495600_0207266_102_722 205
74 3300046810 Ga0495660_0027733 Ga0495660_0027733_2030_2650 205
75 3300046810 Ga0495660_0037886 Ga0495660_0037886_446_1063 205
76 3300047318 Ga0495636_0000767 Ga0495636_0000767_4071_4691 205
77 3300047320 Ga0495672_0002690 Ga0495672_0002690_3699_4319 205
78 3300047322 Ga0495680_0137913 Ga0495680_0137913_207_827 205
79 3300047322 Ga0495680_0186223 Ga0495680_0186223_822_1442 205
80 3300047443 Ga0495687_001396 Ga0495687_001396_17499_18119 205
81 3300047443 Ga0495687_006066 Ga0495687_006066_2108_2725 205
82 3300047446 Ga0495679_009724 Ga0495679_009724_2641_3258 205
83 3300047446 Ga0495679_019491 Ga0495679_019491_1579_2196 205
84 3300047447 Ga0495685_019579 Ga0495685_019579_1230_1850 205
85 3300047469 Ga0495673_0002635 Ga0495673_0002635_4443_5063 205
86 3300047469 Ga0495673_0016610 Ga0495673_0016610_2614_3231 205
87 3300047469 Ga0495673_0016832 Ga0495673_0016832_2555_3172 205
88 3300047470 Ga0495681_0000692 Ga0495681_0000692_19387_20004 205
89 3300047470 Ga0495681_0101699 Ga0495681_0101699_476_1093 205
90 3300047673 Ga0495593_0028581 Ga0495593_0028581_738_1358 205
91 3300048091 Ga0495626_0000941 Ga0495626_0000941_18526_19143 205
92 3300048091 Ga0495626_0008314 Ga0495626_0008314_466_1086 205
93 3300049459 Ga0495678_005703 Ga0495678_005703_466_1086 205
94 3300050489 nmdc:mga03683_158814_c1 nmdc:mga03683_158814_c1_337_954 205
95 iso_pu_bacteria 8019769354 8019769428 205
96 iso_pu_bacteria 8057798959 8057802285 205
97 3300017792 Ga0163161_10003752 Ga0163161_1000375213 206
98 3300046519 Ga0495632_0004235 Ga0495632_0004235_897_1553 206
99 3300046692 Ga0495671_0020219 Ga0495671_0020219_2041_2697 206
100 iso_pu_bacteria 2600254931 2600363147 207
101 iso_pu_bacteria 2904518522 2904518552 207
102 3300009011 Ga0105251_10000033 Ga0105251_1000003351 208
103 3300009092 Ga0105250_10000203 Ga0105250_1000020320 208
104 3300025711 Ga0207696_1000127 Ga0207696_100012768 208
105 3300025735 Ga0207713_1000126 Ga0207713_100012668 208
106 3300046453 Ga0495627_001044 Ga0495627_001044_1012_1662 208
107 3300046458 Ga0495591_029884 Ga0495591_029884_324_974 208
108 3300046491 Ga0495584_0036571 Ga0495584_0036571_1171_1821 208
109 3300046500 Ga0495596_0009446 Ga0495596_0009446_710_1360 208
110 3300046506 Ga0495583_0022970 Ga0495583_0022970_811_1461 208
111 3300046512 Ga0495610_0042992 Ga0495610_0042992_878_1528 208
112 3300046513 Ga0495616_0028678 Ga0495616_0028678_1547_2197 208
113 3300046515 Ga0495620_0067828 Ga0495620_0067828_254_904 208
114 3300046518 Ga0495631_0060750 Ga0495631_0060750_369_1019 208
115 3300046520 Ga0495637_0001869 Ga0495637_0001869_10502_11152 208
116 3300046522 Ga0495643_0029787 Ga0495643_0029787_716_1366 208
117 3300046524 Ga0495648_0029419 Ga0495648_0029419_517_1167 208
118 3300046538 Ga0495609_0024384 Ga0495609_0024384_880_1530 208
119 3300046616 Ga0495668_0055260 Ga0495668_0055260_1006_1656 208
120 3300046691 Ga0495670_0001368 Ga0495670_0001368_868_1518 208
121 3300046794 Ga0495589_0037256 Ga0495589_0037256_1103_1753 208
122 3300047470 Ga0495681_0003667 Ga0495681_0003667_965_1615 208
123 3300047472 Ga0495686_0057531 Ga0495686_0057531_1180_1830 208
124 iso_pu_bacteria 3007866637 3007871871 208
125 3300046519 Ga0495632_0006265 Ga0495632_0006265_4090_4722 209
126 3300046520 Ga0495637_0007714 Ga0495637_0007714_1171_1803 209
127 3300046694 Ga0495649_0008737 Ga0495649_0008737_3670_4302 209
128 3300046794 Ga0495589_0005871 Ga0495589_0005871_2497_3129 209
129 3300048923 Ga0496120_0100983 Ga0496120_0100983_842_1513 209
130 iso_pu_bacteria 2511231018 2511337724 209
131 iso_pu_bacteria 2511231019 2511347378 209
132 iso_pu_bacteria 3007619802 3007623867 209
133 iso_pu_bacteria 2511231004 2511256235 210
134 iso_pu_bacteria 2511231006 2511264753 210
135 iso_pu_bacteria 2511231007 2511273698 210
136 iso_pu_bacteria 2511231008 2511279671 210
137 iso_pu_bacteria 2511231010 2511289628 210
138 iso_pu_bacteria 2511231016 2511325303 210
139 iso_pu_bacteria 2511231031 2511412386 210
140 iso_pu_bacteria 2512047018 2512325265 210
141 iso_pu_bacteria 2554235341 2555666992 210
142 iso_pu_bacteria 2582580891 2583795364 210
143 iso_pu_bacteria 2597489887 2597855242 210
144 iso_pu_bacteria 2599185160 2599355602 210
145 iso_pu_bacteria 2599185161 2599362995 210
146 iso_pu_bacteria 2599185162 2599368699 210
147 iso_pu_bacteria 2599185163 2599376104 210
148 iso_pu_bacteria 2599185164 2599380708 210
149 iso_pu_bacteria 2599185165 2599387776 210
150 iso_pu_bacteria 2599185166 2599394962 210
151 iso_pu_bacteria 2599185168 2599406727 210
152 iso_pu_bacteria 2599185181 2599462436 210
153 iso_pu_bacteria 2599185182 2599468141 210
154 iso_pu_bacteria 2599185185 2599487368 210
155 iso_pu_bacteria 2599185186 2599491453 210
156 iso_pu_bacteria 2599185257 2599804276 210
157 iso_pu_bacteria 2599185317 2600032244 210
158 iso_pu_bacteria 2599185324 2600073202 210
159 iso_pu_bacteria 2599185356 2600215058 210
160 iso_pu_bacteria 2600254930 2600361604 210
161 iso_pu_bacteria 2600255313 2601775224 210
162 iso_pu_bacteria 2600255318 2601798130 210
163 iso_pu_bacteria 2603880185 2606077018 210
164 iso_pu_bacteria 2603880199 2606129736 210
165 iso_pu_bacteria 2623620446 2624489438 210
166 iso_pu_bacteria 2643221565 2643843427 210
167 iso_pu_bacteria 2643221602 2644020143 210
168 iso_pu_bacteria 2643221633 2644184112 210
169 iso_pu_bacteria 2667528171 2671099636 210
170 iso_pu_bacteria 2671180172 2671771285 210
171 iso_pu_bacteria 2675903515 2678266552 210
172 iso_pu_bacteria 2713897149 2715754452 210
173 iso_pu_bacteria 2738543004 2739200940 210
174 iso_pu_bacteria 2744054620 2745007782 210
175 iso_pu_bacteria 2773857670 2774117977 210
176 iso_pu_bacteria 2784132072 2784316464 210
177 iso_pu_bacteria 2808606361 2808858338 210
178 iso_pu_bacteria 2808606376 2808923895 210
179 iso_pu_bacteria 2808606377 2808928059 210
180 iso_pu_bacteria 2808606378 2808938485 210
181 iso_pu_bacteria 2808606380 2808946250 210
182 iso_pu_bacteria 2808606381 2808950759 210
183 iso_pu_bacteria 2808606383 2808966837 210
184 iso_pu_bacteria 2808606389 2809001653 210
185 iso_pu_bacteria 2818991464 2819704783 210
186 iso_pu_bacteria 2842832357 2842833840 210
187 iso_pu_bacteria 2842854478 2842856019 210
188 iso_pu_bacteria 2844665904 2844667477 210
189 iso_pu_bacteria 2917070673 2917070726 210
190 iso_pu_bacteria 2919385768 2919388782 210
191 iso_pu_bacteria 2919697872 2919702357 210
192 iso_pu_bacteria 2931396565 2931398504 210
193 iso_pu_bacteria 2935353572 2935357939 210
194 iso_pu_bacteria 2939636861 2939640511 210
195 iso_pu_bacteria 2974289157 2974293679 210
196 iso_pu_bacteria 2984286254 2984292470 210
197 iso_pu_bacteria 2998139840 2998140130 210
198 iso_pu_bacteria 3007419365 3007419629 210
199 iso_pu_bacteria 3007614139 3007616989 210
200 iso_pu_bacteria 3007718800 3007722703 210
201 iso_pu_bacteria 8015687852 8015687905 210
202 iso_pu_bacteria 8019775933 8019779580 210
203 iso_pu_bacteria 8029995093 8029995122 210
204 iso_pu_bacteria 8055770955 8055771006 210
205 iso_pu_bacteria 8056143049 8056143348 210
206 iso_pu_bacteria 8056166840 8056170918 210
207 iso_pu_bacteria 8056569372 8056570858 210
208 3300041407 Ga0439447_007572 Ga0439447_007572_472_1110 211
209 3300041411 Ga0439466_0000697 Ga0439466_0000697_11185_11832 211
210 3300042006 Ga0439432_008379 Ga0439432_008379_415_1053 211
211 3300042146 Ga0450907_003449 Ga0450907_003449_654_1292 211
212 3300046491 Ga0495584_0022996 Ga0495584_0022996_382_1017 211
213 3300046519 Ga0495632_0018560 Ga0495632_0018560_2542_3177 211
214 3300046660 Ga0495625_0036242 Ga0495625_0036242_597_1232 211
215 3300046810 Ga0495660_0017472 Ga0495660_0017472_2684_3319 211
216 3300048091 Ga0495626_0015748 Ga0495626_0015748_643_1278 211
217 3300049459 Ga0495678_013108 Ga0495678_013108_2518_3153 211
218 3300049673 Ga0501240_000354 Ga0501240_000354_2253_2891 211
219 3300009011 Ga0105251_10001441 Ga0105251_1000144116 213
220 3300009011 Ga0105251_10093819 Ga0105251_100938192 213
221 3300009036 Ga0105244_10044038 Ga0105244_100440382 213
222 3300009148 Ga0105243_10007583 Ga0105243_100075837 213
223 3300025728 Ga0207655_1000135 Ga0207655_100013573 213
224 3300025935 Ga0207709_10004320 Ga0207709_100043202 213
225 3300031548 Ga0307408_100332726 Ga0307408_1003327261 213
226 3300041413 Ga0439465_0020056 Ga0439465_0020056_804_1448 213
227 3300042009 Ga0439451_017844 Ga0439451_017844_498_1142 213
228 3300042016 Ga0439463_001325 Ga0439463_001325_466_1110 213
229 3300042121 Ga0450919_000266 Ga0450919_000266_420_1064 213
230 3300042124 Ga0450922_000802 Ga0450922_000802_2413_3057 213
231 3300042147 Ga0450910_000588 Ga0450910_000588_3481_4125 213
232 3300042184 Ga0450908_001021 Ga0450908_001021_723_1367 213
233 3300042532 Ga0450893_0018169 Ga0450893_0018169_436_1080 213
234 3300046519 Ga0495632_0024744 Ga0495632_0024744_2421_3062 213
235 3300050491 nmdc:mga00v17_24526_c1 nmdc:mga00v17_24526_c1_2477_3118 213
236 2124908027 MRS2a_Contig_126 MRS2a_00027210 214
237 2124908027 MRS2a_Contig_780 MRS2a_00637380 214
238 2124908027 MRS2a_Contig_9063 MRS2a_00494460 214
239 3300002771 JGI25163J39215_1000433 JGI25163J39215_10004334 214
240 3300002772 JGI25164J39214_1000274 JGI25164J39214_100027433 214
241 3300003214 JGI25165J46597_1000175 JGI25165J46597_100017565 214
242 3300003759 Ga0055525_1006866 Ga0055525_10068661 214
243 3300003781 Ga0055536_1000241 Ga0055536_100024122 214
244 3300003791 Ga0055530_10000159 Ga0055530_1000015929 214
245 3300003791 Ga0055530_10002447 Ga0055530_100024477 214
246 3300003791 Ga0055530_10021263 Ga0055530_100212633 214
247 3300003792 Ga0055540_1000378 Ga0055540_100037831 214
248 3300003792 Ga0055540_1000725 Ga0055540_100072511 214
249 3300003794 Ga0055531_10000278 Ga0055531_100002787 214
250 3300005288 Ga0065714_10000066 Ga0065714_100000664 214
251 3300005288 Ga0065714_10006067 Ga0065714_100060674 214
252 3300005288 Ga0065714_10075096 Ga0065714_100750963 214
253 3300005288 Ga0065714_10156917 Ga0065714_101569172 214
254 3300005289 Ga0065704_10095391 Ga0065704_100953913 214
255 3300005290 Ga0065712_10003630 Ga0065712_100036302 214
256 3300005293 Ga0065715_10010939 Ga0065715_100109392 214
257 3300005328 Ga0070676_10456924 Ga0070676_104569241 214
258 3300005548 Ga0070665_100087129 Ga0070665_1000871292 214
259 3300005548 Ga0070665_100365880 Ga0070665_1003658801 214
260 3300006051 Ga0075364_10061280 Ga0075364_100612804 214
261 3300006051 Ga0075364_10133719 Ga0075364_101337191 214
262 3300006051 Ga0075364_10161423 Ga0075364_101614233 214
263 3300006051 Ga0075364_10239839 Ga0075364_102398391 214
264 3300006051 Ga0075364_10304082 Ga0075364_103040822 214
265 3300006058 Ga0075432_10008289 Ga0075432_100082893 214
266 3300006058 Ga0075432_10011873 Ga0075432_100118732 214
267 3300006914 Ga0075436_100085218 Ga0075436_1000852182 214
268 3300006914 Ga0075436_100337277 Ga0075436_1003372772 214
269 3300006946 Ga0079104_1000291 Ga0079104_100029131 214
270 3300006946 Ga0079104_1013191 Ga0079104_10131912 214
271 3300009011 Ga0105251_10015803 Ga0105251_100158033 214
272 3300009011 Ga0105251_10121079 Ga0105251_101210791 214
273 3300009036 Ga0105244_10001003 Ga0105244_1000100323 214
274 3300009036 Ga0105244_10004611 Ga0105244_100046116 214
275 3300009036 Ga0105244_10007387 Ga0105244_100073871 214
276 3300009036 Ga0105244_10015803 Ga0105244_100158034 214
277 3300009036 Ga0105244_10021019 Ga0105244_100210192 214
278 3300009036 Ga0105244_10041120 Ga0105244_100411203 214
279 3300009036 Ga0105244_10070993 Ga0105244_100709933 214
280 3300009092 Ga0105250_10006448 Ga0105250_100064483 214
281 3300009092 Ga0105250_10023299 Ga0105250_100232994 214
282 3300009098 Ga0105245_11116848 Ga0105245_111168481 214
283 3300009148 Ga0105243_10000075 Ga0105243_1000007551 214
284 3300009148 Ga0105243_10000823 Ga0105243_1000082326 214
285 3300009148 Ga0105243_10032759 Ga0105243_100327592 214
286 3300009148 Ga0105243_10046493 Ga0105243_100464933 214
287 3300009148 Ga0105243_10147065 Ga0105243_101470652 214
288 3300009176 Ga0105242_10011641 Ga0105242_100116414 214
289 3300009553 Ga0105249_10010831 Ga0105249_100108313 214
290 3300011119 Ga0105246_10000131 Ga0105246_1000013122 214
291 3300011119 Ga0105246_10050273 Ga0105246_100502733 214
292 3300012498 Ga0157345_1000404 Ga0157345_10004044 214
293 3300013100 Ga0157373_10009904 Ga0157373_100099043 214
294 3300013100 Ga0157373_10022035 Ga0157373_100220352 214
295 3300013100 Ga0157373_10177855 Ga0157373_101778552 214
296 3300013102 Ga0157371_10001263 Ga0157371_1000126316 214
297 3300013102 Ga0157371_10001943 Ga0157371_1000194326 214
298 3300013102 Ga0157371_10013654 Ga0157371_100136544 214
299 3300013104 Ga0157370_10141604 Ga0157370_101416043 214
300 3300013104 Ga0157370_10202119 Ga0157370_102021192 214
301 3300013105 Ga0157369_10178257 Ga0157369_101782572 214
302 3300013105 Ga0157369_10203334 Ga0157369_102033342 214
303 3300013105 Ga0157369_10586115 Ga0157369_105861153 214
304 3300013306 Ga0163162_10102300 Ga0163162_101023002 214
305 3300013306 Ga0163162_10545029 Ga0163162_105450292 214
306 3300013308 Ga0157375_10012327 Ga0157375_100123274 214
307 3300013308 Ga0157375_10287862 Ga0157375_102878621 214
308 3300014325 Ga0163163_10804000 Ga0163163_108040002 214
309 3300014497 Ga0182008_10000367 Ga0182008_1000036716 214
310 3300014497 Ga0182008_10145082 Ga0182008_101450822 214
311 3300015261 Ga0182006_1000961 Ga0182006_10009618 214
312 3300015262 Ga0182007_10000742 Ga0182007_100007428 214
313 3300015262 Ga0182007_10050738 Ga0182007_100507382 214
314 3300015265 Ga0182005_1000885 Ga0182005_100088516 214
315 3300015265 Ga0182005_1001322 Ga0182005_10013225 214
316 3300015265 Ga0182005_1009073 Ga0182005_10090734 214
317 3300017792 Ga0163161_10006852 Ga0163161_100068523 214
318 3300017792 Ga0163161_10014499 Ga0163161_100144994 214
319 3300017792 Ga0163161_10038640 Ga0163161_100386403 214
320 3300017792 Ga0163161_10054637 Ga0163161_100546372 214
321 3300017792 Ga0163161_10060564 Ga0163161_100605643 214
322 3300017792 Ga0163161_10126849 Ga0163161_101268492 214
323 3300025207 Ga0209760_100082 Ga0209760_10008218 214
324 3300025230 Ga0209563_100602 Ga0209563_1006024 214
325 3300025231 Ga0207427_100005 Ga0207427_100005683 214
326 3300025233 Ga0209437_100018 Ga0209437_100018593 214
327 3300025261 Ga0209233_1000021 Ga0209233_1000021683 214
328 3300025284 Ga0209130_1019195 Ga0209130_10191951 214
329 3300025291 Ga0209675_1002845 Ga0209675_10028453 214
330 3300025292 Ga0209676_1000015 Ga0209676_100001531 214
331 3300025292 Ga0209676_1000157 Ga0209676_100015731 214
332 3300025292 Ga0209676_1000222 Ga0209676_100022269 214
333 3300025292 Ga0209676_1002476 Ga0209676_10024769 214
334 3300025298 Ga0209050_1000030 Ga0209050_1000030407 214
335 3300025298 Ga0209050_1000296 Ga0209050_100029669 214
336 3300025298 Ga0209050_1001114 Ga0209050_10011147 214
337 3300025303 Ga0209051_1000143 Ga0209051_100014331 214
338 3300025303 Ga0209051_1000295 Ga0209051_100029511 214
339 3300025303 Ga0209051_1005949 Ga0209051_10059493 214
340 3300025304 Ga0209257_1000422 Ga0209257_100042231 214
341 3300025711 Ga0207696_1014668 Ga0207696_10146681 214
342 3300025728 Ga0207655_1000652 Ga0207655_10006523 214
343 3300025728 Ga0207655_1000961 Ga0207655_100096125 214
344 3300025728 Ga0207655_1002694 Ga0207655_10026944 214
345 3300025728 Ga0207655_1009319 Ga0207655_10093192 214
346 3300025728 Ga0207655_1010881 Ga0207655_10108814 214
347 3300025728 Ga0207655_1018520 Ga0207655_10185205 214
348 3300025728 Ga0207655_1019603 Ga0207655_10196033 214
349 3300025728 Ga0207655_1021543 Ga0207655_10215433 214
350 3300025735 Ga0207713_1001900 Ga0207713_10019002 214
351 3300025735 Ga0207713_1003162 Ga0207713_10031624 214
352 3300025735 Ga0207713_1003858 Ga0207713_100385812 214
353 3300025735 Ga0207713_1008765 Ga0207713_10087653 214
354 3300025735 Ga0207713_1014324 Ga0207713_10143242 214
355 3300025735 Ga0207713_1081322 Ga0207713_10813221 214
356 3300025935 Ga0207709_10000107 Ga0207709_1000010796 214
357 3300025935 Ga0207709_10000269 Ga0207709_1000026954 214
358 3300025961 Ga0207712_10007010 Ga0207712_100070104 214
359 3300027111 Ga0209281_1000237 Ga0209281_100023750 214
360 3300027111 Ga0209281_1017879 Ga0209281_10178792 214
361 3300027111 Ga0209281_1024515 Ga0209281_10245152 214
362 3300027907 Ga0207428_10013002 Ga0207428_100130026 214
363 3300027907 Ga0207428_10018210 Ga0207428_100182106 214
364 3300027907 Ga0207428_10045751 Ga0207428_100457514 214
365 3300028379 Ga0268266_10161859 Ga0268266_101618592 214
366 3300030521 Ga0307511_10124786 Ga0307511_101247862 214
367 3300030734 Ga0316179_1023690 Ga0316179_10236904 214
368 3300030735 Ga0316178_1040639 Ga0316178_10406394 214
369 3300031507 Ga0307509_10044340 Ga0307509_100443403 214
370 3300031548 Ga0307408_100042105 Ga0307408_1000421054 214
371 3300031548 Ga0307408_100458269 Ga0307408_1004582692 214
372 3300031730 Ga0307516_10504584 Ga0307516_105045842 214
373 3300031911 Ga0307412_10008301 Ga0307412_100083014 214
374 3300031911 Ga0307412_10014426 Ga0307412_100144264 214
375 3300031995 Ga0307409_100019888 Ga0307409_1000198883 214
376 3300032002 Ga0307416_100028527 Ga0307416_1000285274 214
377 3300032004 Ga0307414_10007727 Ga0307414_100077274 214
378 3300032004 Ga0307414_10319163 Ga0307414_103191631 214
379 3300032005 Ga0307411_10023905 Ga0307411_100239053 214
380 3300033180 Ga0307510_10003851 Ga0307510_100038518 214
381 3300041405 Ga0439438_002135 Ga0439438_002135_1555_2199 214
382 3300041405 Ga0439438_003946 Ga0439438_003946_4326_4973 214
383 3300041405 Ga0439438_004173 Ga0439438_004173_4113_4760 214
384 3300041405 Ga0439438_017478 Ga0439438_017478_33_677 214
385 3300041405 Ga0439438_029721 Ga0439438_029721_497_1141 214
386 3300041407 Ga0439447_002748 Ga0439447_002748_1794_2438 214
387 3300041407 Ga0439447_003112 Ga0439447_003112_1301_1945 214
388 3300041407 Ga0439447_023496 Ga0439447_023496_407_1054 214
389 3300041407 Ga0439447_068059 Ga0439447_068059_39_686 214
390 3300041411 Ga0439466_0002598 Ga0439466_0002598_989_1633 214
391 3300041411 Ga0439466_0006461 Ga0439466_0006461_2700_3347 214
392 3300041411 Ga0439466_0029796 Ga0439466_0029796_484_1131 214
393 3300041411 Ga0439466_0033419 Ga0439466_0033419_793_1437 214
394 3300041411 Ga0439466_0072798 Ga0439466_0072798_62_706 214
395 3300042004 Ga0439445_0007773 Ga0439445_0007773_982_1629 214
396 3300042004 Ga0439445_0039917 Ga0439445_0039917_154_798 214
397 3300042009 Ga0439451_000759 Ga0439451_000759_2955_3602 214
398 3300042009 Ga0439451_002587 Ga0439451_002587_333_980 214
399 3300042009 Ga0439451_011134 Ga0439451_011134_426_1070 214
400 3300042009 Ga0439451_016879 Ga0439451_016879_775_1431 214
401 3300042009 Ga0439451_030072 Ga0439451_030072_345_989 214
402 3300042010 Ga0439452_000435 Ga0439452_000435_18305_18949 214
403 3300042010 Ga0439452_000563 Ga0439452_000563_965_1612 214
404 3300042010 Ga0439452_002477 Ga0439452_002477_2488_3132 214
405 3300042010 Ga0439452_013627 Ga0439452_013627_751_1395 214
406 3300042013 Ga0439456_001936 Ga0439456_001936_2861_3508 214
407 3300042013 Ga0439456_003667 Ga0439456_003667_571_1218 214
408 3300042013 Ga0439456_015613 Ga0439456_015613_620_1264 214
409 3300042016 Ga0439463_001255 Ga0439463_001255_3246_3893 214
410 3300042016 Ga0439463_009503 Ga0439463_009503_996_1643 214
411 3300042016 Ga0439463_017788 Ga0439463_017788_240_887 214
412 3300042115 Ga0450911_001286 Ga0450911_001286_4363_5010 214
413 3300042121 Ga0450919_000593 Ga0450919_000593_2529_3173 214
414 3300042122 Ga0450920_003573 Ga0450920_003573_1723_2367 214
415 3300042124 Ga0450922_000085 Ga0450922_000085_1759_2403 214
416 3300042125 Ga0450923_009463 Ga0450923_009463_680_1324 214
417 3300042136 Ga0450900_003697 Ga0450900_003697_469_1116 214
418 3300042137 Ga0450902_001341 Ga0450902_001341_2668_3315 214
419 3300042137 Ga0450902_003593 Ga0450902_003593_719_1366 214
420 3300042138 Ga0450903_018786 Ga0450903_018786_331_978 214
421 3300042139 Ga0450904_002383 Ga0450904_002383_847_1494 214
422 3300042139 Ga0450904_003083 Ga0450904_003083_814_1461 214
423 3300042142 Ga0450905_000916 Ga0450905_000916_716_1363 214
424 3300042142 Ga0450905_009990 Ga0450905_009990_590_1234 214
425 3300042145 Ga0450906_001204 Ga0450906_001204_880_1527 214
426 3300042145 Ga0450906_001384 Ga0450906_001384_1504_2148 214
427 3300042146 Ga0450907_000357 Ga0450907_000357_12479_13123 214
428 3300042146 Ga0450907_002598 Ga0450907_002598_1823_2470 214
429 3300042146 Ga0450907_004066 Ga0450907_004066_773_1417 214
430 3300042156 Ga0439446_0024191 Ga0439446_0024191_982_1626 214
431 3300042184 Ga0450908_003721 Ga0450908_003721_686_1330 214
432 3300042185 Ga0450909_001568 Ga0450909_001568_216_860 214
433 3300042435 Ga0439434_0002979 Ga0439434_0002979_3346_3990 214
434 3300042461 Ga0439460_0000423 Ga0439460_0000423_136_780 214
435 3300042461 Ga0439460_0087706 Ga0439460_0087706_166_810 214
436 3300042531 Ga0450918_005517 Ga0450918_005517_788_1435 214
437 3300042531 Ga0450918_021543 Ga0450918_021543_359_1003 214
438 3300042532 Ga0450893_0008804 Ga0450893_0008804_577_1224 214
439 3300042993 Ga0439440_0006164 Ga0439440_0006164_894_1550 214
440 3300046452 Ga0495617_010148 Ga0495617_010148_1674_2318 214
441 3300046452 Ga0495617_017380 Ga0495617_017380_423_1067 214
442 3300046452 Ga0495617_018910 Ga0495617_018910_1233_1877 214
443 3300046452 Ga0495617_019285 Ga0495617_019285_707_1351 214
444 3300046452 Ga0495617_132823 Ga0495617_132823_98_742 214
445 3300046455 Ga0495603_0021167 Ga0495603_0021167_2090_2737 214
446 3300046455 Ga0495603_0043324 Ga0495603_0043324_198_845 214
447 3300046457 Ga0495590_0002808 Ga0495590_0002808_5906_6550 214
448 3300046457 Ga0495590_0033756 Ga0495590_0033756_355_999 214
449 3300046457 Ga0495590_0105024 Ga0495590_0105024_259_906 214
450 3300046458 Ga0495591_009425 Ga0495591_009425_414_1058 214
451 3300046458 Ga0495591_013145 Ga0495591_013145_1480_2124 214
452 3300046458 Ga0495591_019691 Ga0495591_019691_746_1393 214
453 3300046459 Ga0495629_0014547 Ga0495629_0014547_1499_2146 214
454 3300046460 Ga0495638_0016165 Ga0495638_0016165_1905_2552 214
455 3300046460 Ga0495638_0019195 Ga0495638_0019195_1011_1655 214
456 3300046460 Ga0495638_0041481 Ga0495638_0041481_433_1077 214
457 3300046460 Ga0495638_0077777 Ga0495638_0077777_492_1136 214
458 3300046460 Ga0495638_0082308 Ga0495638_0082308_1140_1787 214
459 3300046463 Ga0495653_0013163 Ga0495653_0013163_4008_4655 214
460 3300046463 Ga0495653_0049227 Ga0495653_0049227_1343_1993 214
461 3300046471 Ga0495650_0013756 Ga0495650_0013756_2485_3129 214
462 3300046471 Ga0495650_0033127 Ga0495650_0033127_761_1405 214
463 3300046473 Ga0495582_0011519 Ga0495582_0011519_631_1278 214
464 3300046474 Ga0495605_0010536 Ga0495605_0010536_2137_2784 214
465 3300046474 Ga0495605_0034714 Ga0495605_0034714_998_1648 214
466 3300046474 Ga0495605_0045549 Ga0495605_0045549_1320_1967 214
467 3300046474 Ga0495605_0049589 Ga0495605_0049589_423_1082 214
468 3300046474 Ga0495605_0051652 Ga0495605_0051652_380_1024 214
469 3300046475 Ga0495639_0000239 Ga0495639_0000239_7252_7899 214
470 3300046475 Ga0495639_0011704 Ga0495639_0011704_252_899 214
471 3300046475 Ga0495639_0120892 Ga0495639_0120892_453_1097 214
472 3300046491 Ga0495584_0003267 Ga0495584_0003267_5666_6313 214
473 3300046491 Ga0495584_0004470 Ga0495584_0004470_602_1246 214
474 3300046491 Ga0495584_0008729 Ga0495584_0008729_1635_2282 214
475 3300046491 Ga0495584_0009357 Ga0495584_0009357_2664_3308 214
476 3300046491 Ga0495584_0015172 Ga0495584_0015172_2577_3221 214
477 3300046491 Ga0495584_0077394 Ga0495584_0077394_698_1342 214
478 3300046491 Ga0495584_0167597 Ga0495584_0167597_413_1072 214
479 3300046492 Ga0495585_0000800 Ga0495585_0000800_21207_21863 214
480 3300046492 Ga0495585_0010077 Ga0495585_0010077_4001_4660 214
481 3300046492 Ga0495585_0021682 Ga0495585_0021682_2266_2913 214
482 3300046492 Ga0495585_0050632 Ga0495585_0050632_730_1389 214
483 3300046499 Ga0495594_0025909 Ga0495594_0025909_994_1638 214
484 3300046499 Ga0495594_0155761 Ga0495594_0155761_60_707 214
485 3300046499 Ga0495594_0185542 Ga0495594_0185542_341_988 214
486 3300046501 Ga0495607_0017659 Ga0495607_0017659_326_973 214
487 3300046501 Ga0495607_0023541 Ga0495607_0023541_2436_3080 214
488 3300046501 Ga0495607_0032978 Ga0495607_0032978_960_1604 214
489 3300046501 Ga0495607_0074010 Ga0495607_0074010_536_1180 214
490 3300046506 Ga0495583_0001586 Ga0495583_0001586_2921_3580 214
491 3300046506 Ga0495583_0020431 Ga0495583_0020431_2472_3116 214
492 3300046506 Ga0495583_0040261 Ga0495583_0040261_226_870 214
493 3300046506 Ga0495583_0046724 Ga0495583_0046724_380_1027 214
494 3300046507 Ga0495606_0006756 Ga0495606_0006756_5497_6144 214
495 3300046507 Ga0495606_0020688 Ga0495606_0020688_884_1528 214
496 3300046507 Ga0495606_0053966 Ga0495606_0053966_1356_2012 214
497 3300046507 Ga0495606_0087322 Ga0495606_0087322_675_1319 214
498 3300046512 Ga0495610_0014224 Ga0495610_0014224_3673_4317 214
499 3300046512 Ga0495610_0016431 Ga0495610_0016431_2697_3341 214
500 3300046512 Ga0495610_0017352 Ga0495610_0017352_531_1175 214
501 3300046512 Ga0495610_0020852 Ga0495610_0020852_568_1224 214
502 3300046512 Ga0495610_0039857 Ga0495610_0039857_834_1481 214
503 3300046512 Ga0495610_0086344 Ga0495610_0086344_591_1238 214
504 3300046513 Ga0495616_0001775 Ga0495616_0001775_5616_6386 214
505 3300046513 Ga0495616_0006850 Ga0495616_0006850_810_1457 214
506 3300046513 Ga0495616_0033803 Ga0495616_0033803_1026_1670 214
507 3300046513 Ga0495616_0042038 Ga0495616_0042038_921_1565 214
508 3300046513 Ga0495616_0087655 Ga0495616_0087655_207_851 214
509 3300046513 Ga0495616_0119015 Ga0495616_0119015_380_1024 214
510 3300046515 Ga0495620_0006500 Ga0495620_0006500_5136_5780 214
511 3300046515 Ga0495620_0010348 Ga0495620_0010348_930_1574 214
512 3300046515 Ga0495620_0029283 Ga0495620_0029283_1219_1866 214
513 3300046517 Ga0495630_0062785 Ga0495630_0062785_550_1197 214
514 3300046517 Ga0495630_0119908 Ga0495630_0119908_879_1529 214
515 3300046517 Ga0495630_0328978 Ga0495630_0328978_71_715 214
516 3300046518 Ga0495631_0001056 Ga0495631_0001056_6086_6733 214
517 3300046518 Ga0495631_0014109 Ga0495631_0014109_721_1365 214
518 3300046518 Ga0495631_0045367 Ga0495631_0045367_221_865 214
519 3300046518 Ga0495631_0046642 Ga0495631_0046642_1079_1726 214
520 3300046519 Ga0495632_0002331 Ga0495632_0002331_963_1607 214
521 3300046519 Ga0495632_0019858 Ga0495632_0019858_2420_3064 214
522 3300046519 Ga0495632_0114646 Ga0495632_0114646_329_973 214
523 3300046520 Ga0495637_0003537 Ga0495637_0003537_5108_5755 214
524 3300046520 Ga0495637_0006880 Ga0495637_0006880_945_1589 214
525 3300046520 Ga0495637_0013354 Ga0495637_0013354_2619_3299 214
526 3300046520 Ga0495637_0033244 Ga0495637_0033244_442_1086 214
527 3300046520 Ga0495637_0043692 Ga0495637_0043692_233_877 214
528 3300046520 Ga0495637_0092180 Ga0495637_0092180_135_782 214
529 3300046522 Ga0495643_0021753 Ga0495643_0021753_2079_2738 214
530 3300046523 Ga0495644_0018084 Ga0495644_0018084_1750_2409 214
531 3300046523 Ga0495644_0174233 Ga0495644_0174233_26_673 214
532 3300046524 Ga0495648_0004730 Ga0495648_0004730_7943_8587 214
533 3300046524 Ga0495648_0009264 Ga0495648_0009264_1738_2382 214
534 3300046524 Ga0495648_0024416 Ga0495648_0024416_2680_3324 214
535 3300046524 Ga0495648_0026432 Ga0495648_0026432_765_1409 214
536 3300046524 Ga0495648_0046402 Ga0495648_0046402_1321_1965 214
537 3300046524 Ga0495648_0075231 Ga0495648_0075231_389_1036 214
538 3300046524 Ga0495648_0154831 Ga0495648_0154831_219_863 214
539 3300046526 Ga0495666_0005622 Ga0495666_0005622_5036_5680 214
540 3300046526 Ga0495666_0017177 Ga0495666_0017177_2320_2964 214
541 3300046526 Ga0495666_0018165 Ga0495666_0018165_1313_1960 214
542 3300046526 Ga0495666_0223262 Ga0495666_0223262_39_686 214
543 3300046528 Ga0495642_0000368 Ga0495642_0000368_961_1605 214
544 3300046528 Ga0495642_0196396 Ga0495642_0196396_45_689 214
545 3300046529 Ga0495652_0264488 Ga0495652_0264488_72_722 214
546 3300046530 Ga0495654_0004733 Ga0495654_0004733_702_1349 214
547 3300046530 Ga0495654_0006704 Ga0495654_0006704_5211_5855 214
548 3300046530 Ga0495654_0011144 Ga0495654_0011144_2568_3212 214
549 3300046530 Ga0495654_0014551 Ga0495654_0014551_469_1113 214
550 3300046530 Ga0495654_0070196 Ga0495654_0070196_761_1405 214
551 3300046530 Ga0495654_0072939 Ga0495654_0072939_55_702 214
552 3300046530 Ga0495654_0105410 Ga0495654_0105410_432_1076 214
553 3300046530 Ga0495654_0107024 Ga0495654_0107024_29_673 214
554 3300046530 Ga0495654_0136618 Ga0495654_0136618_374_1021 214
555 3300046530 Ga0495654_0152199 Ga0495654_0152199_335_979 214
556 3300046535 Ga0495586_0138210 Ga0495586_0138210_518_1165 214
557 3300046536 Ga0495587_0004632 Ga0495587_0004632_7728_8375 214
558 3300046536 Ga0495587_0052443 Ga0495587_0052443_537_1187 214
559 3300046538 Ga0495609_0009275 Ga0495609_0009275_844_1488 214
560 3300046538 Ga0495609_0010169 Ga0495609_0010169_3251_3898 214
561 3300046538 Ga0495609_0025904 Ga0495609_0025904_666_1310 214
562 3300046538 Ga0495609_0049631 Ga0495609_0049631_28_672 214
563 3300046538 Ga0495609_0073302 Ga0495609_0073302_641_1285 214
564 3300046542 Ga0495597_0027590 Ga0495597_0027590_969_1628 214
565 3300046542 Ga0495597_0165849 Ga0495597_0165849_124_771 214
566 3300046543 Ga0495645_0031563 Ga0495645_0031563_3096_3743 214
567 3300046557 Ga0495622_0000466 Ga0495622_0000466_17904_18551 214
568 3300046557 Ga0495622_0008678 Ga0495622_0008678_188_832 214
569 3300046557 Ga0495622_0028872 Ga0495622_0028872_1516_2160 214
570 3300046558 Ga0495633_0037972 Ga0495633_0037972_484_1128 214
571 3300046558 Ga0495633_0063709 Ga0495633_0063709_384_1031 214
572 3300046558 Ga0495633_0170388 Ga0495633_0170388_98_745 214
573 3300046616 Ga0495668_0399741 Ga0495668_0399741_47_694 214
574 3300046642 Ga0495634_0031347 Ga0495634_0031347_905_1555 214
575 3300046648 Ga0495611_0073392 Ga0495611_0073392_359_1003 214
576 3300046648 Ga0495611_0313494 Ga0495611_0313494_27_671 214
577 3300046660 Ga0495625_0010646 Ga0495625_0010646_927_1571 214
578 3300046660 Ga0495625_0036979 Ga0495625_0036979_479_1126 214
579 3300046660 Ga0495625_0044071 Ga0495625_0044071_1674_2318 214
580 3300046660 Ga0495625_0045876 Ga0495625_0045876_1801_2445 214
581 3300046660 Ga0495625_0046654 Ga0495625_0046654_1473_2120 214
582 3300046660 Ga0495625_0214353 Ga0495625_0214353_300_947 214
583 3300046660 Ga0495625_0245245 Ga0495625_0245245_270_914 214
584 3300046660 Ga0495625_0347342 Ga0495625_0347342_228_872 214
585 3300046663 Ga0495635_0003679 Ga0495635_0003679_6023_6670 214
586 3300046663 Ga0495635_0030869 Ga0495635_0030869_2108_2758 214
587 3300046664 Ga0495659_0000386 Ga0495659_0000386_6003_6650 214
588 3300046664 Ga0495659_0001212 Ga0495659_0001212_968_1612 214
589 3300046665 Ga0495661_0052039 Ga0495661_0052039_1021_1668 214
590 3300046665 Ga0495661_0067428 Ga0495661_0067428_376_1020 214
591 3300046665 Ga0495661_0077321 Ga0495661_0077321_264_908 214
592 3300046665 Ga0495661_0100233 Ga0495661_0100233_933_1577 214
593 3300046674 Ga0495588_0012866 Ga0495588_0012866_2383_3027 214
594 3300046674 Ga0495588_0031918 Ga0495588_0031918_429_1073 214
595 3300046674 Ga0495588_0034510 Ga0495588_0034510_1285_1929 214
596 3300046674 Ga0495588_0103441 Ga0495588_0103441_277_924 214
597 3300046675 Ga0495657_0156489 Ga0495657_0156489_710_1354 214
598 3300046679 Ga0495623_0007277 Ga0495623_0007277_474_1118 214
599 3300046679 Ga0495623_0072459 Ga0495623_0072459_585_1235 214
600 3300046680 Ga0495646_0003931 Ga0495646_0003931_718_1365 214
601 3300046680 Ga0495646_0004999 Ga0495646_0004999_635_1285 214
602 3300046684 Ga0495669_0028399 Ga0495669_0028399_1462_2106 214
603 3300046689 Ga0495613_0039106 Ga0495613_0039106_485_1132 214
604 3300046689 Ga0495613_0040176 Ga0495613_0040176_2212_2856 214
605 3300046689 Ga0495613_0080638 Ga0495613_0080638_923_1573 214
606 3300046691 Ga0495670_0009391 Ga0495670_0009391_1145_1792 214
607 3300046691 Ga0495670_0039756 Ga0495670_0039756_159_806 214
608 3300046691 Ga0495670_0057740 Ga0495670_0057740_212_856 214
609 3300046691 Ga0495670_0097114 Ga0495670_0097114_651_1295 214
610 3300046691 Ga0495670_0127259 Ga0495670_0127259_447_1091 214
611 3300046691 Ga0495670_0144692 Ga0495670_0144692_377_1021 214
612 3300046691 Ga0495670_0257898 Ga0495670_0257898_116_763 214
613 3300046692 Ga0495671_0000561 Ga0495671_0000561_21563_22210 214
614 3300046692 Ga0495671_0006816 Ga0495671_0006816_895_1623 214
615 3300046692 Ga0495671_0019883 Ga0495671_0019883_597_1241 214
616 3300046692 Ga0495671_0026680 Ga0495671_0026680_1431_2075 214
617 3300046692 Ga0495671_0033873 Ga0495671_0033873_1673_2317 214
618 3300046692 Ga0495671_0041674 Ga0495671_0041674_1191_1835 214
619 3300046692 Ga0495671_0069766 Ga0495671_0069766_357_1001 214
620 3300046692 Ga0495671_0083986 Ga0495671_0083986_550_1194 214
621 3300046694 Ga0495649_0001584 Ga0495649_0001584_4986_5630 214
622 3300046694 Ga0495649_0006788 Ga0495649_0006788_5776_6423 214
623 3300046694 Ga0495649_0012199 Ga0495649_0012199_704_1348 214
624 3300046694 Ga0495649_0017812 Ga0495649_0017812_907_1551 214
625 3300046694 Ga0495649_0022466 Ga0495649_0022466_2456_3100 214
626 3300046694 Ga0495649_0025555 Ga0495649_0025555_662_1306 214
627 3300046694 Ga0495649_0231091 Ga0495649_0231091_63_710 214
628 3300046794 Ga0495589_0004328 Ga0495589_0004328_1756_2400 214
629 3300046794 Ga0495589_0006208 Ga0495589_0006208_1848_2492 214
630 3300046794 Ga0495589_0010114 Ga0495589_0010114_3320_3964 214
631 3300046794 Ga0495589_0011587 Ga0495589_0011587_225_872 214
632 3300046794 Ga0495589_0015823 Ga0495589_0015823_631_1275 214
633 3300046794 Ga0495589_0037861 Ga0495589_0037861_932_1618 214
634 3300046794 Ga0495589_0075844 Ga0495589_0075844_511_1155 214
635 3300046794 Ga0495589_0079938 Ga0495589_0079938_182_829 214
636 3300046809 Ga0495600_0062942 Ga0495600_0062942_1117_1761 214
637 3300046809 Ga0495600_0179256 Ga0495600_0179256_574_1221 214
638 3300046809 Ga0495600_0232990 Ga0495600_0232990_149_793 214
639 3300046810 Ga0495660_0007063 Ga0495660_0007063_3085_3741 214
640 3300046810 Ga0495660_0009761 Ga0495660_0009761_2456_3103 214
641 3300046810 Ga0495660_0015524 Ga0495660_0015524_604_1248 214
642 3300046810 Ga0495660_0025166 Ga0495660_0025166_1947_2591 214
643 3300046810 Ga0495660_0028829 Ga0495660_0028829_1581_2225 214
644 3300046810 Ga0495660_0032411 Ga0495660_0032411_297_941 214
645 3300046810 Ga0495660_0051962 Ga0495660_0051962_521_1165 214
646 3300046810 Ga0495660_0058447 Ga0495660_0058447_394_1041 214
647 3300046810 Ga0495660_0204703 Ga0495660_0204703_26_673 214
648 3300047315 Ga0495581_0014248 Ga0495581_0014248_3341_3988 214
649 3300047315 Ga0495581_0068339 Ga0495581_0068339_1080_1727 214
650 3300047317 Ga0495604_0003119 Ga0495604_0003119_968_1615 214
651 3300047317 Ga0495604_0038173 Ga0495604_0038173_2139_2789 214
652 3300047317 Ga0495604_0077937 Ga0495604_0077937_964_1608 214
653 3300047318 Ga0495636_0135422 Ga0495636_0135422_198_842 214
654 3300047319 Ga0495674_0055542 Ga0495674_0055542_901_1551 214
655 3300047320 Ga0495672_0007133 Ga0495672_0007133_2367_3011 214
656 3300047320 Ga0495672_0011535 Ga0495672_0011535_46_690 214
657 3300047320 Ga0495672_0014878 Ga0495672_0014878_3163_3807 214
658 3300047320 Ga0495672_0016236 Ga0495672_0016236_1695_2342 214
659 3300047320 Ga0495672_0022015 Ga0495672_0022015_992_1636 214
660 3300047320 Ga0495672_0022892 Ga0495672_0022892_3108_3752 214
661 3300047320 Ga0495672_0109129 Ga0495672_0109129_319_1002 214
662 3300047320 Ga0495672_0140310 Ga0495672_0140310_112_756 214
663 3300047322 Ga0495680_0002200 Ga0495680_0002200_6766_7413 214
664 3300047322 Ga0495680_0043379 Ga0495680_0043379_422_1066 214
665 3300047323 Ga0495683_0001158 Ga0495683_0001158_6966_7613 214
666 3300047323 Ga0495683_0009772 Ga0495683_0009772_3849_4493 214
667 3300047323 Ga0495683_0026419 Ga0495683_0026419_1629_2276 214
668 3300047323 Ga0495683_0063894 Ga0495683_0063894_973_1620 214
669 3300047323 Ga0495683_0176789 Ga0495683_0176789_36_680 214
670 3300047443 Ga0495687_015229 Ga0495687_015229_2236_2883 214
671 3300047443 Ga0495687_019767 Ga0495687_019767_641_1285 214
672 3300047444 Ga0495675_0013112 Ga0495675_0013112_574_1221 214
673 3300047445 Ga0495677_0004139 Ga0495677_0004139_3991_4635 214
674 3300047446 Ga0495679_008998 Ga0495679_008998_2783_3451 214
675 3300047446 Ga0495679_009522 Ga0495679_009522_2459_3118 214
676 3300047446 Ga0495679_024510 Ga0495679_024510_401_1087 214
677 3300047447 Ga0495685_152470 Ga0495685_152470_10_654 214
678 3300047469 Ga0495673_0001264 Ga0495673_0001264_7105_7752 214
679 3300047469 Ga0495673_0004460 Ga0495673_0004460_2116_2799 214
680 3300047469 Ga0495673_0015317 Ga0495673_0015317_2550_3194 214
681 3300047469 Ga0495673_0016890 Ga0495673_0016890_2379_3023 214
682 3300047469 Ga0495673_0047401 Ga0495673_0047401_890_1537 214
683 3300047469 Ga0495673_0050608 Ga0495673_0050608_421_1065 214
684 3300047469 Ga0495673_0072953 Ga0495673_0072953_569_1213 214
685 3300047470 Ga0495681_0006216 Ga0495681_0006216_5533_6177 214
686 3300047470 Ga0495681_0006575 Ga0495681_0006575_1437_2081 214
687 3300047470 Ga0495681_0013443 Ga0495681_0013443_801_1481 214
688 3300047470 Ga0495681_0017662 Ga0495681_0017662_2065_2712 214
689 3300047470 Ga0495681_0035564 Ga0495681_0035564_904_1548 214
690 3300047471 Ga0495684_0010832 Ga0495684_0010832_514_1158 214
691 3300047673 Ga0495593_0067024 Ga0495593_0067024_166_813 214
692 3300047673 Ga0495593_0077839 Ga0495593_0077839_753_1397 214
693 3300048088 Ga0495602_0180425 Ga0495602_0180425_613_1263 214
694 3300048091 Ga0495626_0000507 Ga0495626_0000507_33111_33755 214
695 3300048091 Ga0495626_0001521 Ga0495626_0001521_10319_10966 214
696 3300048091 Ga0495626_0003386 Ga0495626_0003386_5550_6194 214
697 3300048091 Ga0495626_0007343 Ga0495626_0007343_4834_5493 214
698 3300048091 Ga0495626_0077169 Ga0495626_0077169_365_1012 214
699 3300048905 Ga0496102_0051073 Ga0496102_0051073_2139_2789 214
700 3300048905 Ga0496102_0204801 Ga0496102_0204801_1181_1828 214
701 3300048906 Ga0496103_0052190 Ga0496103_0052190_993_1643 214
702 3300048907 Ga0496104_0525750 Ga0496104_0525750_139_783 214
703 3300048909 Ga0496106_0108036 Ga0496106_0108036_155_802 214
704 3300048913 Ga0496110_0071795 Ga0496110_0071795_1844_2488 214
705 3300048914 Ga0496111_0053067 Ga0496111_0053067_1395_2039 214
706 3300048919 Ga0496116_0000242 Ga0496116_0000242_66845_67504 214
707 3300048919 Ga0496116_0001730 Ga0496116_0001730_17904_18551 214
708 3300048919 Ga0496116_0032061 Ga0496116_0032061_2116_2766 214
709 3300048919 Ga0496116_0054146 Ga0496116_0054146_963_1607 214
710 3300048919 Ga0496116_0075783 Ga0496116_0075783_571_1215 214
711 3300048920 Ga0496117_0000270 Ga0496117_0000270_66834_67493 214
712 3300048920 Ga0496117_0005168 Ga0496117_0005168_10943_11629 214
713 3300048920 Ga0496117_0019125 Ga0496117_0019125_4477_5121 214
714 3300048920 Ga0496117_0027449 Ga0496117_0027449_3611_4258 214
715 3300048920 Ga0496117_0042517 Ga0496117_0042517_307_951 214
716 3300048920 Ga0496117_0062240 Ga0496117_0062240_1003_1653 214
717 3300048920 Ga0496117_0065661 Ga0496117_0065661_871_1515 214
718 3300048920 Ga0496117_0090948 Ga0496117_0090948_360_1004 214
719 3300048920 Ga0496117_0092015 Ga0496117_0092015_1069_1716 214
720 3300048921 Ga0496118_0010776 Ga0496118_0010776_2563_3222 214
721 3300048921 Ga0496118_0020473 Ga0496118_0020473_796_1440 214
722 3300048921 Ga0496118_0043972 Ga0496118_0043972_937_1581 214
723 3300048921 Ga0496118_0057565 Ga0496118_0057565_1900_2586 214
724 3300048921 Ga0496118_0065260 Ga0496118_0065260_962_1606 214
725 3300048921 Ga0496118_0107031 Ga0496118_0107031_975_1625 214
726 3300048922 Ga0496119_0068428 Ga0496119_0068428_1085_1771 214
727 3300048922 Ga0496119_0265408 Ga0496119_0265408_184_834 214
728 3300048924 Ga0496121_0000318 Ga0496121_0000318_33338_33997 214
729 3300048924 Ga0496121_0021091 Ga0496121_0021091_5467_6114 214
730 3300048924 Ga0496121_0138041 Ga0496121_0138041_146_793 214
731 3300048924 Ga0496121_0385169 Ga0496121_0385169_145_795 214
732 3300048925 Ga0496122_0012848 Ga0496122_0012848_699_1346 214
733 3300048925 Ga0496122_0072859 Ga0496122_0072859_919_1578 214
734 3300048925 Ga0496122_0146590 Ga0496122_0146590_720_1364 214
735 3300048926 Ga0496123_0005798 Ga0496123_0005798_10386_11045 214
736 3300048926 Ga0496123_0067990 Ga0496123_0067990_820_1464 214
737 3300048926 Ga0496123_0076258 Ga0496123_0076258_987_1631 214
738 3300048926 Ga0496123_0085325 Ga0496123_0085325_421_1107 214
739 3300048927 Ga0496124_0006474 Ga0496124_0006474_10928_11614 214
740 3300048927 Ga0496124_0023735 Ga0496124_0023735_813_1457 214
741 3300048927 Ga0496124_0098994 Ga0496124_0098994_1324_1971 214
742 3300048927 Ga0496124_0103701 Ga0496124_0103701_1618_2262 214
743 3300048927 Ga0496124_0127466 Ga0496124_0127466_716_1363 214
744 3300048927 Ga0496124_0178152 Ga0496124_0178152_575_1219 214
745 3300048927 Ga0496124_0221284 Ga0496124_0221284_716_1363 214
746 3300048927 Ga0496124_0246119 Ga0496124_0246119_323_967 214
747 3300048928 Ga0496125_0005587 Ga0496125_0005587_10901_11587 214
748 3300048928 Ga0496125_0005756 Ga0496125_0005756_12012_12656 214
749 3300048928 Ga0496125_0012297 Ga0496125_0012297_5520_6167 214
750 3300048928 Ga0496125_0038345 Ga0496125_0038345_993_1640 214
751 3300048929 Ga0496126_0214692 Ga0496126_0214692_796_1446 214
752 3300049459 Ga0495678_005802 Ga0495678_005802_414_1061 214
753 3300049459 Ga0495678_011515 Ga0495678_011515_505_1149 214
754 3300049459 Ga0495678_012469 Ga0495678_012469_755_1399 214
755 3300049459 Ga0495678_012911 Ga0495678_012911_2552_3196 214
756 3300049459 Ga0495678_019721 Ga0495678_019721_737_1381 214
757 3300049459 Ga0495678_033248 Ga0495678_033248_1216_1860 214
758 3300049459 Ga0495678_050474 Ga0495678_050474_659_1327 214
759 3300049460 Ga0495682_0003503 Ga0495682_0003503_949_1593 214
760 3300049460 Ga0495682_0015073 Ga0495682_0015073_1279_1923 214
761 3300049460 Ga0495682_0023087 Ga0495682_0023087_976_1620 214
762 3300049460 Ga0495682_0037189 Ga0495682_0037189_383_1027 214
763 3300049460 Ga0495682_0038661 Ga0495682_0038661_945_1592 214
764 3300049460 Ga0495682_0064986 Ga0495682_0064986_168_815 214
765 3300049460 Ga0495682_0077669 Ga0495682_0077669_324_971 214
766 3300049758 Ga0501241_001531 Ga0501241_001531_3128_3772 214
767 3300050489 nmdc:mga03683_16851_c1 nmdc:mga03683_16851_c1_742_1386 214
768 3300050489 nmdc:mga03683_281514_c1 nmdc:mga03683_281514_c1_16_672 214
769 3300050489 nmdc:mga03683_91958_c1 nmdc:mga03683_91958_c1_202_846 214
770 3300050491 nmdc:mga00v17_41099_c1 nmdc:mga00v17_41099_c1_1485_2129 214
771 3300050491 nmdc:mga00v17_54485_c1 nmdc:mga00v17_54485_c1_1582_2226 214
772 3300050491 nmdc:mga00v17_70608_c1 nmdc:mga00v17_70608_c1_1398_2045 214
773 3300050514 nmdc:mga08x19_139661_c1 nmdc:mga08x19_139661_c1_214_858 214
774 3300053145 Ga0500586_024376 Ga0500586_024376_598_1242 214
775 iso_pu_bacteria 637000220 637317395 214
776 iso_pu_bacteria 8056172158 8056177051 214

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00782

DSPc

Dual specificity phosphatase, catalytic domain

95

223

0.87

PF00102

Y_phosphatase

Protein-tyrosine phosphatase

136

202

0.84

PF13350

Y_phosphatase3

Tyrosine phosphatase family

93

200

0.84

PF03162

Y_phosphatase2

Tyrosine phosphatase family

84

225

0.82

PF22784

PTP-SAK

Swiss Army Knife protein, DSP-PTPase phosphatase domain

101

221

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r0t-assembly1.cif.gz_B crystal structure of p. aeruginosa tpba (c132s) in complex with ptyr 0.952 32 192
4r0s-assembly2.cif.gz_B crystal structure of p. aeruginosa tpba 0.9508 32 191
4r0t-assembly1.cif.gz_B crystal structure of p. aeruginosa tpba (c132s) in complex with ptyr 0.9407 32 192
4r0s-assembly2.cif.gz_B crystal structure of p. aeruginosa tpba 0.9395 32 191
7moj-assembly2.cif.gz_B crystal structure of arabidopsis thaliana plant and fungi atypical dual specificity phosphatase 1(atpfa-dsp1 ) cys150ser in complex with a metaphosphate intermediate 0.8528 44 183
ID Description Score Start End Superfamily
4r0sA00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.9516 32 192 3.90.190.10
4r0sA00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.9404 32 192 3.90.190.10
af_Q4DWG7_10_189_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8473 44 182 3.90.190.10
af_Q9UUF3_81_240_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.833 44 179 3.90.190.10
af_A4HSF4_49_220_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8174 43 174 3.90.190.10
ID Description Score Start End GO Terms
AF-A0A1H6Y1P0-F1-model_v4 deleted 0.954 44 190
AF-A0A2W5EXN5-F1-model_v4 Protein-tyrosine-phosphatase 0.9522 28 202 GO:0016791
AF-A0A370L8K8-F1-model_v4 Protein-tyrosine-phosphatase 0.9498 35 189 GO:0004721
AF-A0A329J267-F1-model_v4 Protein tyrosine phosphatase 0.9489 32 207 GO:0016791
AF-A0A2D6QPC8-F1-model_v4 deleted 0.9488 28 214

Feature Viewer

pLDDT pTM Quality
78.29 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map