F480282
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 775 | 326 | 1550 | 121 |
Family's Representative Sequence
| Representative Sequence | 3300049579|Ga0501043_0007438|Ga0501043_0007438_1661_2056 |
| Length | 131 |
| Sequence | MTGLVVFTVIDIVLLVAGLAGYLFVVGSQLTAVAEVLEECNEIVGXXXEDAEPIIPGVVHINQTGGVVAAALPLLYGMAEGIVSGVTYQPRPADAERRPARPAGGTRRSRLGEGVGFDSSGRSLAGAVRRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 61 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 67 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 101 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 161 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 162 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 163 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 164 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 165 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 166 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 167 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 168 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 169 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 170 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 171 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 172 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 173 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 174 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 175 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 176 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 178 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 179 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 180 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 181 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 182 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 183 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 184 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 186 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 187 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 188 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 189 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 190 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 191 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 195 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 196 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 197 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 199 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 200 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 201 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 203 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 204 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 206 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 207 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 208 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 209 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 210 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 211 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 212 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 213 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 214 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 215 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 216 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 217 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 218 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 263 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 264 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 265 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 266 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 267 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 268 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 271 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 272 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 273 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 274 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 275 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 276 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 307 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 308 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 321 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 324 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 325 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 326 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.61 |
| Metatranscriptomes | 0 |
| Isolates | 0.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.77 |
| Nodule | 0.13 |
| Rhizoplane | 5.68 |
| Rhizosphere | 92.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501043_0007438 | 3300049579 | Bacteria | 8697 |
| 2 | JGI24735J21928_10039304 | 3300002067 | Bacteria | 1384 |
| 3 | Ga0070658_10009307 | 3300005327 | Bacteria | 7902 |
| 4 | Ga0070676_11247025 | 3300005328 | Bacteria | 566 |
| 5 | Ga0070683_100014802 | 3300005329 | Bacteria | 6836 |
| 6 | Ga0070683_100091945 | 3300005329 | Bacteria | 2850 |
| 7 | Ga0070683_100275767 | 3300005329 | Bacteria | 1600 |
| 8 | Ga0070683_100483579 | 3300005329 | Bacteria | 1182 |
| 9 | Ga0070683_100993434 | 3300005329 | Bacteria | 806 |
| 10 | Ga0070670_100810704 | 3300005331 | Bacteria | 846 |
| 11 | Ga0068869_100681328 | 3300005334 | Bacteria | 875 |
| 12 | Ga0068869_100794150 | 3300005334 | Bacteria | 813 |
| 13 | Ga0070666_10073214 | 3300005335 | Bacteria | 2334 |
| 14 | Ga0070680_100142919 | 3300005336 | Bacteria | 2007 |
| 15 | Ga0070682_100386862 | 3300005337 | Bacteria | 1054 |
| 16 | Ga0068868_100037463 | 3300005338 | Bacteria | 3760 |
| 17 | Ga0068868_100737619 | 3300005338 | Bacteria | 884 |
| 18 | Ga0070660_100581449 | 3300005339 | Bacteria | 935 |
| 19 | Ga0070689_101266698 | 3300005340 | Bacteria | 663 |
| 20 | Ga0070689_102174111 | 3300005340 | Bacteria | 508 |
| 21 | Ga0070691_10020692 | 3300005341 | Bacteria | 3041 |
| 22 | Ga0070687_100494770 | 3300005343 | Bacteria | 822 |
| 23 | Ga0070687_100827867 | 3300005343 | Bacteria | 658 |
| 24 | Ga0070661_100341641 | 3300005344 | Bacteria | 1173 |
| 25 | Ga0070661_100443321 | 3300005344 | Bacteria | 1032 |
| 26 | Ga0070661_101257032 | 3300005344 | Bacteria | 620 |
| 27 | Ga0070692_10036514 | 3300005345 | Bacteria | 2494 |
| 28 | Ga0070692_10257134 | 3300005345 | Bacteria | 1048 |
| 29 | Ga0070675_100008657 | 3300005354 | Bacteria | 7901 |
| 30 | Ga0070675_100906075 | 3300005354 | Bacteria | 808 |
| 31 | Ga0070673_101000944 | 3300005364 | Bacteria | 778 |
| 32 | Ga0070659_101189673 | 3300005366 | Bacteria | 674 |
| 33 | Ga0070659_101192662 | 3300005366 | Bacteria | 673 |
| 34 | Ga0070659_101599417 | 3300005366 | Bacteria | 582 |
| 35 | Ga0070667_101449738 | 3300005367 | Bacteria | 644 |
| 36 | Ga0070709_10366141 | 3300005434 | Bacteria | 1068 |
| 37 | Ga0070709_11724127 | 3300005434 | Bacteria | 512 |
| 38 | Ga0070714_100000110 | 3300005435 | Bacteria | 68074 |
| 39 | Ga0070714_100090850 | 3300005435 | Bacteria | 2675 |
| 40 | Ga0070713_100067709 | 3300005436 | Bacteria | 3007 |
| 41 | Ga0070713_100091792 | 3300005436 | Bacteria | 2613 |
| 42 | Ga0070710_10124881 | 3300005437 | Bacteria | 1562 |
| 43 | Ga0070711_100030211 | 3300005439 | Bacteria | 3584 |
| 44 | Ga0070711_100034804 | 3300005439 | Bacteria | 3362 |
| 45 | Ga0070711_100175320 | 3300005439 | Bacteria | 1637 |
| 46 | Ga0070711_100481160 | 3300005439 | Bacteria | 1020 |
| 47 | Ga0070705_100392450 | 3300005440 | Bacteria | 1025 |
| 48 | Ga0070700_100004764 | 3300005441 | Bacteria | 7118 |
| 49 | Ga0070700_100202505 | 3300005441 | Bacteria | 1395 |
| 50 | Ga0070708_100024151 | 3300005445 | Bacteria | 5178 |
| 51 | Ga0070708_100338293 | 3300005445 | Bacteria | 1418 |
| 52 | Ga0070663_100024520 | 3300005455 | Bacteria | 4063 |
| 53 | Ga0070678_100383889 | 3300005456 | Bacteria | 1216 |
| 54 | Ga0070678_100588560 | 3300005456 | Bacteria | 992 |
| 55 | Ga0070681_10108604 | 3300005458 | Bacteria | 2715 |
| 56 | Ga0070681_11808807 | 3300005458 | Bacteria | 538 |
| 57 | Ga0070685_10835841 | 3300005466 | Unclassified | 681 |
| 58 | Ga0070685_11579393 | 3300005466 | Bacteria | 507 |
| 59 | Ga0070706_100003429 | 3300005467 | Bacteria | 15622 |
| 60 | Ga0070706_100006536 | 3300005467 | Bacteria | 10998 |
| 61 | Ga0070706_100192863 | 3300005467 | Bacteria | 1903 |
| 62 | Ga0070706_100257261 | 3300005467 | Bacteria | 1630 |
| 63 | Ga0070706_100604279 | 3300005467 | Bacteria | 1019 |
| 64 | Ga0070707_100000766 | 3300005468 | Bacteria | 31770 |
| 65 | Ga0070707_100036970 | 3300005468 | Bacteria | 4659 |
| 66 | Ga0070707_100051727 | 3300005468 | Bacteria | 3937 |
| 67 | Ga0070707_100072042 | 3300005468 | Bacteria | 3330 |
| 68 | Ga0070698_100001129 | 3300005471 | Bacteria | 29516 |
| 69 | Ga0070698_100002451 | 3300005471 | Bacteria | 20468 |
| 70 | Ga0070698_100004829 | 3300005471 | Bacteria | 14790 |
| 71 | Ga0070698_100065579 | 3300005471 | Bacteria | 3655 |
| 72 | Ga0070698_100067490 | 3300005471 | Bacteria | 3596 |
| 73 | Ga0070698_100406604 | 3300005471 | Bacteria | 1295 |
| 74 | Ga0070699_100005079 | 3300005518 | Bacteria | 11588 |
| 75 | Ga0070699_100036278 | 3300005518 | Bacteria | 4265 |
| 76 | Ga0070699_100112281 | 3300005518 | Bacteria | 2394 |
| 77 | Ga0070679_100031267 | 3300005530 | Bacteria | 5258 |
| 78 | Ga0070684_100027599 | 3300005535 | Bacteria | 4794 |
| 79 | Ga0070684_100139487 | 3300005535 | Bacteria | 2192 |
| 80 | Ga0070684_101225881 | 3300005535 | Bacteria | 706 |
| 81 | Ga0070697_100008565 | 3300005536 | Bacteria | 7987 |
| 82 | Ga0070686_100036891 | 3300005544 | Bacteria | 3029 |
| 83 | Ga0070696_100569039 | 3300005546 | Bacteria | 910 |
| 84 | Ga0070665_100103489 | 3300005548 | Bacteria | 2850 |
| 85 | Ga0070665_100243395 | 3300005548 | Bacteria | 1799 |
| 86 | Ga0070664_100000166 | 3300005564 | Bacteria | 45730 |
| 87 | Ga0070664_100042397 | 3300005564 | Bacteria | 3842 |
| 88 | Ga0070664_100068650 | 3300005564 | Bacteria | 3031 |
| 89 | Ga0070664_100172724 | 3300005564 | Bacteria | 1918 |
| 90 | Ga0070664_100229483 | 3300005564 | Bacteria | 1664 |
| 91 | Ga0068857_100072034 | 3300005577 | Bacteria | 3080 |
| 92 | Ga0068857_100268973 | 3300005577 | Bacteria | 1566 |
| 93 | Ga0068857_101000456 | 3300005577 | Bacteria | 805 |
| 94 | Ga0068857_101043565 | 3300005577 | Bacteria | 788 |
| 95 | Ga0068854_100922717 | 3300005578 | Bacteria | 769 |
| 96 | Ga0068856_100069880 | 3300005614 | Bacteria | 3472 |
| 97 | Ga0068856_101235818 | 3300005614 | Bacteria | 763 |
| 98 | Ga0068852_100012594 | 3300005616 | Bacteria | 6428 |
| 99 | Ga0068859_100287726 | 3300005617 | Bacteria | 1736 |
| 100 | Ga0068864_100025703 | 3300005618 | Bacteria | 4962 |
| 101 | Ga0068864_100643285 | 3300005618 | Bacteria | 1032 |
| 102 | Ga0068861_100106579 | 3300005719 | Bacteria | 2239 |
| 103 | Ga0068851_10176216 | 3300005834 | Bacteria | 1182 |
| 104 | Ga0068870_10062603 | 3300005840 | Bacteria | 2005 |
| 105 | Ga0068870_10854396 | 3300005840 | Bacteria | 640 |
| 106 | Ga0068863_100455950 | 3300005841 | Bacteria | 1255 |
| 107 | Ga0068863_100464191 | 3300005841 | Bacteria | 1244 |
| 108 | Ga0068858_100293893 | 3300005842 | Bacteria | 1549 |
| 109 | Ga0068858_100299660 | 3300005842 | Bacteria | 1533 |
| 110 | Ga0068858_100333562 | 3300005842 | Bacteria | 1451 |
| 111 | Ga0068858_100391071 | 3300005842 | Bacteria | 1335 |
| 112 | Ga0068858_101272310 | 3300005842 | Bacteria | 724 |
| 113 | Ga0068860_100177081 | 3300005843 | Bacteria | 2061 |
| 114 | Ga0068860_100875835 | 3300005843 | Bacteria | 913 |
| 115 | Ga0068860_100919421 | 3300005843 | Bacteria | 891 |
| 116 | Ga0068860_100935482 | 3300005843 | Bacteria | 884 |
| 117 | Ga0068862_100030122 | 3300005844 | Bacteria | 4572 |
| 118 | Ga0081455_10003500 | 3300005937 | Bacteria | 18039 |
| 119 | Ga0081455_10085266 | 3300005937 | Bacteria | 2576 |
| 120 | Ga0081455_10983425 | 3300005937 | Bacteria | 522 |
| 121 | Ga0070717_10049746 | 3300006028 | Bacteria | 3442 |
| 122 | Ga0070717_10163804 | 3300006028 | Bacteria | 1931 |
| 123 | Ga0070717_10505534 | 3300006028 | Bacteria | 1092 |
| 124 | Ga0075365_10158840 | 3300006038 | Bacteria | 1574 |
| 125 | Ga0070715_10253504 | 3300006163 | Bacteria | 921 |
| 126 | Ga0070716_100008308 | 3300006173 | Bacteria | 5150 |
| 127 | Ga0070716_100070202 | 3300006173 | Bacteria | 2056 |
| 128 | Ga0070712_100047967 | 3300006175 | Bacteria | 2959 |
| 129 | Ga0070712_100061679 | 3300006175 | Bacteria | 2649 |
| 130 | Ga0097621_100086986 | 3300006237 | Bacteria | 2609 |
| 131 | Ga0097621_100694168 | 3300006237 | Bacteria | 937 |
| 132 | Ga0097621_101826529 | 3300006237 | Bacteria | 579 |
| 133 | Ga0068871_100018486 | 3300006358 | Bacteria | 5298 |
| 134 | Ga0075428_100003437 | 3300006844 | Bacteria | 17332 |
| 135 | Ga0075428_100065648 | 3300006844 | Bacteria | 3975 |
| 136 | Ga0075428_100127686 | 3300006844 | Bacteria | 2767 |
| 137 | Ga0075428_101959678 | 3300006844 | Bacteria | 608 |
| 138 | Ga0075430_100107988 | 3300006846 | Bacteria | 2321 |
| 139 | Ga0075430_100529349 | 3300006846 | Bacteria | 972 |
| 140 | Ga0075430_101192949 | 3300006846 | Bacteria | 627 |
| 141 | Ga0075431_100013680 | 3300006847 | Bacteria | 8202 |
| 142 | Ga0075431_100144479 | 3300006847 | Bacteria | 2451 |
| 143 | Ga0075431_100370144 | 3300006847 | Bacteria | 1438 |
| 144 | Ga0075431_100555045 | 3300006847 | Bacteria | 1136 |
| 145 | Ga0075431_100925572 | 3300006847 | Bacteria | 841 |
| 146 | Ga0075433_10581379 | 3300006852 | Bacteria | 984 |
| 147 | Ga0075434_102162102 | 3300006871 | Bacteria | 561 |
| 148 | Ga0075429_100009750 | 3300006880 | Bacteria | 8324 |
| 149 | Ga0075429_100100146 | 3300006880 | Bacteria | 2529 |
| 150 | Ga0075429_100134242 | 3300006880 | Bacteria | 2165 |
| 151 | Ga0068865_100178831 | 3300006881 | Bacteria | 1632 |
| 152 | Ga0097620_100287719 | 3300006931 | Bacteria | 1736 |
| 153 | Ga0075435_101344587 | 3300007076 | Bacteria | 626 |
| 154 | Ga0099794_10252151 | 3300007265 | Unclassified | 910 |
| 155 | Ga0111539_10019751 | 3300009094 | Bacteria | 8309 |
| 156 | Ga0111539_10052611 | 3300009094 | Bacteria | 4848 |
| 157 | Ga0111539_10359147 | 3300009094 | Bacteria | 1696 |
| 158 | Ga0111539_10818706 | 3300009094 | Bacteria | 1083 |
| 159 | Ga0105245_10084521 | 3300009098 | Bacteria | 2908 |
| 160 | Ga0105245_10112422 | 3300009098 | Bacteria | 2535 |
| 161 | Ga0105245_10355093 | 3300009098 | Bacteria | 1453 |
| 162 | Ga0105245_12641222 | 3300009098 | Bacteria | 555 |
| 163 | Ga0114129_10006612 | 3300009147 | Bacteria | 16458 |
| 164 | Ga0114129_10013739 | 3300009147 | Bacteria | 11543 |
| 165 | Ga0114129_11781097 | 3300009147 | Bacteria | 749 |
| 166 | Ga0105243_10031597 | 3300009148 | Bacteria | 4082 |
| 167 | Ga0105243_10206594 | 3300009148 | Bacteria | 1726 |
| 168 | Ga0105243_10307597 | 3300009148 | Bacteria | 1439 |
| 169 | Ga0105241_10798838 | 3300009174 | Bacteria | 869 |
| 170 | Ga0105242_10158990 | 3300009176 | Bacteria | 1976 |
| 171 | Ga0105248_10202597 | 3300009177 | Bacteria | 2236 |
| 172 | Ga0105248_10239740 | 3300009177 | Bacteria | 2041 |
| 173 | Ga0105237_10378666 | 3300009545 | Bacteria | 1420 |
| 174 | Ga0105237_12400057 | 3300009545 | Bacteria | 537 |
| 175 | Ga0105238_10196549 | 3300009551 | Bacteria | 1993 |
| 176 | Ga0105238_10389614 | 3300009551 | Bacteria | 1385 |
| 177 | Ga0105238_12628581 | 3300009551 | Bacteria | 540 |
| 178 | Ga0105238_13035538 | 3300009551 | Bacteria | 504 |
| 179 | Ga0105249_10075133 | 3300009553 | Bacteria | 3129 |
| 180 | Ga0105249_10771628 | 3300009553 | Bacteria | 1024 |
| 181 | Ga0105249_12452414 | 3300009553 | Bacteria | 594 |
| 182 | Ga0105249_12815911 | 3300009553 | Bacteria | 558 |
| 183 | Ga0105246_11457898 | 3300011119 | Bacteria | 641 |
| 184 | Ga0157371_11194871 | 3300013102 | Bacteria | 586 |
| 185 | Ga0157370_10107944 | 3300013104 | Bacteria | 2603 |
| 186 | Ga0157369_10649638 | 3300013105 | Bacteria | 1088 |
| 187 | Ga0157374_10085592 | 3300013296 | Bacteria | 2998 |
| 188 | Ga0157378_10910308 | 3300013297 | Unclassified | 911 |
| 189 | Ga0157378_11668860 | 3300013297 | Bacteria | 684 |
| 190 | Ga0157378_12682686 | 3300013297 | Bacteria | 551 |
| 191 | Ga0163162_10040806 | 3300013306 | Bacteria | 4642 |
| 192 | Ga0157372_11364203 | 3300013307 | Bacteria | 818 |
| 193 | Ga0157372_11753633 | 3300013307 | Bacteria | 714 |
| 194 | Ga0157375_10073178 | 3300013308 | Bacteria | 3446 |
| 195 | Ga0157375_10261957 | 3300013308 | Bacteria | 1890 |
| 196 | Ga0163163_10286508 | 3300014325 | Bacteria | 1699 |
| 197 | Ga0157380_10525804 | 3300014326 | Bacteria | 1155 |
| 198 | Ga0157377_10011793 | 3300014745 | Bacteria | 4373 |
| 199 | Ga0157379_10022427 | 3300014968 | Bacteria | 5593 |
| 200 | Ga0157379_10036334 | 3300014968 | Bacteria | 4393 |
| 201 | Ga0157379_10037351 | 3300014968 | Bacteria | 4330 |
| 202 | Ga0157379_10071578 | 3300014968 | Bacteria | 3101 |
| 203 | Ga0157379_10394966 | 3300014968 | Bacteria | 1270 |
| 204 | Ga0157376_10017499 | 3300014969 | Bacteria | 5469 |
| 205 | Ga0157376_10106730 | 3300014969 | Bacteria | 2457 |
| 206 | Ga0157376_11547082 | 3300014969 | Bacteria | 697 |
| 207 | Ga0213875_10001941 | 3300021388 | Bacteria | 12788 |
| 208 | Ga0207656_10596210 | 3300025321 | Bacteria | 564 |
| 209 | Ga0207692_10034193 | 3300025898 | Bacteria | 2459 |
| 210 | Ga0207642_10231091 | 3300025899 | Bacteria | 1039 |
| 211 | Ga0207710_10062430 | 3300025900 | Bacteria | 1693 |
| 212 | Ga0207688_10825523 | 3300025901 | Bacteria | 587 |
| 213 | Ga0207647_10021010 | 3300025904 | Bacteria | 4365 |
| 214 | Ga0207685_10702463 | 3300025905 | Bacteria | 551 |
| 215 | Ga0207699_10002526 | 3300025906 | Bacteria | 8638 |
| 216 | Ga0207643_10270451 | 3300025908 | Bacteria | 1051 |
| 217 | Ga0207684_10004919 | 3300025910 | Bacteria | 12463 |
| 218 | Ga0207684_10028911 | 3300025910 | Bacteria | 4721 |
| 219 | Ga0207684_10101689 | 3300025910 | Bacteria | 2457 |
| 220 | Ga0207684_10477557 | 3300025910 | Bacteria | 1069 |
| 221 | Ga0207654_10869605 | 3300025911 | Bacteria | 653 |
| 222 | Ga0207707_10339816 | 3300025912 | Bacteria | 1295 |
| 223 | Ga0207707_10980035 | 3300025912 | Bacteria | 695 |
| 224 | Ga0207671_10299703 | 3300025914 | Bacteria | 1270 |
| 225 | Ga0207693_10051886 | 3300025915 | Bacteria | 3217 |
| 226 | Ga0207693_10063660 | 3300025915 | Bacteria | 2889 |
| 227 | Ga0207663_10133431 | 3300025916 | Bacteria | 1719 |
| 228 | Ga0207663_10314713 | 3300025916 | Bacteria | 1174 |
| 229 | Ga0207663_10441308 | 3300025916 | Bacteria | 1002 |
| 230 | Ga0207660_10985806 | 3300025917 | Bacteria | 687 |
| 231 | Ga0207657_10021703 | 3300025919 | Bacteria | 6036 |
| 232 | Ga0207657_10075338 | 3300025919 | Bacteria | 2848 |
| 233 | Ga0207649_11050716 | 3300025920 | Bacteria | 642 |
| 234 | Ga0207649_11200506 | 3300025920 | Bacteria | 599 |
| 235 | Ga0207652_10030950 | 3300025921 | Bacteria | 4488 |
| 236 | Ga0207652_10188138 | 3300025921 | Bacteria | 1857 |
| 237 | Ga0207646_10000995 | 3300025922 | Bacteria | 36401 |
| 238 | Ga0207646_10019682 | 3300025922 | Bacteria | 6268 |
| 239 | Ga0207646_10142821 | 3300025922 | Bacteria | 2156 |
| 240 | Ga0207646_10460513 | 3300025922 | Bacteria | 1147 |
| 241 | Ga0207694_10227471 | 3300025924 | Bacteria | 1523 |
| 242 | Ga0207650_10865056 | 3300025925 | Bacteria | 767 |
| 243 | Ga0207650_11087800 | 3300025925 | Unclassified | 680 |
| 244 | Ga0207659_10011347 | 3300025926 | Bacteria | 5626 |
| 245 | Ga0207687_10112685 | 3300025927 | Bacteria | 2022 |
| 246 | Ga0207687_10115991 | 3300025927 | Bacteria | 1995 |
| 247 | Ga0207687_10297692 | 3300025927 | Bacteria | 1299 |
| 248 | Ga0207687_10368274 | 3300025927 | Bacteria | 1174 |
| 249 | Ga0207700_10010090 | 3300025928 | Bacteria | 5938 |
| 250 | Ga0207700_10347781 | 3300025928 | Bacteria | 1290 |
| 251 | Ga0207700_10630271 | 3300025928 | Bacteria | 955 |
| 252 | Ga0207664_10011017 | 3300025929 | Bacteria | 6405 |
| 253 | Ga0207664_10075157 | 3300025929 | Bacteria | 2731 |
| 254 | Ga0207664_10322041 | 3300025929 | Bacteria | 1364 |
| 255 | Ga0207664_10747591 | 3300025929 | Bacteria | 879 |
| 256 | Ga0207664_11337112 | 3300025929 | Bacteria | 636 |
| 257 | Ga0207690_10018993 | 3300025932 | Bacteria | 4221 |
| 258 | Ga0207686_10086166 | 3300025934 | Bacteria | 2062 |
| 259 | Ga0207709_10029045 | 3300025935 | Bacteria | 3203 |
| 260 | Ga0207709_10137963 | 3300025935 | Bacteria | 1672 |
| 261 | Ga0207670_10218588 | 3300025936 | Bacteria | 1457 |
| 262 | Ga0207670_10289686 | 3300025936 | Bacteria | 1279 |
| 263 | Ga0207670_10942684 | 3300025936 | Unclassified | 724 |
| 264 | Ga0207669_10108695 | 3300025937 | Unclassified | 1853 |
| 265 | Ga0207704_10250212 | 3300025938 | Bacteria | 1330 |
| 266 | Ga0207665_10007373 | 3300025939 | Bacteria | 7270 |
| 267 | Ga0207665_10029281 | 3300025939 | Bacteria | 3641 |
| 268 | Ga0207665_10104931 | 3300025939 | Bacteria | 1979 |
| 269 | Ga0207711_10172048 | 3300025941 | Bacteria | 1966 |
| 270 | Ga0207711_10515835 | 3300025941 | Bacteria | 1114 |
| 271 | Ga0207689_10137280 | 3300025942 | Bacteria | 2014 |
| 272 | Ga0207689_10728104 | 3300025942 | Bacteria | 837 |
| 273 | Ga0207661_10061019 | 3300025944 | Bacteria | 3045 |
| 274 | Ga0207661_10443019 | 3300025944 | Bacteria | 1182 |
| 275 | Ga0207661_10508563 | 3300025944 | Bacteria | 1101 |
| 276 | Ga0207661_10884220 | 3300025944 | Bacteria | 823 |
| 277 | Ga0207679_10023314 | 3300025945 | Bacteria | 4230 |
| 278 | Ga0207679_10110502 | 3300025945 | Bacteria | 2169 |
| 279 | Ga0207679_10218262 | 3300025945 | Bacteria | 1603 |
| 280 | Ga0207679_11813243 | 3300025945 | Bacteria | 557 |
| 281 | Ga0207667_10342099 | 3300025949 | Bacteria | 1527 |
| 282 | Ga0207651_10601608 | 3300025960 | Bacteria | 961 |
| 283 | Ga0207712_10255938 | 3300025961 | Bacteria | 1417 |
| 284 | Ga0207712_10587360 | 3300025961 | Bacteria | 962 |
| 285 | Ga0207712_10589838 | 3300025961 | Bacteria | 960 |
| 286 | Ga0207712_11065101 | 3300025961 | Bacteria | 719 |
| 287 | Ga0207668_10266462 | 3300025972 | Bacteria | 1399 |
| 288 | Ga0207658_11424606 | 3300025986 | Bacteria | 634 |
| 289 | Ga0207677_10020546 | 3300026023 | Bacteria | 4012 |
| 290 | Ga0207677_10285012 | 3300026023 | Bacteria | 1358 |
| 291 | Ga0207703_10071822 | 3300026035 | Bacteria | 2859 |
| 292 | Ga0207703_10140362 | 3300026035 | Bacteria | 2096 |
| 293 | Ga0207703_10282118 | 3300026035 | Bacteria | 1509 |
| 294 | Ga0207678_10160836 | 3300026067 | Bacteria | 1918 |
| 295 | Ga0207708_10004104 | 3300026075 | Bacteria | 10717 |
| 296 | Ga0207702_10025668 | 3300026078 | Bacteria | 4890 |
| 297 | Ga0207702_10530413 | 3300026078 | Bacteria | 1150 |
| 298 | Ga0207641_10367768 | 3300026088 | Bacteria | 1374 |
| 299 | Ga0207641_10505564 | 3300026088 | Bacteria | 1174 |
| 300 | Ga0207641_11423432 | 3300026088 | Bacteria | 694 |
| 301 | Ga0207648_10001856 | 3300026089 | Bacteria | 23079 |
| 302 | Ga0207676_10410027 | 3300026095 | Bacteria | 1268 |
| 303 | Ga0207676_11369081 | 3300026095 | Bacteria | 703 |
| 304 | Ga0207676_11449755 | 3300026095 | Bacteria | 683 |
| 305 | Ga0207674_10032798 | 3300026116 | Bacteria | 5444 |
| 306 | Ga0207674_10133704 | 3300026116 | Bacteria | 2443 |
| 307 | Ga0207674_10138625 | 3300026116 | Bacteria | 2393 |
| 308 | Ga0207674_10149750 | 3300026116 | Bacteria | 2291 |
| 309 | Ga0207674_10291627 | 3300026116 | Bacteria | 1580 |
| 310 | Ga0207674_10530511 | 3300026116 | Bacteria | 1137 |
| 311 | Ga0207674_10657979 | 3300026116 | Bacteria | 1012 |
| 312 | Ga0207675_100121270 | 3300026118 | Bacteria | 2474 |
| 313 | Ga0207683_10428443 | 3300026121 | Bacteria | 1219 |
| 314 | Ga0207683_10449530 | 3300026121 | Bacteria | 1188 |
| 315 | Ga0207683_10565064 | 3300026121 | Bacteria | 1052 |
| 316 | Ga0207698_10203269 | 3300026142 | Bacteria | 1776 |
| 317 | Ga0209179_1150694 | 3300027512 | Bacteria | 519 |
| 318 | Ga0207428_10056266 | 3300027907 | Bacteria | 3126 |
| 319 | Ga0268266_10292252 | 3300028379 | Bacteria | 1518 |
| 320 | Ga0268265_10026129 | 3300028380 | Bacteria | 4151 |
| 321 | Ga0268265_11472977 | 3300028380 | Bacteria | 684 |
| 322 | Ga0268265_12470364 | 3300028380 | Bacteria | 526 |
| 323 | Ga0268264_10097795 | 3300028381 | Bacteria | 2545 |
| 324 | Ga0268264_10484331 | 3300028381 | Bacteria | 1204 |
| 325 | Ga0268264_11033886 | 3300028381 | Bacteria | 829 |
| 326 | Ga0265334_10080323 | 3300028573 | Bacteria | 1202 |
| 327 | Ga0265338_10009869 | 3300028800 | Bacteria | 11303 |
| 328 | Ga0265325_10003767 | 3300031241 | Bacteria | 9786 |
| 329 | Ga0265340_10004794 | 3300031247 | Bacteria | 7526 |
| 330 | Ga0265339_10031623 | 3300031249 | Bacteria | 2989 |
| 331 | Ga0265316_10155172 | 3300031344 | Bacteria | 1713 |
| 332 | Ga0307408_100317986 | 3300031548 | Bacteria | 1310 |
| 333 | Ga0265313_10119396 | 3300031595 | Bacteria | 1151 |
| 334 | Ga0265314_10476859 | 3300031711 | Bacteria | 660 |
| 335 | Ga0265342_10014517 | 3300031712 | Bacteria | 5226 |
| 336 | Ga0316576_10005814 | 3300031727 | Bacteria | 7605 |
| 337 | Ga0316578_10007697 | 3300031728 | Bacteria | 5426 |
| 338 | Ga0307405_10001312 | 3300031731 | Bacteria | 10406 |
| 339 | Ga0307405_10674831 | 3300031731 | Bacteria | 853 |
| 340 | Ga0307413_10026393 | 3300031824 | Bacteria | 3200 |
| 341 | Ga0307413_10200594 | 3300031824 | Bacteria | 1441 |
| 342 | Ga0307406_10099781 | 3300031901 | Bacteria | 1975 |
| 343 | Ga0307406_10126513 | 3300031901 | Bacteria | 1786 |
| 344 | Ga0307406_10392061 | 3300031901 | Bacteria | 1098 |
| 345 | Ga0307407_10084035 | 3300031903 | Bacteria | 1933 |
| 346 | Ga0307412_10277166 | 3300031911 | Bacteria | 1315 |
| 347 | Ga0307412_10819550 | 3300031911 | Bacteria | 809 |
| 348 | Ga0307409_100071030 | 3300031995 | Bacteria | 2766 |
| 349 | Ga0307409_100508057 | 3300031995 | Bacteria | 1175 |
| 350 | Ga0307416_100026033 | 3300032002 | Bacteria | 4303 |
| 351 | Ga0307416_100283968 | 3300032002 | Bacteria | 1634 |
| 352 | Ga0307416_101003056 | 3300032002 | Bacteria | 938 |
| 353 | Ga0307416_101954456 | 3300032002 | Bacteria | 690 |
| 354 | Ga0307415_100000001 | 3300032126 | Bacteria | 182929 |
| 355 | Ga0307415_100569213 | 3300032126 | Bacteria | 1003 |
| 356 | Ga0373926_0344746 | 3300035083 | Bacteria | 584 |
| 357 | Ga0373934_0006410 | 3300035086 | Bacteria | 4367 |
| 358 | Ga0373934_0009134 | 3300035086 | Bacteria | 3709 |
| 359 | Ga0373934_0037175 | 3300035086 | Bacteria | 1917 |
| 360 | Ga0373940_0091408 | 3300035088 | Bacteria | 912 |
| 361 | Ga0373944_0270710 | 3300035089 | Bacteria | 631 |
| 362 | Ga0373923_0108623 | 3300035111 | Bacteria | 1230 |
| 363 | Ga0373923_0441887 | 3300035111 | Bacteria | 630 |
| 364 | Ga0373936_0052436 | 3300035113 | Bacteria | 1652 |
| 365 | Ga0373945_0376066 | 3300035116 | Bacteria | 619 |
| 366 | Ga0373953_0004579 | 3300035117 | Bacteria | 4414 |
| 367 | Ga0373953_0064645 | 3300035117 | Bacteria | 1501 |
| 368 | Ga0373953_0173139 | 3300035117 | Bacteria | 929 |
| 369 | Ga0373954_0002449 | 3300035118 | Bacteria | 7775 |
| 370 | Ga0373956_0073951 | 3300035119 | Bacteria | 1557 |
| 371 | Ga0373956_0078038 | 3300035119 | Bacteria | 1516 |
| 372 | Ga0373957_0029907 | 3300035120 | Bacteria | 1993 |
| 373 | Ga0373946_0281120 | 3300035171 | Bacteria | 819 |
| 374 | Ga0373955_0005265 | 3300035172 | Bacteria | 5805 |
| 375 | Ga0373955_0017990 | 3300035172 | Bacteria | 3506 |
| 376 | Ga0373955_0036904 | 3300035172 | Bacteria | 2596 |
| 377 | Ga0373955_0044515 | 3300035172 | Bacteria | 2391 |
| 378 | Ga0373942_0043362 | 3300035207 | Unclassified | 1236 |
| 379 | Ga0316574_0015928 | 3300035398 | Bacteria | 4370 |
| 380 | Ga0316574_0040847 | 3300035398 | Bacteria | 2857 |
| 381 | Ga0373924_0007104 | 3300035410 | Bacteria | 4034 |
| 382 | Ga0373924_0028649 | 3300035410 | Bacteria | 2220 |
| 383 | Ga0373924_0138689 | 3300035410 | Bacteria | 1060 |
| 384 | Ga0373924_0266978 | 3300035410 | Bacteria | 758 |
| 385 | Ga0373931_0316233 | 3300035691 | Bacteria | 968 |
| 386 | Ga0373935_0015396 | 3300035692 | Bacteria | 4623 |
| 387 | Ga0373935_0017200 | 3300035692 | Bacteria | 4382 |
| 388 | Ga0373935_0457460 | 3300035692 | Bacteria | 923 |
| 389 | Ga0373935_0899512 | 3300035692 | Bacteria | 656 |
| 390 | Ga0373935_0977340 | 3300035692 | Bacteria | 628 |
| 391 | Ga0373927_0242424 | 3300035695 | Bacteria | 1185 |
| 392 | Ga0373927_0549227 | 3300035695 | Bacteria | 763 |
| 393 | Ga0373933_0057557 | 3300035724 | Bacteria | 2336 |
| 394 | Ga0373933_0064284 | 3300035724 | Bacteria | 2219 |
| 395 | Ga0373933_0106699 | 3300035724 | Bacteria | 1743 |
| 396 | Ga0373933_1039650 | 3300035724 | Bacteria | 539 |
| 397 | Ga0373947_0379441 | 3300035725 | Bacteria | 951 |
| 398 | Ga0373947_0441100 | 3300035725 | Bacteria | 881 |
| 399 | Ga0373937_0008806 | 3300036401 | Bacteria | 8755 |
| 400 | Ga0373937_0167055 | 3300036401 | Bacteria | 2063 |
| 401 | Ga0373937_0227230 | 3300036401 | Bacteria | 1757 |
| 402 | Ga0373937_0603620 | 3300036401 | Unclassified | 1042 |
| 403 | Ga0316582_0029906 | 3300036647 | Bacteria | 3312 |
| 404 | Ga0316584_0007268 | 3300036712 | Bacteria | 7559 |
| 405 | Ga0316584_0039481 | 3300036712 | Bacteria | 3514 |
| 406 | Ga0373925_1481504 | 3300037068 | Bacteria | 555 |
| 407 | Ga0436364_0667270 | 3300037853 | Bacteria | 158868 |
| 408 | Ga0436360_1311167 | 3300039438 | Bacteria | 733 |
| 409 | Ga0439443_034419 | 3300042003 | Bacteria | 846 |
| 410 | Ga0439450_004020 | 3300042008 | Bacteria | 2481 |
| 411 | Ga0439463_021847 | 3300042016 | Bacteria | 1599 |
| 412 | Ga0439464_0064264 | 3300042439 | Bacteria | 1078 |
| 413 | Ga0439460_0027365 | 3300042461 | Bacteria | 1601 |
| 414 | Ga0466966_0672674 | 3300044684 | Bacteria | 624 |
| 415 | Ga0466963_0061514 | 3300044694 | Bacteria | 2510 |
| 416 | Ga0466964_0249032 | 3300044706 | Bacteria | 875 |
| 417 | Ga0466957_0390770 | 3300044842 | Bacteria | 950 |
| 418 | Ga0466959_0323077 | 3300045049 | Bacteria | 1055 |
| 419 | Ga0466967_0604786 | 3300045976 | Bacteria | 1082 |
| 420 | Ga0466967_0786212 | 3300045976 | Bacteria | 945 |
| 421 | Ga0495592_0031150 | 3300046454 | Bacteria | 4032 |
| 422 | Ga0495592_0084738 | 3300046454 | Bacteria | 2286 |
| 423 | Ga0495592_0119423 | 3300046454 | Bacteria | 1856 |
| 424 | Ga0495629_0046488 | 3300046459 | Bacteria | 3044 |
| 425 | Ga0495641_0018805 | 3300046461 | Bacteria | 3555 |
| 426 | Ga0495651_0007604 | 3300046462 | Bacteria | 8284 |
| 427 | Ga0495651_0008220 | 3300046462 | Bacteria | 7997 |
| 428 | Ga0495651_0011640 | 3300046462 | Bacteria | 6762 |
| 429 | Ga0495651_0347022 | 3300046462 | Bacteria | 982 |
| 430 | Ga0495653_0002670 | 3300046463 | Bacteria | 14201 |
| 431 | Ga0495653_0082390 | 3300046463 | Bacteria | 2374 |
| 432 | Ga0495653_0093785 | 3300046463 | Bacteria | 2188 |
| 433 | Ga0495653_0190555 | 3300046463 | Bacteria | 1399 |
| 434 | Ga0495653_0712042 | 3300046463 | Unclassified | 609 |
| 435 | Ga0495582_0117084 | 3300046473 | Bacteria | 1499 |
| 436 | Ga0495582_0240808 | 3300046473 | Bacteria | 1037 |
| 437 | Ga0495639_0006190 | 3300046475 | Bacteria | 5139 |
| 438 | Ga0495662_0004379 | 3300046476 | Bacteria | 7091 |
| 439 | Ga0495664_0055911 | 3300046477 | Bacteria | 2347 |
| 440 | Ga0495664_0155001 | 3300046477 | Bacteria | 1389 |
| 441 | Ga0495664_0641838 | 3300046477 | Bacteria | 629 |
| 442 | Ga0495594_0704297 | 3300046499 | Bacteria | 571 |
| 443 | Ga0495608_0010808 | 3300046511 | Bacteria | 6361 |
| 444 | Ga0495608_0013758 | 3300046511 | Bacteria | 5613 |
| 445 | Ga0495608_0188033 | 3300046511 | Bacteria | 1305 |
| 446 | Ga0495618_0015513 | 3300046514 | Bacteria | 4650 |
| 447 | Ga0495618_0066596 | 3300046514 | Bacteria | 2289 |
| 448 | Ga0495618_0361429 | 3300046514 | Bacteria | 893 |
| 449 | Ga0495618_0850781 | 3300046514 | Bacteria | 529 |
| 450 | Ga0495628_0037598 | 3300046516 | Bacteria | 3881 |
| 451 | Ga0495628_0127868 | 3300046516 | Bacteria | 1945 |
| 452 | Ga0495628_0184167 | 3300046516 | Bacteria | 1578 |
| 453 | Ga0495628_0830160 | 3300046516 | Bacteria | 645 |
| 454 | Ga0495630_0024664 | 3300046517 | Bacteria | 4444 |
| 455 | Ga0495630_0679136 | 3300046517 | Bacteria | 788 |
| 456 | Ga0495630_1273197 | 3300046517 | Bacteria | 555 |
| 457 | Ga0495652_0001597 | 3300046529 | Bacteria | 24759 |
| 458 | Ga0495652_0011086 | 3300046529 | Bacteria | 8166 |
| 459 | Ga0495652_0026351 | 3300046529 | Bacteria | 5137 |
| 460 | Ga0495652_0106896 | 3300046529 | Bacteria | 2258 |
| 461 | Ga0495665_0002420 | 3300046531 | Bacteria | 10086 |
| 462 | Ga0495665_0174196 | 3300046531 | Bacteria | 1119 |
| 463 | Ga0495665_0516916 | 3300046531 | Bacteria | 601 |
| 464 | Ga0495640_0026695 | 3300046533 | Bacteria | 4169 |
| 465 | Ga0495640_0087916 | 3300046533 | Bacteria | 2054 |
| 466 | Ga0495640_0505062 | 3300046533 | Bacteria | 735 |
| 467 | Ga0495586_0036186 | 3300046535 | Bacteria | 2649 |
| 468 | Ga0495586_0044392 | 3300046535 | Bacteria | 2395 |
| 469 | Ga0495587_0001478 | 3300046536 | Bacteria | 15648 |
| 470 | Ga0495587_0024267 | 3300046536 | Bacteria | 3718 |
| 471 | Ga0495587_0042692 | 3300046536 | Bacteria | 2703 |
| 472 | Ga0495645_0037901 | 3300046543 | Bacteria | 3514 |
| 473 | Ga0495645_0088129 | 3300046543 | Bacteria | 2220 |
| 474 | Ga0495645_0096948 | 3300046543 | Bacteria | 2101 |
| 475 | Ga0495645_0286603 | 3300046543 | Bacteria | 1081 |
| 476 | Ga0495645_0290671 | 3300046543 | Bacteria | 1071 |
| 477 | Ga0495667_0003193 | 3300046559 | Bacteria | 10989 |
| 478 | Ga0495667_0029221 | 3300046559 | Bacteria | 3709 |
| 479 | Ga0495667_0133108 | 3300046559 | Bacteria | 1603 |
| 480 | Ga0495634_0011313 | 3300046642 | Bacteria | 6497 |
| 481 | Ga0495634_0019584 | 3300046642 | Bacteria | 4807 |
| 482 | Ga0495634_0082072 | 3300046642 | Bacteria | 2107 |
| 483 | Ga0495635_0058246 | 3300046663 | Bacteria | 2657 |
| 484 | Ga0495635_0068466 | 3300046663 | Bacteria | 2434 |
| 485 | Ga0495635_0103715 | 3300046663 | Bacteria | 1943 |
| 486 | Ga0495657_0004513 | 3300046675 | Bacteria | 11134 |
| 487 | Ga0495657_0017741 | 3300046675 | Bacteria | 5163 |
| 488 | Ga0495657_0098661 | 3300046675 | Bacteria | 1864 |
| 489 | Ga0495657_0354745 | 3300046675 | Bacteria | 867 |
| 490 | Ga0495657_0412400 | 3300046675 | Bacteria | 794 |
| 491 | Ga0495599_0000701 | 3300046678 | Bacteria | 18936 |
| 492 | Ga0495599_0065683 | 3300046678 | Bacteria | 2266 |
| 493 | Ga0495599_0120932 | 3300046678 | Bacteria | 1628 |
| 494 | Ga0495599_0672235 | 3300046678 | Bacteria | 599 |
| 495 | Ga0495599_0693851 | 3300046678 | Bacteria | 587 |
| 496 | Ga0495623_0078505 | 3300046679 | Bacteria | 2046 |
| 497 | Ga0495623_0364149 | 3300046679 | Bacteria | 785 |
| 498 | Ga0495623_0442185 | 3300046679 | Bacteria | 693 |
| 499 | Ga0495623_0499200 | 3300046679 | Bacteria | 642 |
| 500 | Ga0495623_0635488 | 3300046679 | Bacteria | 551 |
| 501 | Ga0495646_0335838 | 3300046680 | Bacteria | 793 |
| 502 | Ga0495647_0118095 | 3300046681 | Bacteria | 1113 |
| 503 | Ga0495658_0007460 | 3300046683 | Bacteria | 5414 |
| 504 | Ga0495658_0271632 | 3300046683 | Bacteria | 1069 |
| 505 | Ga0495613_0011672 | 3300046689 | Bacteria | 6532 |
| 506 | Ga0495613_0023373 | 3300046689 | Bacteria | 4605 |
| 507 | Ga0495613_0233718 | 3300046689 | Bacteria | 1287 |
| 508 | Ga0495624_0168989 | 3300046690 | Bacteria | 1334 |
| 509 | Ga0495624_0416882 | 3300046690 | Bacteria | 805 |
| 510 | Ga0495600_0001504 | 3300046809 | Bacteria | 12934 |
| 511 | Ga0495600_0020015 | 3300046809 | Bacteria | 4278 |
| 512 | Ga0495600_0056899 | 3300046809 | Bacteria | 2555 |
| 513 | Ga0495600_0128348 | 3300046809 | Bacteria | 1648 |
| 514 | Ga0495581_0008196 | 3300047315 | Bacteria | 6054 |
| 515 | Ga0495581_0145682 | 3300047315 | Bacteria | 1382 |
| 516 | Ga0495581_0178481 | 3300047315 | Bacteria | 1242 |
| 517 | Ga0495604_0013160 | 3300047317 | Bacteria | 6587 |
| 518 | Ga0495604_0087128 | 3300047317 | Bacteria | 2326 |
| 519 | Ga0495604_0193793 | 3300047317 | Bacteria | 1414 |
| 520 | Ga0495604_0846960 | 3300047317 | Bacteria | 574 |
| 521 | Ga0495674_0048082 | 3300047319 | Bacteria | 3777 |
| 522 | Ga0495674_0151341 | 3300047319 | Bacteria | 1945 |
| 523 | Ga0495674_0557416 | 3300047319 | Bacteria | 911 |
| 524 | Ga0495674_0911983 | 3300047319 | Bacteria | 678 |
| 525 | Ga0495676_0570948 | 3300047321 | Bacteria | 738 |
| 526 | Ga0495680_0060851 | 3300047322 | Bacteria | 2908 |
| 527 | Ga0495680_0127503 | 3300047322 | Bacteria | 1872 |
| 528 | Ga0495675_0013829 | 3300047444 | Bacteria | 5100 |
| 529 | Ga0495675_0059489 | 3300047444 | Bacteria | 2422 |
| 530 | Ga0495684_0008566 | 3300047471 | Bacteria | 7920 |
| 531 | Ga0495684_0009552 | 3300047471 | Bacteria | 7477 |
| 532 | Ga0495684_0014726 | 3300047471 | Bacteria | 6020 |
| 533 | Ga0495684_0034751 | 3300047471 | Bacteria | 3867 |
| 534 | Ga0495593_0039791 | 3300047673 | Bacteria | 2533 |
| 535 | Ga0495602_0039633 | 3300048088 | Bacteria | 4335 |
| 536 | Ga0495602_0040118 | 3300048088 | Bacteria | 4299 |
| 537 | Ga0495602_0070165 | 3300048088 | Bacteria | 3000 |
| 538 | Ga0495614_0142197 | 3300048089 | Bacteria | 1067 |
| 539 | Ga0496100_0390871 | 3300048903 | Bacteria | 1058 |
| 540 | Ga0496100_0463748 | 3300048903 | Bacteria | 972 |
| 541 | Ga0496100_0882467 | 3300048903 | Bacteria | 702 |
| 542 | Ga0496101_0161320 | 3300048904 | Bacteria | 1719 |
| 543 | Ga0496101_0477997 | 3300048904 | Bacteria | 984 |
| 544 | Ga0496102_0215639 | 3300048905 | Unclassified | 1809 |
| 545 | Ga0496102_0222277 | 3300048905 | Bacteria | 1780 |
| 546 | Ga0496102_0889204 | 3300048905 | Bacteria | 812 |
| 547 | Ga0496102_1658081 | 3300048905 | Bacteria | 557 |
| 548 | Ga0496103_0062540 | 3300048906 | Bacteria | 2317 |
| 549 | Ga0496103_0432311 | 3300048906 | Bacteria | 845 |
| 550 | Ga0496104_0067971 | 3300048907 | Bacteria | 3385 |
| 551 | Ga0496104_0098266 | 3300048907 | Bacteria | 2802 |
| 552 | Ga0496104_0193851 | 3300048907 | Bacteria | 1944 |
| 553 | Ga0496104_0738834 | 3300048907 | Unclassified | 891 |
| 554 | Ga0496105_0000534 | 3300048908 | Bacteria | 25137 |
| 555 | Ga0496105_0941020 | 3300048908 | Unclassified | 649 |
| 556 | Ga0496105_1241834 | 3300048908 | Bacteria | 547 |
| 557 | Ga0496106_1090001 | 3300048909 | Bacteria | 626 |
| 558 | Ga0496106_1147839 | 3300048909 | Bacteria | 607 |
| 559 | Ga0496107_0041340 | 3300048910 | Bacteria | 3310 |
| 560 | Ga0496107_0073540 | 3300048910 | Bacteria | 2486 |
| 561 | Ga0496108_0014347 | 3300048911 | Bacteria | 6468 |
| 562 | Ga0496108_0460507 | 3300048911 | Bacteria | 1111 |
| 563 | Ga0496109_0048792 | 3300048912 | Bacteria | 3852 |
| 564 | Ga0496109_0107293 | 3300048912 | Bacteria | 2594 |
| 565 | Ga0496109_0391854 | 3300048912 | Bacteria | 1312 |
| 566 | Ga0496110_0024156 | 3300048913 | Bacteria | 5177 |
| 567 | Ga0496110_0037500 | 3300048913 | Bacteria | 4213 |
| 568 | Ga0496110_0343721 | 3300048913 | Bacteria | 1359 |
| 569 | Ga0496110_0815943 | 3300048913 | Unclassified | 837 |
| 570 | Ga0496110_0836167 | 3300048913 | Bacteria | 826 |
| 571 | Ga0496111_0106789 | 3300048914 | Unclassified | 2061 |
| 572 | Ga0496111_0106937 | 3300048914 | Bacteria | 2059 |
| 573 | Ga0496112_0051180 | 3300048915 | Bacteria | 4051 |
| 574 | Ga0496113_0097559 | 3300048916 | Bacteria | 2274 |
| 575 | Ga0496114_0046409 | 3300048917 | Bacteria | 3610 |
| 576 | Ga0496114_0063993 | 3300048917 | Bacteria | 3080 |
| 577 | Ga0496114_0105935 | 3300048917 | Bacteria | 2405 |
| 578 | Ga0496114_0647562 | 3300048917 | Bacteria | 929 |
| 579 | Ga0496115_0008187 | 3300048918 | Bacteria | 7724 |
| 580 | Ga0496115_0012002 | 3300048918 | Bacteria | 6511 |
| 581 | Ga0496115_0115630 | 3300048918 | Bacteria | 2206 |
| 582 | Ga0496115_0252741 | 3300048918 | Bacteria | 1451 |
| 583 | Ga0501031_0002488 | 3300049568 | Bacteria | 11757 |
| 584 | Ga0501031_0068472 | 3300049568 | Bacteria | 2312 |
| 585 | Ga0501031_0139730 | 3300049568 | Bacteria | 1583 |
| 586 | Ga0501032_0447240 | 3300049569 | Unclassified | 828 |
| 587 | Ga0501033_0000615 | 3300049570 | Bacteria | 32993 |
| 588 | Ga0501033_0067091 | 3300049570 | Bacteria | 2638 |
| 589 | Ga0501034_0873738 | 3300049571 | Bacteria | 788 |
| 590 | Ga0501036_0023095 | 3300049572 | Bacteria | 5235 |
| 591 | Ga0501036_0029827 | 3300049572 | Bacteria | 4609 |
| 592 | Ga0501036_0349287 | 3300049572 | Bacteria | 1235 |
| 593 | Ga0501036_0505484 | 3300049572 | Bacteria | 1005 |
| 594 | Ga0501037_0065371 | 3300049573 | Bacteria | 2650 |
| 595 | Ga0501037_0182053 | 3300049573 | Unclassified | 1491 |
| 596 | Ga0501038_0008162 | 3300049574 | Bacteria | 9635 |
| 597 | Ga0501038_0091739 | 3300049574 | Bacteria | 2544 |
| 598 | Ga0501038_0147415 | 3300049574 | Bacteria | 1920 |
| 599 | Ga0501038_0325229 | 3300049574 | Unclassified | 1202 |
| 600 | Ga0501039_0018814 | 3300049575 | Bacteria | 5301 |
| 601 | Ga0501039_0136357 | 3300049575 | Bacteria | 1927 |
| 602 | Ga0501039_0169868 | 3300049575 | Bacteria | 1714 |
| 603 | Ga0501039_0245917 | 3300049575 | Bacteria | 1407 |
| 604 | Ga0501040_0001015 | 3300049576 | Bacteria | 17801 |
| 605 | Ga0501040_0013967 | 3300049576 | Bacteria | 5287 |
| 606 | Ga0501040_0018416 | 3300049576 | Bacteria | 4636 |
| 607 | Ga0501040_0026733 | 3300049576 | Bacteria | 3882 |
| 608 | Ga0501040_0213999 | 3300049576 | Bacteria | 1371 |
| 609 | Ga0501040_0243980 | 3300049576 | Unclassified | 1281 |
| 610 | Ga0501040_0269631 | 3300049576 | Unclassified | 1215 |
| 611 | Ga0501040_0596847 | 3300049576 | Bacteria | 798 |
| 612 | Ga0501040_0608587 | 3300049576 | Bacteria | 789 |
| 613 | Ga0501041_0121952 | 3300049577 | Bacteria | 1620 |
| 614 | Ga0501041_0176507 | 3300049577 | Bacteria | 1337 |
| 615 | Ga0501041_0375193 | 3300049577 | Bacteria | 900 |
| 616 | Ga0501041_0590459 | 3300049577 | Bacteria | 709 |
| 617 | Ga0501041_0738518 | 3300049577 | Unclassified | 630 |
| 618 | Ga0501042_0004580 | 3300049578 | Bacteria | 8825 |
| 619 | Ga0501042_0017296 | 3300049578 | Bacteria | 4970 |
| 620 | Ga0501042_0024258 | 3300049578 | Bacteria | 4253 |
| 621 | Ga0501042_0104336 | 3300049578 | Bacteria | 2040 |
| 622 | Ga0501042_0129546 | 3300049578 | Bacteria | 1818 |
| 623 | Ga0501042_0245149 | 3300049578 | Bacteria | 1293 |
| 624 | Ga0501043_0058230 | 3300049579 | Bacteria | 3033 |
| 625 | Ga0501043_0383930 | 3300049579 | Bacteria | 1063 |
| 626 | Ga0501046_0000193 | 3300049580 | Bacteria | 62517 |
| 627 | Ga0501046_0007814 | 3300049580 | Bacteria | 9385 |
| 628 | Ga0501046_0023505 | 3300049580 | Bacteria | 5070 |
| 629 | Ga0501046_0042506 | 3300049580 | Bacteria | 3624 |
| 630 | Ga0501046_0144035 | 3300049580 | Bacteria | 1801 |
| 631 | Ga0501046_0516267 | 3300049580 | Bacteria | 854 |
| 632 | Ga0501048_0027653 | 3300049582 | Bacteria | 4119 |
| 633 | Ga0501048_0034486 | 3300049582 | Bacteria | 3650 |
| 634 | Ga0501048_0069468 | 3300049582 | Bacteria | 2488 |
| 635 | Ga0501048_0626872 | 3300049582 | Unclassified | 772 |
| 636 | Ga0501048_0664445 | 3300049582 | Bacteria | 748 |
| 637 | Ga0501068_0017707 | 3300049584 | Bacteria | 4122 |
| 638 | Ga0501068_0218534 | 3300049584 | Bacteria | 1211 |
| 639 | Ga0501068_0415131 | 3300049584 | Bacteria | 869 |
| 640 | Ga0501069_0026250 | 3300049585 | Bacteria | 3190 |
| 641 | Ga0501069_0154829 | 3300049585 | Bacteria | 1318 |
| 642 | Ga0501069_0300816 | 3300049585 | Bacteria | 941 |
| 643 | Ga0501069_0580285 | 3300049585 | Bacteria | 672 |
| 644 | Ga0501070_0004104 | 3300049586 | Bacteria | 12522 |
| 645 | Ga0501070_0181747 | 3300049586 | Bacteria | 1731 |
| 646 | Ga0501070_0347462 | 3300049586 | Bacteria | 1204 |
| 647 | Ga0501070_1199462 | 3300049586 | Bacteria | 582 |
| 648 | Ga0501071_0002696 | 3300049587 | Bacteria | 10878 |
| 649 | Ga0501071_0005661 | 3300049587 | Bacteria | 8056 |
| 650 | Ga0501071_0082549 | 3300049587 | Bacteria | 2353 |
| 651 | Ga0501071_0286230 | 3300049587 | Unclassified | 1248 |
| 652 | Ga0501071_0427974 | 3300049587 | Bacteria | 1012 |
| 653 | Ga0501071_1028202 | 3300049587 | Bacteria | 636 |
| 654 | Ga0501072_0009637 | 3300049588 | Bacteria | 7347 |
| 655 | Ga0501072_0019122 | 3300049588 | Bacteria | 5291 |
| 656 | Ga0501072_0030474 | 3300049588 | Bacteria | 4219 |
| 657 | Ga0501072_0047695 | 3300049588 | Bacteria | 3373 |
| 658 | Ga0501072_0066080 | 3300049588 | Bacteria | 2853 |
| 659 | Ga0501072_0110634 | 3300049588 | Bacteria | 2186 |
| 660 | Ga0501072_0271433 | 3300049588 | Bacteria | 1349 |
| 661 | Ga0501072_0455513 | 3300049588 | Bacteria | 1013 |
| 662 | Ga0501072_0746368 | 3300049588 | Unclassified | 768 |
| 663 | Ga0501073_0109265 | 3300049589 | Unclassified | 1919 |
| 664 | Ga0501073_0399574 | 3300049589 | Bacteria | 949 |
| 665 | Ga0501074_0002465 | 3300049590 | Bacteria | 12903 |
| 666 | Ga0501074_0008809 | 3300049590 | Bacteria | 7314 |
| 667 | Ga0501074_0149438 | 3300049590 | Bacteria | 1670 |
| 668 | Ga0501074_0292704 | 3300049590 | Bacteria | 1157 |
| 669 | Ga0501074_0450796 | 3300049590 | Bacteria | 912 |
| 670 | Ga0501074_0931187 | 3300049590 | Unclassified | 611 |
| 671 | Ga0501075_0005255 | 3300049591 | Bacteria | 8853 |
| 672 | Ga0501075_0012059 | 3300049591 | Bacteria | 6136 |
| 673 | Ga0501075_0022826 | 3300049591 | Bacteria | 4575 |
| 674 | Ga0501075_0084789 | 3300049591 | Bacteria | 2400 |
| 675 | Ga0501075_0190350 | 3300049591 | Unclassified | 1565 |
| 676 | Ga0501075_0302545 | 3300049591 | Unclassified | 1218 |
| 677 | Ga0501075_0515026 | 3300049591 | Bacteria | 913 |
| 678 | Ga0501075_0583507 | 3300049591 | Bacteria | 853 |
| 679 | Ga0501075_0810218 | 3300049591 | Bacteria | 712 |
| 680 | Ga0501076_0000715 | 3300049592 | Bacteria | 21424 |
| 681 | Ga0501076_0002705 | 3300049592 | Bacteria | 12254 |
| 682 | Ga0501076_0049521 | 3300049592 | Bacteria | 3323 |
| 683 | Ga0501076_0058888 | 3300049592 | Bacteria | 3054 |
| 684 | Ga0501076_0105208 | 3300049592 | Bacteria | 2277 |
| 685 | Ga0501076_0186469 | 3300049592 | Unclassified | 1692 |
| 686 | Ga0501076_0362509 | 3300049592 | Bacteria | 1190 |
| 687 | Ga0501077_0040852 | 3300049593 | Bacteria | 2953 |
| 688 | Ga0501077_0054151 | 3300049593 | Bacteria | 2548 |
| 689 | Ga0501077_0172469 | 3300049593 | Bacteria | 1374 |
| 690 | Ga0501077_0203051 | 3300049593 | Bacteria | 1259 |
| 691 | Ga0501077_0215222 | 3300049593 | Bacteria | 1221 |
| 692 | Ga0501077_0714974 | 3300049593 | Bacteria | 644 |
| 693 | Ga0501079_0001024 | 3300049741 | Bacteria | 19374 |
| 694 | Ga0501079_0022336 | 3300049741 | Bacteria | 4851 |
| 695 | Ga0501079_0046199 | 3300049741 | Bacteria | 3360 |
| 696 | Ga0501079_0048328 | 3300049741 | Bacteria | 3283 |
| 697 | Ga0501079_0093293 | 3300049741 | Unclassified | 2332 |
| 698 | Ga0501079_0228907 | 3300049741 | Bacteria | 1452 |
| 699 | Ga0501080_0010722 | 3300049742 | Bacteria | 8385 |
| 700 | Ga0501080_0047937 | 3300049742 | Bacteria | 3978 |
| 701 | Ga0501080_0386490 | 3300049742 | Bacteria | 1260 |
| 702 | Ga0501080_0504051 | 3300049742 | Bacteria | 1081 |
| 703 | Ga0501081_0001508 | 3300049743 | Bacteria | 14295 |
| 704 | Ga0501081_0012492 | 3300049743 | Bacteria | 5584 |
| 705 | Ga0501081_0034577 | 3300049743 | Bacteria | 3439 |
| 706 | Ga0501081_0038123 | 3300049743 | Bacteria | 3282 |
| 707 | Ga0501081_0181899 | 3300049743 | Unclassified | 1521 |
| 708 | Ga0501083_0072150 | 3300049744 | Bacteria | 2295 |
| 709 | Ga0501083_0316817 | 3300049744 | Bacteria | 1014 |
| 710 | Ga0501035_0118321 | 3300049822 | Bacteria | 2318 |
| 711 | Ga0501035_0305678 | 3300049822 | Bacteria | 1339 |
| 712 | Ga0501035_0347441 | 3300049822 | Bacteria | 1242 |
| 713 | Ga0501035_0392955 | 3300049822 | Bacteria | 1155 |
| 714 | Ga0501035_0551818 | 3300049822 | Bacteria | 944 |
| 715 | Ga0501044_0325819 | 3300049823 | Bacteria | 1460 |
| 716 | Ga0501044_0385981 | 3300049823 | Bacteria | 1315 |
| 717 | Ga0501045_0019960 | 3300049824 | Bacteria | 4783 |
| 718 | Ga0501045_0169789 | 3300049824 | Bacteria | 1625 |
| 719 | Ga0501045_0200099 | 3300049824 | Bacteria | 1488 |
| 720 | Ga0501045_0331808 | 3300049824 | Unclassified | 1132 |
| 721 | Ga0501045_0405653 | 3300049824 | Bacteria | 1014 |
| 722 | nmdc:mga0yw44_1201514_c1 | 3300050492 | Bacteria | 511 |
| 723 | nmdc:mga0yw44_147335_c1 | 3300050492 | Bacteria | 1533 |
| 724 | nmdc:mga0yw44_207405_c1 | 3300050492 | Bacteria | 1296 |
| 725 | nmdc:mga07m45_45938_c1 | 3300050496 | Bacteria | 2452 |
| 726 | nmdc:mga05p37_16321_c1 | 3300050507 | Bacteria | 8941 |
| 727 | nmdc:mga09592_17477_c1 | 3300050508 | Bacteria | 5876 |
| 728 | nmdc:mga09592_436492_c1 | 3300050508 | Bacteria | 1130 |
| 729 | nmdc:mga09592_53990_c1 | 3300050508 | Bacteria | 3394 |
| 730 | nmdc:mga0qj67_1139644_c1 | 3300050509 | Unclassified | 608 |
| 731 | nmdc:mga0qj67_242481_c1 | 3300050509 | Bacteria | 1462 |
| 732 | nmdc:mga0qj67_56933_c1 | 3300050509 | Bacteria | 3100 |
| 733 | nmdc:mga0qj67_830440_c1 | 3300050509 | Unclassified | 730 |
| 734 | nmdc:mga0qj67_833935_c1 | 3300050509 | Bacteria | 729 |
| 735 | nmdc:mga06r32_380659_c1 | 3300050510 | Bacteria | 1394 |
| 736 | nmdc:mga06r32_56539_c1 | 3300050510 | Bacteria | 3767 |
| 737 | nmdc:mga08y16_113377_c1 | 3300050511 | Bacteria | 2822 |
| 738 | nmdc:mga08y16_377698_c1 | 3300050511 | Unclassified | 1453 |
| 739 | nmdc:mga08y16_481104_c1 | 3300050511 | Bacteria | 1263 |
| 740 | nmdc:mga0n895_1732626_c1 | 3300050512 | Bacteria | 587 |
| 741 | nmdc:mga0rr50_1201038_c1 | 3300050513 | Bacteria | 644 |
| 742 | nmdc:mga08x19_685145_c1 | 3300050514 | Bacteria | 727 |
| 743 | Ga0495601_0060592 | 3300053077 | Bacteria | 2401 |
| 744 | Ga0495601_0248787 | 3300053077 | Bacteria | 1161 |
| 745 | Ga0495612_0042562 | 3300053078 | Bacteria | 1854 |
| 746 | Ga0495595_0007279 | 3300053084 | Bacteria | 4527 |
| 747 | Ga0495595_0100828 | 3300053084 | Bacteria | 1393 |
| 748 | Ga0495595_0111266 | 3300053084 | Bacteria | 1328 |
| 749 | Ga0495595_0154590 | 3300053084 | Bacteria | 1130 |
| 750 | Ga0495619_0064104 | 3300053085 | Bacteria | 2449 |
| 751 | Ga0495619_0224620 | 3300053085 | Bacteria | 1301 |
| 752 | Ga0495619_0232613 | 3300053085 | Bacteria | 1277 |
| 753 | Ga0500573_0432900 | 3300053140 | Bacteria | 613 |
| 754 | Ga0501084_0037505 | 3300054114 | Bacteria | 4049 |
| 755 | Ga0501084_0062524 | 3300054114 | Bacteria | 3117 |
| 756 | Ga0501084_0093358 | 3300054114 | Bacteria | 2527 |
| 757 | Ga0501084_0096306 | 3300054114 | Bacteria | 2485 |
| 758 | Ga0501084_0167499 | 3300054114 | Bacteria | 1854 |
| 759 | Ga0501084_0328453 | 3300054114 | Unclassified | 1292 |
| 760 | Ga0501084_1374566 | 3300054114 | Bacteria | 591 |
| 761 | Ga0501082_0004681 | 3300060353 | Bacteria | 11931 |
| 762 | Ga0501082_0122470 | 3300060353 | Bacteria | 2255 |
| 763 | Ga0501082_0124758 | 3300060353 | Bacteria | 2233 |
| 764 | Ga0501082_0375052 | 3300060353 | Bacteria | 1241 |
| 765 | Ga0501082_1573023 | 3300060353 | Bacteria | 574 |
| 766 | Ga0530510_0010835 | 3300061734 | Bacteria | 6394 |
| 767 | Ga0530510_0014076 | 3300061734 | Bacteria | 5640 |
| 768 | Ga0530510_0038149 | 3300061734 | Bacteria | 3468 |
| 769 | Ga0530510_0093337 | 3300061734 | Bacteria | 2197 |
| 770 | Ga0530510_0105012 | 3300061734 | Bacteria | 2067 |
| 771 | Ga0530510_0117890 | 3300061734 | Bacteria | 1947 |
| 772 | Ga0530510_0294101 | 3300061734 | Bacteria | 1215 |
| 773 | 2644092079 | 2643221615 | Bacteria | 5487866 |
| 774 | 2644321882 | 2643221657 | Bacteria | 5490246 |
| 775 | 8002783783 | 8002775197 | Bacteria | 10728764 |
| 776 | Ga0501043_0007438 | |||
| 777 | JGI24735J21928_10039304 | |||
| 778 | Ga0070658_10009307 | |||
| 779 | Ga0070676_11247025 | |||
| 780 | Ga0070683_100014802 | |||
| 781 | Ga0070683_100091945 | |||
| 782 | Ga0070683_100275767 | |||
| 783 | Ga0070683_100483579 | |||
| 784 | Ga0070683_100993434 | |||
| 785 | Ga0070670_100810704 | |||
| 786 | Ga0068869_100681328 | |||
| 787 | Ga0068869_100794150 | |||
| 788 | Ga0070666_10073214 | |||
| 789 | Ga0070680_100142919 | |||
| 790 | Ga0070682_100386862 | |||
| 791 | Ga0068868_100037463 | |||
| 792 | Ga0068868_100737619 | |||
| 793 | Ga0070660_100581449 | |||
| 794 | Ga0070689_101266698 | |||
| 795 | Ga0070689_102174111 | |||
| 796 | Ga0070691_10020692 | |||
| 797 | Ga0070687_100494770 | |||
| 798 | Ga0070687_100827867 | |||
| 799 | Ga0070661_100341641 | |||
| 800 | Ga0070661_100443321 | |||
| 801 | Ga0070661_101257032 | |||
| 802 | Ga0070692_10036514 | |||
| 803 | Ga0070692_10257134 | |||
| 804 | Ga0070675_100008657 | |||
| 805 | Ga0070675_100906075 | |||
| 806 | Ga0070673_101000944 | |||
| 807 | Ga0070659_101189673 | |||
| 808 | Ga0070659_101192662 | |||
| 809 | Ga0070659_101599417 | |||
| 810 | Ga0070667_101449738 | |||
| 811 | Ga0070709_10366141 | |||
| 812 | Ga0070709_11724127 | |||
| 813 | Ga0070714_100000110 | |||
| 814 | Ga0070714_100090850 | |||
| 815 | Ga0070713_100067709 | |||
| 816 | Ga0070713_100091792 | |||
| 817 | Ga0070710_10124881 | |||
| 818 | Ga0070711_100030211 | |||
| 819 | Ga0070711_100034804 | |||
| 820 | Ga0070711_100175320 | |||
| 821 | Ga0070711_100481160 | |||
| 822 | Ga0070705_100392450 | |||
| 823 | Ga0070700_100004764 | |||
| 824 | Ga0070700_100202505 | |||
| 825 | Ga0070708_100024151 | |||
| 826 | Ga0070708_100338293 | |||
| 827 | Ga0070663_100024520 | |||
| 828 | Ga0070678_100383889 | |||
| 829 | Ga0070678_100588560 | |||
| 830 | Ga0070681_10108604 | |||
| 831 | Ga0070681_11808807 | |||
| 832 | Ga0070685_10835841 | |||
| 833 | Ga0070685_11579393 | |||
| 834 | Ga0070706_100003429 | |||
| 835 | Ga0070706_100006536 | |||
| 836 | Ga0070706_100192863 | |||
| 837 | Ga0070706_100257261 | |||
| 838 | Ga0070706_100604279 | |||
| 839 | Ga0070707_100000766 | |||
| 840 | Ga0070707_100036970 | |||
| 841 | Ga0070707_100051727 | |||
| 842 | Ga0070707_100072042 | |||
| 843 | Ga0070698_100001129 | |||
| 844 | Ga0070698_100002451 | |||
| 845 | Ga0070698_100004829 | |||
| 846 | Ga0070698_100065579 | |||
| 847 | Ga0070698_100067490 | |||
| 848 | Ga0070698_100406604 | |||
| 849 | Ga0070699_100005079 | |||
| 850 | Ga0070699_100036278 | |||
| 851 | Ga0070699_100112281 | |||
| 852 | Ga0070679_100031267 | |||
| 853 | Ga0070684_100027599 | |||
| 854 | Ga0070684_100139487 | |||
| 855 | Ga0070684_101225881 | |||
| 856 | Ga0070697_100008565 | |||
| 857 | Ga0070686_100036891 | |||
| 858 | Ga0070696_100569039 | |||
| 859 | Ga0070665_100103489 | |||
| 860 | Ga0070665_100243395 | |||
| 861 | Ga0070664_100000166 | |||
| 862 | Ga0070664_100042397 | |||
| 863 | Ga0070664_100068650 | |||
| 864 | Ga0070664_100172724 | |||
| 865 | Ga0070664_100229483 | |||
| 866 | Ga0068857_100072034 | |||
| 867 | Ga0068857_100268973 | |||
| 868 | Ga0068857_101000456 | |||
| 869 | Ga0068857_101043565 | |||
| 870 | Ga0068854_100922717 | |||
| 871 | Ga0068856_100069880 | |||
| 872 | Ga0068856_101235818 | |||
| 873 | Ga0068852_100012594 | |||
| 874 | Ga0068859_100287726 | |||
| 875 | Ga0068864_100025703 | |||
| 876 | Ga0068864_100643285 | |||
| 877 | Ga0068861_100106579 | |||
| 878 | Ga0068851_10176216 | |||
| 879 | Ga0068870_10062603 | |||
| 880 | Ga0068870_10854396 | |||
| 881 | Ga0068863_100455950 | |||
| 882 | Ga0068863_100464191 | |||
| 883 | Ga0068858_100293893 | |||
| 884 | Ga0068858_100299660 | |||
| 885 | Ga0068858_100333562 | |||
| 886 | Ga0068858_100391071 | |||
| 887 | Ga0068858_101272310 | |||
| 888 | Ga0068860_100177081 | |||
| 889 | Ga0068860_100875835 | |||
| 890 | Ga0068860_100919421 | |||
| 891 | Ga0068860_100935482 | |||
| 892 | Ga0068862_100030122 | |||
| 893 | Ga0081455_10003500 | |||
| 894 | Ga0081455_10085266 | |||
| 895 | Ga0081455_10983425 | |||
| 896 | Ga0070717_10049746 | |||
| 897 | Ga0070717_10163804 | |||
| 898 | Ga0070717_10505534 | |||
| 899 | Ga0075365_10158840 | |||
| 900 | Ga0070715_10253504 | |||
| 901 | Ga0070716_100008308 | |||
| 902 | Ga0070716_100070202 | |||
| 903 | Ga0070712_100047967 | |||
| 904 | Ga0070712_100061679 | |||
| 905 | Ga0097621_100086986 | |||
| 906 | Ga0097621_100694168 | |||
| 907 | Ga0097621_101826529 | |||
| 908 | Ga0068871_100018486 | |||
| 909 | Ga0075428_100003437 | |||
| 910 | Ga0075428_100065648 | |||
| 911 | Ga0075428_100127686 | |||
| 912 | Ga0075428_101959678 | |||
| 913 | Ga0075430_100107988 | |||
| 914 | Ga0075430_100529349 | |||
| 915 | Ga0075430_101192949 | |||
| 916 | Ga0075431_100013680 | |||
| 917 | Ga0075431_100144479 | |||
| 918 | Ga0075431_100370144 | |||
| 919 | Ga0075431_100555045 | |||
| 920 | Ga0075431_100925572 | |||
| 921 | Ga0075433_10581379 | |||
| 922 | Ga0075434_102162102 | |||
| 923 | Ga0075429_100009750 | |||
| 924 | Ga0075429_100100146 | |||
| 925 | Ga0075429_100134242 | |||
| 926 | Ga0068865_100178831 | |||
| 927 | Ga0097620_100287719 | |||
| 928 | Ga0075435_101344587 | |||
| 929 | Ga0099794_10252151 | |||
| 930 | Ga0111539_10019751 | |||
| 931 | Ga0111539_10052611 | |||
| 932 | Ga0111539_10359147 | |||
| 933 | Ga0111539_10818706 | |||
| 934 | Ga0105245_10084521 | |||
| 935 | Ga0105245_10112422 | |||
| 936 | Ga0105245_10355093 | |||
| 937 | Ga0105245_12641222 | |||
| 938 | Ga0114129_10006612 | |||
| 939 | Ga0114129_10013739 | |||
| 940 | Ga0114129_11781097 | |||
| 941 | Ga0105243_10031597 | |||
| 942 | Ga0105243_10206594 | |||
| 943 | Ga0105243_10307597 | |||
| 944 | Ga0105241_10798838 | |||
| 945 | Ga0105242_10158990 | |||
| 946 | Ga0105248_10202597 | |||
| 947 | Ga0105248_10239740 | |||
| 948 | Ga0105237_10378666 | |||
| 949 | Ga0105237_12400057 | |||
| 950 | Ga0105238_10196549 | |||
| 951 | Ga0105238_10389614 | |||
| 952 | Ga0105238_12628581 | |||
| 953 | Ga0105238_13035538 | |||
| 954 | Ga0105249_10075133 | |||
| 955 | Ga0105249_10771628 | |||
| 956 | Ga0105249_12452414 | |||
| 957 | Ga0105249_12815911 | |||
| 958 | Ga0105246_11457898 | |||
| 959 | Ga0157371_11194871 | |||
| 960 | Ga0157370_10107944 | |||
| 961 | Ga0157369_10649638 | |||
| 962 | Ga0157374_10085592 | |||
| 963 | Ga0157378_10910308 | |||
| 964 | Ga0157378_11668860 | |||
| 965 | Ga0157378_12682686 | |||
| 966 | Ga0163162_10040806 | |||
| 967 | Ga0157372_11364203 | |||
| 968 | Ga0157372_11753633 | |||
| 969 | Ga0157375_10073178 | |||
| 970 | Ga0157375_10261957 | |||
| 971 | Ga0163163_10286508 | |||
| 972 | Ga0157380_10525804 | |||
| 973 | Ga0157377_10011793 | |||
| 974 | Ga0157379_10022427 | |||
| 975 | Ga0157379_10036334 | |||
| 976 | Ga0157379_10037351 | |||
| 977 | Ga0157379_10071578 | |||
| 978 | Ga0157379_10394966 | |||
| 979 | Ga0157376_10017499 | |||
| 980 | Ga0157376_10106730 | |||
| 981 | Ga0157376_11547082 | |||
| 982 | Ga0213875_10001941 | |||
| 983 | Ga0207656_10596210 | |||
| 984 | Ga0207692_10034193 | |||
| 985 | Ga0207642_10231091 | |||
| 986 | Ga0207710_10062430 | |||
| 987 | Ga0207688_10825523 | |||
| 988 | Ga0207647_10021010 | |||
| 989 | Ga0207685_10702463 | |||
| 990 | Ga0207699_10002526 | |||
| 991 | Ga0207643_10270451 | |||
| 992 | Ga0207684_10004919 | |||
| 993 | Ga0207684_10028911 | |||
| 994 | Ga0207684_10101689 | |||
| 995 | Ga0207684_10477557 | |||
| 996 | Ga0207654_10869605 | |||
| 997 | Ga0207707_10339816 | |||
| 998 | Ga0207707_10980035 | |||
| 999 | Ga0207671_10299703 | |||
| 1000 | Ga0207693_10051886 | |||
| 1001 | Ga0207693_10063660 | |||
| 1002 | Ga0207663_10133431 | |||
| 1003 | Ga0207663_10314713 | |||
| 1004 | Ga0207663_10441308 | |||
| 1005 | Ga0207660_10985806 | |||
| 1006 | Ga0207657_10021703 | |||
| 1007 | Ga0207657_10075338 | |||
| 1008 | Ga0207649_11050716 | |||
| 1009 | Ga0207649_11200506 | |||
| 1010 | Ga0207652_10030950 | |||
| 1011 | Ga0207652_10188138 | |||
| 1012 | Ga0207646_10000995 | |||
| 1013 | Ga0207646_10019682 | |||
| 1014 | Ga0207646_10142821 | |||
| 1015 | Ga0207646_10460513 | |||
| 1016 | Ga0207694_10227471 | |||
| 1017 | Ga0207650_10865056 | |||
| 1018 | Ga0207650_11087800 | |||
| 1019 | Ga0207659_10011347 | |||
| 1020 | Ga0207687_10112685 | |||
| 1021 | Ga0207687_10115991 | |||
| 1022 | Ga0207687_10297692 | |||
| 1023 | Ga0207687_10368274 | |||
| 1024 | Ga0207700_10010090 | |||
| 1025 | Ga0207700_10347781 | |||
| 1026 | Ga0207700_10630271 | |||
| 1027 | Ga0207664_10011017 | |||
| 1028 | Ga0207664_10075157 | |||
| 1029 | Ga0207664_10322041 | |||
| 1030 | Ga0207664_10747591 | |||
| 1031 | Ga0207664_11337112 | |||
| 1032 | Ga0207690_10018993 | |||
| 1033 | Ga0207686_10086166 | |||
| 1034 | Ga0207709_10029045 | |||
| 1035 | Ga0207709_10137963 | |||
| 1036 | Ga0207670_10218588 | |||
| 1037 | Ga0207670_10289686 | |||
| 1038 | Ga0207670_10942684 | |||
| 1039 | Ga0207669_10108695 | |||
| 1040 | Ga0207704_10250212 | |||
| 1041 | Ga0207665_10007373 | |||
| 1042 | Ga0207665_10029281 | |||
| 1043 | Ga0207665_10104931 | |||
| 1044 | Ga0207711_10172048 | |||
| 1045 | Ga0207711_10515835 | |||
| 1046 | Ga0207689_10137280 | |||
| 1047 | Ga0207689_10728104 | |||
| 1048 | Ga0207661_10061019 | |||
| 1049 | Ga0207661_10443019 | |||
| 1050 | Ga0207661_10508563 | |||
| 1051 | Ga0207661_10884220 | |||
| 1052 | Ga0207679_10023314 | |||
| 1053 | Ga0207679_10110502 | |||
| 1054 | Ga0207679_10218262 | |||
| 1055 | Ga0207679_11813243 | |||
| 1056 | Ga0207667_10342099 | |||
| 1057 | Ga0207651_10601608 | |||
| 1058 | Ga0207712_10255938 | |||
| 1059 | Ga0207712_10587360 | |||
| 1060 | Ga0207712_10589838 | |||
| 1061 | Ga0207712_11065101 | |||
| 1062 | Ga0207668_10266462 | |||
| 1063 | Ga0207658_11424606 | |||
| 1064 | Ga0207677_10020546 | |||
| 1065 | Ga0207677_10285012 | |||
| 1066 | Ga0207703_10071822 | |||
| 1067 | Ga0207703_10140362 | |||
| 1068 | Ga0207703_10282118 | |||
| 1069 | Ga0207678_10160836 | |||
| 1070 | Ga0207708_10004104 | |||
| 1071 | Ga0207702_10025668 | |||
| 1072 | Ga0207702_10530413 | |||
| 1073 | Ga0207641_10367768 | |||
| 1074 | Ga0207641_10505564 | |||
| 1075 | Ga0207641_11423432 | |||
| 1076 | Ga0207648_10001856 | |||
| 1077 | Ga0207676_10410027 | |||
| 1078 | Ga0207676_11369081 | |||
| 1079 | Ga0207676_11449755 | |||
| 1080 | Ga0207674_10032798 | |||
| 1081 | Ga0207674_10133704 | |||
| 1082 | Ga0207674_10138625 | |||
| 1083 | Ga0207674_10149750 | |||
| 1084 | Ga0207674_10291627 | |||
| 1085 | Ga0207674_10530511 | |||
| 1086 | Ga0207674_10657979 | |||
| 1087 | Ga0207675_100121270 | |||
| 1088 | Ga0207683_10428443 | |||
| 1089 | Ga0207683_10449530 | |||
| 1090 | Ga0207683_10565064 | |||
| 1091 | Ga0207698_10203269 | |||
| 1092 | Ga0209179_1150694 | |||
| 1093 | Ga0207428_10056266 | |||
| 1094 | Ga0268266_10292252 | |||
| 1095 | Ga0268265_10026129 | |||
| 1096 | Ga0268265_11472977 | |||
| 1097 | Ga0268265_12470364 | |||
| 1098 | Ga0268264_10097795 | |||
| 1099 | Ga0268264_10484331 | |||
| 1100 | Ga0268264_11033886 | |||
| 1101 | Ga0265334_10080323 | |||
| 1102 | Ga0265338_10009869 | |||
| 1103 | Ga0265325_10003767 | |||
| 1104 | Ga0265340_10004794 | |||
| 1105 | Ga0265339_10031623 | |||
| 1106 | Ga0265316_10155172 | |||
| 1107 | Ga0307408_100317986 | |||
| 1108 | Ga0265313_10119396 | |||
| 1109 | Ga0265314_10476859 | |||
| 1110 | Ga0265342_10014517 | |||
| 1111 | Ga0316576_10005814 | |||
| 1112 | Ga0316578_10007697 | |||
| 1113 | Ga0307405_10001312 | |||
| 1114 | Ga0307405_10674831 | |||
| 1115 | Ga0307413_10026393 | |||
| 1116 | Ga0307413_10200594 | |||
| 1117 | Ga0307406_10099781 | |||
| 1118 | Ga0307406_10126513 | |||
| 1119 | Ga0307406_10392061 | |||
| 1120 | Ga0307407_10084035 | |||
| 1121 | Ga0307412_10277166 | |||
| 1122 | Ga0307412_10819550 | |||
| 1123 | Ga0307409_100071030 | |||
| 1124 | Ga0307409_100508057 | |||
| 1125 | Ga0307416_100026033 | |||
| 1126 | Ga0307416_100283968 | |||
| 1127 | Ga0307416_101003056 | |||
| 1128 | Ga0307416_101954456 | |||
| 1129 | Ga0307415_100000001 | |||
| 1130 | Ga0307415_100569213 | |||
| 1131 | Ga0373926_0344746 | |||
| 1132 | Ga0373934_0006410 | |||
| 1133 | Ga0373934_0009134 | |||
| 1134 | Ga0373934_0037175 | |||
| 1135 | Ga0373940_0091408 | |||
| 1136 | Ga0373944_0270710 | |||
| 1137 | Ga0373923_0108623 | |||
| 1138 | Ga0373923_0441887 | |||
| 1139 | Ga0373936_0052436 | |||
| 1140 | Ga0373945_0376066 | |||
| 1141 | Ga0373953_0004579 | |||
| 1142 | Ga0373953_0064645 | |||
| 1143 | Ga0373953_0173139 | |||
| 1144 | Ga0373954_0002449 | |||
| 1145 | Ga0373956_0073951 | |||
| 1146 | Ga0373956_0078038 | |||
| 1147 | Ga0373957_0029907 | |||
| 1148 | Ga0373946_0281120 | |||
| 1149 | Ga0373955_0005265 | |||
| 1150 | Ga0373955_0017990 | |||
| 1151 | Ga0373955_0036904 | |||
| 1152 | Ga0373955_0044515 | |||
| 1153 | Ga0373942_0043362 | |||
| 1154 | Ga0316574_0015928 | |||
| 1155 | Ga0316574_0040847 | |||
| 1156 | Ga0373924_0007104 | |||
| 1157 | Ga0373924_0028649 | |||
| 1158 | Ga0373924_0138689 | |||
| 1159 | Ga0373924_0266978 | |||
| 1160 | Ga0373931_0316233 | |||
| 1161 | Ga0373935_0015396 | |||
| 1162 | Ga0373935_0017200 | |||
| 1163 | Ga0373935_0457460 | |||
| 1164 | Ga0373935_0899512 | |||
| 1165 | Ga0373935_0977340 | |||
| 1166 | Ga0373927_0242424 | |||
| 1167 | Ga0373927_0549227 | |||
| 1168 | Ga0373933_0057557 | |||
| 1169 | Ga0373933_0064284 | |||
| 1170 | Ga0373933_0106699 | |||
| 1171 | Ga0373933_1039650 | |||
| 1172 | Ga0373947_0379441 | |||
| 1173 | Ga0373947_0441100 | |||
| 1174 | Ga0373937_0008806 | |||
| 1175 | Ga0373937_0167055 | |||
| 1176 | Ga0373937_0227230 | |||
| 1177 | Ga0373937_0603620 | |||
| 1178 | Ga0316582_0029906 | |||
| 1179 | Ga0316584_0007268 | |||
| 1180 | Ga0316584_0039481 | |||
| 1181 | Ga0373925_1481504 | |||
| 1182 | Ga0436364_0667270 | |||
| 1183 | Ga0436360_1311167 | |||
| 1184 | Ga0439443_034419 | |||
| 1185 | Ga0439450_004020 | |||
| 1186 | Ga0439463_021847 | |||
| 1187 | Ga0439464_0064264 | |||
| 1188 | Ga0439460_0027365 | |||
| 1189 | Ga0466966_0672674 | |||
| 1190 | Ga0466963_0061514 | |||
| 1191 | Ga0466964_0249032 | |||
| 1192 | Ga0466957_0390770 | |||
| 1193 | Ga0466959_0323077 | |||
| 1194 | Ga0466967_0604786 | |||
| 1195 | Ga0466967_0786212 | |||
| 1196 | Ga0495592_0031150 | |||
| 1197 | Ga0495592_0084738 | |||
| 1198 | Ga0495592_0119423 | |||
| 1199 | Ga0495629_0046488 | |||
| 1200 | Ga0495641_0018805 | |||
| 1201 | Ga0495651_0007604 | |||
| 1202 | Ga0495651_0008220 | |||
| 1203 | Ga0495651_0011640 | |||
| 1204 | Ga0495651_0347022 | |||
| 1205 | Ga0495653_0002670 | |||
| 1206 | Ga0495653_0082390 | |||
| 1207 | Ga0495653_0093785 | |||
| 1208 | Ga0495653_0190555 | |||
| 1209 | Ga0495653_0712042 | |||
| 1210 | Ga0495582_0117084 | |||
| 1211 | Ga0495582_0240808 | |||
| 1212 | Ga0495639_0006190 | |||
| 1213 | Ga0495662_0004379 | |||
| 1214 | Ga0495664_0055911 | |||
| 1215 | Ga0495664_0155001 | |||
| 1216 | Ga0495664_0641838 | |||
| 1217 | Ga0495594_0704297 | |||
| 1218 | Ga0495608_0010808 | |||
| 1219 | Ga0495608_0013758 | |||
| 1220 | Ga0495608_0188033 | |||
| 1221 | Ga0495618_0015513 | |||
| 1222 | Ga0495618_0066596 | |||
| 1223 | Ga0495618_0361429 | |||
| 1224 | Ga0495618_0850781 | |||
| 1225 | Ga0495628_0037598 | |||
| 1226 | Ga0495628_0127868 | |||
| 1227 | Ga0495628_0184167 | |||
| 1228 | Ga0495628_0830160 | |||
| 1229 | Ga0495630_0024664 | |||
| 1230 | Ga0495630_0679136 | |||
| 1231 | Ga0495630_1273197 | |||
| 1232 | Ga0495652_0001597 | |||
| 1233 | Ga0495652_0011086 | |||
| 1234 | Ga0495652_0026351 | |||
| 1235 | Ga0495652_0106896 | |||
| 1236 | Ga0495665_0002420 | |||
| 1237 | Ga0495665_0174196 | |||
| 1238 | Ga0495665_0516916 | |||
| 1239 | Ga0495640_0026695 | |||
| 1240 | Ga0495640_0087916 | |||
| 1241 | Ga0495640_0505062 | |||
| 1242 | Ga0495586_0036186 | |||
| 1243 | Ga0495586_0044392 | |||
| 1244 | Ga0495587_0001478 | |||
| 1245 | Ga0495587_0024267 | |||
| 1246 | Ga0495587_0042692 | |||
| 1247 | Ga0495645_0037901 | |||
| 1248 | Ga0495645_0088129 | |||
| 1249 | Ga0495645_0096948 | |||
| 1250 | Ga0495645_0286603 | |||
| 1251 | Ga0495645_0290671 | |||
| 1252 | Ga0495667_0003193 | |||
| 1253 | Ga0495667_0029221 | |||
| 1254 | Ga0495667_0133108 | |||
| 1255 | Ga0495634_0011313 | |||
| 1256 | Ga0495634_0019584 | |||
| 1257 | Ga0495634_0082072 | |||
| 1258 | Ga0495635_0058246 | |||
| 1259 | Ga0495635_0068466 | |||
| 1260 | Ga0495635_0103715 | |||
| 1261 | Ga0495657_0004513 | |||
| 1262 | Ga0495657_0017741 | |||
| 1263 | Ga0495657_0098661 | |||
| 1264 | Ga0495657_0354745 | |||
| 1265 | Ga0495657_0412400 | |||
| 1266 | Ga0495599_0000701 | |||
| 1267 | Ga0495599_0065683 | |||
| 1268 | Ga0495599_0120932 | |||
| 1269 | Ga0495599_0672235 | |||
| 1270 | Ga0495599_0693851 | |||
| 1271 | Ga0495623_0078505 | |||
| 1272 | Ga0495623_0364149 | |||
| 1273 | Ga0495623_0442185 | |||
| 1274 | Ga0495623_0499200 | |||
| 1275 | Ga0495623_0635488 | |||
| 1276 | Ga0495646_0335838 | |||
| 1277 | Ga0495647_0118095 | |||
| 1278 | Ga0495658_0007460 | |||
| 1279 | Ga0495658_0271632 | |||
| 1280 | Ga0495613_0011672 | |||
| 1281 | Ga0495613_0023373 | |||
| 1282 | Ga0495613_0233718 | |||
| 1283 | Ga0495624_0168989 | |||
| 1284 | Ga0495624_0416882 | |||
| 1285 | Ga0495600_0001504 | |||
| 1286 | Ga0495600_0020015 | |||
| 1287 | Ga0495600_0056899 | |||
| 1288 | Ga0495600_0128348 | |||
| 1289 | Ga0495581_0008196 | |||
| 1290 | Ga0495581_0145682 | |||
| 1291 | Ga0495581_0178481 | |||
| 1292 | Ga0495604_0013160 | |||
| 1293 | Ga0495604_0087128 | |||
| 1294 | Ga0495604_0193793 | |||
| 1295 | Ga0495604_0846960 | |||
| 1296 | Ga0495674_0048082 | |||
| 1297 | Ga0495674_0151341 | |||
| 1298 | Ga0495674_0557416 | |||
| 1299 | Ga0495674_0911983 | |||
| 1300 | Ga0495676_0570948 | |||
| 1301 | Ga0495680_0060851 | |||
| 1302 | Ga0495680_0127503 | |||
| 1303 | Ga0495675_0013829 | |||
| 1304 | Ga0495675_0059489 | |||
| 1305 | Ga0495684_0008566 | |||
| 1306 | Ga0495684_0009552 | |||
| 1307 | Ga0495684_0014726 | |||
| 1308 | Ga0495684_0034751 | |||
| 1309 | Ga0495593_0039791 | |||
| 1310 | Ga0495602_0039633 | |||
| 1311 | Ga0495602_0040118 | |||
| 1312 | Ga0495602_0070165 | |||
| 1313 | Ga0495614_0142197 | |||
| 1314 | Ga0496100_0390871 | |||
| 1315 | Ga0496100_0463748 | |||
| 1316 | Ga0496100_0882467 | |||
| 1317 | Ga0496101_0161320 | |||
| 1318 | Ga0496101_0477997 | |||
| 1319 | Ga0496102_0215639 | |||
| 1320 | Ga0496102_0222277 | |||
| 1321 | Ga0496102_0889204 | |||
| 1322 | Ga0496102_1658081 | |||
| 1323 | Ga0496103_0062540 | |||
| 1324 | Ga0496103_0432311 | |||
| 1325 | Ga0496104_0067971 | |||
| 1326 | Ga0496104_0098266 | |||
| 1327 | Ga0496104_0193851 | |||
| 1328 | Ga0496104_0738834 | |||
| 1329 | Ga0496105_0000534 | |||
| 1330 | Ga0496105_0941020 | |||
| 1331 | Ga0496105_1241834 | |||
| 1332 | Ga0496106_1090001 | |||
| 1333 | Ga0496106_1147839 | |||
| 1334 | Ga0496107_0041340 | |||
| 1335 | Ga0496107_0073540 | |||
| 1336 | Ga0496108_0014347 | |||
| 1337 | Ga0496108_0460507 | |||
| 1338 | Ga0496109_0048792 | |||
| 1339 | Ga0496109_0107293 | |||
| 1340 | Ga0496109_0391854 | |||
| 1341 | Ga0496110_0024156 | |||
| 1342 | Ga0496110_0037500 | |||
| 1343 | Ga0496110_0343721 | |||
| 1344 | Ga0496110_0815943 | |||
| 1345 | Ga0496110_0836167 | |||
| 1346 | Ga0496111_0106789 | |||
| 1347 | Ga0496111_0106937 | |||
| 1348 | Ga0496112_0051180 | |||
| 1349 | Ga0496113_0097559 | |||
| 1350 | Ga0496114_0046409 | |||
| 1351 | Ga0496114_0063993 | |||
| 1352 | Ga0496114_0105935 | |||
| 1353 | Ga0496114_0647562 | |||
| 1354 | Ga0496115_0008187 | |||
| 1355 | Ga0496115_0012002 | |||
| 1356 | Ga0496115_0115630 | |||
| 1357 | Ga0496115_0252741 | |||
| 1358 | Ga0501031_0002488 | |||
| 1359 | Ga0501031_0068472 | |||
| 1360 | Ga0501031_0139730 | |||
| 1361 | Ga0501032_0447240 | |||
| 1362 | Ga0501033_0000615 | |||
| 1363 | Ga0501033_0067091 | |||
| 1364 | Ga0501034_0873738 | |||
| 1365 | Ga0501036_0023095 | |||
| 1366 | Ga0501036_0029827 | |||
| 1367 | Ga0501036_0349287 | |||
| 1368 | Ga0501036_0505484 | |||
| 1369 | Ga0501037_0065371 | |||
| 1370 | Ga0501037_0182053 | |||
| 1371 | Ga0501038_0008162 | |||
| 1372 | Ga0501038_0091739 | |||
| 1373 | Ga0501038_0147415 | |||
| 1374 | Ga0501038_0325229 | |||
| 1375 | Ga0501039_0018814 | |||
| 1376 | Ga0501039_0136357 | |||
| 1377 | Ga0501039_0169868 | |||
| 1378 | Ga0501039_0245917 | |||
| 1379 | Ga0501040_0001015 | |||
| 1380 | Ga0501040_0013967 | |||
| 1381 | Ga0501040_0018416 | |||
| 1382 | Ga0501040_0026733 | |||
| 1383 | Ga0501040_0213999 | |||
| 1384 | Ga0501040_0243980 | |||
| 1385 | Ga0501040_0269631 | |||
| 1386 | Ga0501040_0596847 | |||
| 1387 | Ga0501040_0608587 | |||
| 1388 | Ga0501041_0121952 | |||
| 1389 | Ga0501041_0176507 | |||
| 1390 | Ga0501041_0375193 | |||
| 1391 | Ga0501041_0590459 | |||
| 1392 | Ga0501041_0738518 | |||
| 1393 | Ga0501042_0004580 | |||
| 1394 | Ga0501042_0017296 | |||
| 1395 | Ga0501042_0024258 | |||
| 1396 | Ga0501042_0104336 | |||
| 1397 | Ga0501042_0129546 | |||
| 1398 | Ga0501042_0245149 | |||
| 1399 | Ga0501043_0058230 | |||
| 1400 | Ga0501043_0383930 | |||
| 1401 | Ga0501046_0000193 | |||
| 1402 | Ga0501046_0007814 | |||
| 1403 | Ga0501046_0023505 | |||
| 1404 | Ga0501046_0042506 | |||
| 1405 | Ga0501046_0144035 | |||
| 1406 | Ga0501046_0516267 | |||
| 1407 | Ga0501048_0027653 | |||
| 1408 | Ga0501048_0034486 | |||
| 1409 | Ga0501048_0069468 | |||
| 1410 | Ga0501048_0626872 | |||
| 1411 | Ga0501048_0664445 | |||
| 1412 | Ga0501068_0017707 | |||
| 1413 | Ga0501068_0218534 | |||
| 1414 | Ga0501068_0415131 | |||
| 1415 | Ga0501069_0026250 | |||
| 1416 | Ga0501069_0154829 | |||
| 1417 | Ga0501069_0300816 | |||
| 1418 | Ga0501069_0580285 | |||
| 1419 | Ga0501070_0004104 | |||
| 1420 | Ga0501070_0181747 | |||
| 1421 | Ga0501070_0347462 | |||
| 1422 | Ga0501070_1199462 | |||
| 1423 | Ga0501071_0002696 | |||
| 1424 | Ga0501071_0005661 | |||
| 1425 | Ga0501071_0082549 | |||
| 1426 | Ga0501071_0286230 | |||
| 1427 | Ga0501071_0427974 | |||
| 1428 | Ga0501071_1028202 | |||
| 1429 | Ga0501072_0009637 | |||
| 1430 | Ga0501072_0019122 | |||
| 1431 | Ga0501072_0030474 | |||
| 1432 | Ga0501072_0047695 | |||
| 1433 | Ga0501072_0066080 | |||
| 1434 | Ga0501072_0110634 | |||
| 1435 | Ga0501072_0271433 | |||
| 1436 | Ga0501072_0455513 | |||
| 1437 | Ga0501072_0746368 | |||
| 1438 | Ga0501073_0109265 | |||
| 1439 | Ga0501073_0399574 | |||
| 1440 | Ga0501074_0002465 | |||
| 1441 | Ga0501074_0008809 | |||
| 1442 | Ga0501074_0149438 | |||
| 1443 | Ga0501074_0292704 | |||
| 1444 | Ga0501074_0450796 | |||
| 1445 | Ga0501074_0931187 | |||
| 1446 | Ga0501075_0005255 | |||
| 1447 | Ga0501075_0012059 | |||
| 1448 | Ga0501075_0022826 | |||
| 1449 | Ga0501075_0084789 | |||
| 1450 | Ga0501075_0190350 | |||
| 1451 | Ga0501075_0302545 | |||
| 1452 | Ga0501075_0515026 | |||
| 1453 | Ga0501075_0583507 | |||
| 1454 | Ga0501075_0810218 | |||
| 1455 | Ga0501076_0000715 | |||
| 1456 | Ga0501076_0002705 | |||
| 1457 | Ga0501076_0049521 | |||
| 1458 | Ga0501076_0058888 | |||
| 1459 | Ga0501076_0105208 | |||
| 1460 | Ga0501076_0186469 | |||
| 1461 | Ga0501076_0362509 | |||
| 1462 | Ga0501077_0040852 | |||
| 1463 | Ga0501077_0054151 | |||
| 1464 | Ga0501077_0172469 | |||
| 1465 | Ga0501077_0203051 | |||
| 1466 | Ga0501077_0215222 | |||
| 1467 | Ga0501077_0714974 | |||
| 1468 | Ga0501079_0001024 | |||
| 1469 | Ga0501079_0022336 | |||
| 1470 | Ga0501079_0046199 | |||
| 1471 | Ga0501079_0048328 | |||
| 1472 | Ga0501079_0093293 | |||
| 1473 | Ga0501079_0228907 | |||
| 1474 | Ga0501080_0010722 | |||
| 1475 | Ga0501080_0047937 | |||
| 1476 | Ga0501080_0386490 | |||
| 1477 | Ga0501080_0504051 | |||
| 1478 | Ga0501081_0001508 | |||
| 1479 | Ga0501081_0012492 | |||
| 1480 | Ga0501081_0034577 | |||
| 1481 | Ga0501081_0038123 | |||
| 1482 | Ga0501081_0181899 | |||
| 1483 | Ga0501083_0072150 | |||
| 1484 | Ga0501083_0316817 | |||
| 1485 | Ga0501035_0118321 | |||
| 1486 | Ga0501035_0305678 | |||
| 1487 | Ga0501035_0347441 | |||
| 1488 | Ga0501035_0392955 | |||
| 1489 | Ga0501035_0551818 | |||
| 1490 | Ga0501044_0325819 | |||
| 1491 | Ga0501044_0385981 | |||
| 1492 | Ga0501045_0019960 | |||
| 1493 | Ga0501045_0169789 | |||
| 1494 | Ga0501045_0200099 | |||
| 1495 | Ga0501045_0331808 | |||
| 1496 | Ga0501045_0405653 | |||
| 1497 | nmdc:mga0yw44_1201514_c1 | |||
| 1498 | nmdc:mga0yw44_147335_c1 | |||
| 1499 | nmdc:mga0yw44_207405_c1 | |||
| 1500 | nmdc:mga07m45_45938_c1 | |||
| 1501 | nmdc:mga05p37_16321_c1 | |||
| 1502 | nmdc:mga09592_17477_c1 | |||
| 1503 | nmdc:mga09592_436492_c1 | |||
| 1504 | nmdc:mga09592_53990_c1 | |||
| 1505 | nmdc:mga0qj67_1139644_c1 | |||
| 1506 | nmdc:mga0qj67_242481_c1 | |||
| 1507 | nmdc:mga0qj67_56933_c1 | |||
| 1508 | nmdc:mga0qj67_830440_c1 | |||
| 1509 | nmdc:mga0qj67_833935_c1 | |||
| 1510 | nmdc:mga06r32_380659_c1 | |||
| 1511 | nmdc:mga06r32_56539_c1 | |||
| 1512 | nmdc:mga08y16_113377_c1 | |||
| 1513 | nmdc:mga08y16_377698_c1 | |||
| 1514 | nmdc:mga08y16_481104_c1 | |||
| 1515 | nmdc:mga0n895_1732626_c1 | |||
| 1516 | nmdc:mga0rr50_1201038_c1 | |||
| 1517 | nmdc:mga08x19_685145_c1 | |||
| 1518 | Ga0495601_0060592 | |||
| 1519 | Ga0495601_0248787 | |||
| 1520 | Ga0495612_0042562 | |||
| 1521 | Ga0495595_0007279 | |||
| 1522 | Ga0495595_0100828 | |||
| 1523 | Ga0495595_0111266 | |||
| 1524 | Ga0495595_0154590 | |||
| 1525 | Ga0495619_0064104 | |||
| 1526 | Ga0495619_0224620 | |||
| 1527 | Ga0495619_0232613 | |||
| 1528 | Ga0500573_0432900 | |||
| 1529 | Ga0501084_0037505 | |||
| 1530 | Ga0501084_0062524 | |||
| 1531 | Ga0501084_0093358 | |||
| 1532 | Ga0501084_0096306 | |||
| 1533 | Ga0501084_0167499 | |||
| 1534 | Ga0501084_0328453 | |||
| 1535 | Ga0501084_1374566 | |||
| 1536 | Ga0501082_0004681 | |||
| 1537 | Ga0501082_0122470 | |||
| 1538 | Ga0501082_0124758 | |||
| 1539 | Ga0501082_0375052 | |||
| 1540 | Ga0501082_1573023 | |||
| 1541 | Ga0530510_0010835 | |||
| 1542 | Ga0530510_0014076 | |||
| 1543 | Ga0530510_0038149 | |||
| 1544 | Ga0530510_0093337 | |||
| 1545 | Ga0530510_0105012 | |||
| 1546 | Ga0530510_0117890 | |||
| 1547 | Ga0530510_0294101 | |||
| 1548 | 2644092079 | |||
| 1549 | 2644321882 | |||
| 1550 | 8002783783 |