F479250

General Info

Members Datasets Scaffolds Average Seq Length
754 250 1508 70

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10258282|Ga0075433_102582822
Length 84
Sequence MSTARRLLIGRLEDGMSLVRLLGFTTLACGCVVGRYREVATSREVAYVEEKGKTCGSHGHRRNHTVAADRLASLAPIALATKAS

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
167 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
180 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
181 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
182 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
183 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
184 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
185 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
186 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
193 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
194 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
195 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
196 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
197 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
198 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
199 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
200 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
201 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
208 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
209 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
210 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
211 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
212 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
228 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
231 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
232 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
233 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
234 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
237 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
238 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
246 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
247 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
248 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
249 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
250 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.06
Nodule 0
Rhizoplane 3.32
Rhizosphere 95.62
Stem 0
Stem Tuber 0
Unclassified 40.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10258282 3300006852 Unclassified 1545
2 Ga0058863_11813469 3300004799 Unclassified 648
3 Ga0065715_10157029 3300005293 Unclassified 1666
4 Ga0065715_10774674 3300005293 Bacteria 586
5 Ga0070676_10018518 3300005328 Bacteria 3861
6 Ga0070676_10142367 3300005328 Unclassified 1528
7 Ga0070676_10196739 3300005328 Bacteria 1319
8 Ga0070676_10630933 3300005328 Bacteria 776
9 Ga0070683_100075211 3300005329 Bacteria 3155
10 Ga0070683_100462310 3300005329 Bacteria 1211
11 Ga0070690_100198555 3300005330 Archaea 1395
12 Ga0070690_100299690 3300005330 Bacteria 1152
13 Ga0070670_100154015 3300005331 Bacteria 1990
14 Ga0070670_100433964 3300005331 Bacteria 1163
15 Ga0070670_100641948 3300005331 Bacteria 952
16 Ga0070670_100844826 3300005331 Bacteria 828
17 Ga0070670_101464998 3300005331 Unclassified 626
18 Ga0070677_10040882 3300005333 Unclassified 1827
19 Ga0068869_100279967 3300005334 Bacteria 1341
20 Ga0068869_100656656 3300005334 Unclassified 891
21 Ga0068869_101075083 3300005334 Bacteria 703
22 Ga0068869_101600209 3300005334 Unclassified 580
23 Ga0070666_10017637 3300005335 Bacteria 4580
24 Ga0070666_10073739 3300005335 Archaea 2325
25 Ga0070666_10234298 3300005335 Bacteria 1297
26 Ga0070666_10294534 3300005335 Unclassified 1155
27 Ga0070666_10338324 3300005335 Unclassified 1075
28 Ga0070680_100532686 3300005336 Bacteria 1006
29 Ga0070680_100682988 3300005336 Unclassified 883
30 Ga0068868_100033764 3300005338 Bacteria 3946
31 Ga0068868_100196760 3300005338 Bacteria 1678
32 Ga0068868_100202120 3300005338 Bacteria 1657
33 Ga0068868_100697477 3300005338 Unclassified 908
34 Ga0068868_101125665 3300005338 Unclassified 723
35 Ga0068868_101166401 3300005338 Unclassified 711
36 Ga0070660_101151436 3300005339 Bacteria 657
37 Ga0070689_100848415 3300005340 Unclassified 806
38 Ga0070689_101365573 3300005340 Bacteria 639
39 Ga0070691_10008506 3300005341 Bacteria 4698
40 Ga0070687_100030469 3300005343 Bacteria 2637
41 Ga0070687_100037689 3300005343 Bacteria 2418
42 Ga0070687_100618244 3300005343 Unclassified 747
43 Ga0070692_10107893 3300005345 Bacteria 1536
44 Ga0070692_10271419 3300005345 Unclassified 1024
45 Ga0070668_100056011 3300005347 Bacteria 3044
46 Ga0070668_100172624 3300005347 Bacteria 1761
47 Ga0070668_100867430 3300005347 Bacteria 805
48 Ga0070668_101641042 3300005347 Bacteria 589
49 Ga0070669_100009794 3300005353 Bacteria 6825
50 Ga0070669_100018849 3300005353 Bacteria 4933
51 Ga0070675_100036346 3300005354 Bacteria 4008
52 Ga0070675_100691806 3300005354 Bacteria 928
53 Ga0070675_100910185 3300005354 Unclassified 806
54 Ga0070675_101028186 3300005354 Bacteria 757
55 Ga0070675_101796473 3300005354 Bacteria 566
56 Ga0070675_101846147 3300005354 Unclassified 557
57 Ga0070671_100317751 3300005355 Bacteria 1327
58 Ga0070674_100031883 3300005356 Bacteria 3496
59 Ga0070674_100153348 3300005356 Bacteria 1741
60 Ga0070674_100267775 3300005356 Bacteria 1349
61 Ga0070674_100354504 3300005356 Unclassified 1186
62 Ga0070674_101256172 3300005356 Unclassified 659
63 Ga0070674_101884961 3300005356 Bacteria 543
64 Ga0070673_100035638 3300005364 Unclassified 3774
65 Ga0070673_100178713 3300005364 Archaea 1816
66 Ga0070673_100187345 3300005364 Bacteria 1775
67 Ga0070673_100302250 3300005364 Unclassified 1409
68 Ga0070673_102025753 3300005364 Unclassified 546
69 Ga0070673_102079754 3300005364 Unclassified 539
70 Ga0070688_100021725 3300005365 Unclassified 3752
71 Ga0070688_100269725 3300005365 Bacteria 1219
72 Ga0070688_100344434 3300005365 Unclassified 1089
73 Ga0070688_100390412 3300005365 Unclassified 1028
74 Ga0070688_101109596 3300005365 Unclassified 633
75 Ga0070659_100931820 3300005366 Unclassified 760
76 Ga0070667_100076529 3300005367 Bacteria 2857
77 Ga0070667_100558110 3300005367 Bacteria 1053
78 Ga0070667_100834128 3300005367 Bacteria 857
79 Ga0070709_10037346 3300005434 Unclassified 2966
80 Ga0070709_10707585 3300005434 Unclassified 784
81 Ga0070713_100575484 3300005436 Unclassified 1068
82 Ga0070710_10710985 3300005437 Bacteria 710
83 Ga0070701_10013105 3300005438 Bacteria 3761
84 Ga0070701_10712877 3300005438 Bacteria 676
85 Ga0070705_100013496 3300005440 Bacteria 4181
86 Ga0070705_100171119 3300005440 Unclassified 1462
87 Ga0070705_100357521 3300005440 Bacteria 1067
88 Ga0070705_100442569 3300005440 Unclassified 973
89 Ga0070705_101045240 3300005440 Unclassified 665
90 Ga0070700_100002015 3300005441 Bacteria 10319
91 Ga0070700_100060721 3300005441 Unclassified 2383
92 Ga0070700_100311733 3300005441 Unclassified 1152
93 Ga0070700_101229638 3300005441 Unclassified 627
94 Ga0070700_101391545 3300005441 Unclassified 593
95 Ga0070700_101677421 3300005441 Bacteria 545
96 Ga0070700_101683987 3300005441 Unclassified 544
97 Ga0070694_100013190 3300005444 Bacteria 5158
98 Ga0070694_100036351 3300005444 Bacteria 3262
99 Ga0070694_100217844 3300005444 Unclassified 1430
100 Ga0070694_100243956 3300005444 Bacteria 1356
101 Ga0070708_100130668 3300005445 Unclassified 2324
102 Ga0070708_100433324 3300005445 Archaea 1240
103 Ga0070678_100163905 3300005456 Bacteria 1804
104 Ga0070678_100691165 3300005456 Bacteria 918
105 Ga0070662_100023061 3300005457 Bacteria 4272
106 Ga0070662_101726082 3300005457 Unclassified 541
107 Ga0070681_10313758 3300005458 Unclassified 1477
108 Ga0070681_10934912 3300005458 Bacteria 786
109 Ga0070681_11248999 3300005458 Unclassified 665
110 Ga0068867_100042064 3300005459 Bacteria 3340
111 Ga0068867_100067274 3300005459 Bacteria 2671
112 Ga0068867_100374711 3300005459 Bacteria 1194
113 Ga0068867_100874107 3300005459 Bacteria 807
114 Ga0068867_101249274 3300005459 Unclassified 684
115 Ga0068867_101352919 3300005459 Unclassified 659
116 Ga0068867_101500751 3300005459 Unclassified 628
117 Ga0068867_102018799 3300005459 Unclassified 545
118 Ga0070706_100315968 3300005467 Bacteria 1457
119 Ga0070707_100030322 3300005468 Bacteria 5149
120 Ga0070707_100066712 3300005468 Bacteria 3459
121 Ga0070707_100098830 3300005468 Bacteria 2827
122 Ga0070707_102072510 3300005468 Unclassified 536
123 Ga0070698_100016948 3300005471 Bacteria 7681
124 Ga0070698_100049628 3300005471 Bacteria 4282
125 Ga0070698_100806031 3300005471 Unclassified 883
126 Ga0070698_100874517 3300005471 Unclassified 844
127 Ga0070698_101329909 3300005471 Bacteria 669
128 Ga0070698_101537897 3300005471 Bacteria 617
129 Ga0070699_100008361 3300005518 Bacteria 8967
130 Ga0070699_100172780 3300005518 Unclassified 1915
131 Ga0070699_100348420 3300005518 Bacteria 1334
132 Ga0070699_100434215 3300005518 Bacteria 1190
133 Ga0070679_100340439 3300005530 Bacteria 1448
134 Ga0070697_101062816 3300005536 Bacteria 720
135 Ga0070672_100718661 3300005543 Unclassified 875
136 Ga0070672_101269752 3300005543 Unclassified 657
137 Ga0070672_101337292 3300005543 Unclassified 640
138 Ga0070686_100001249 3300005544 Bacteria 14442
139 Ga0070686_100033710 3300005544 Bacteria 3148
140 Ga0070686_100998466 3300005544 Unclassified 686
141 Ga0070686_101001729 3300005544 Unclassified 685
142 Ga0070695_100002600 3300005545 Bacteria 10428
143 Ga0070695_100134574 3300005545 Bacteria 1707
144 Ga0070695_100320091 3300005545 Bacteria 1153
145 Ga0070695_100848681 3300005545 Unclassified 735
146 Ga0070696_100078171 3300005546 Bacteria 2339
147 Ga0070696_100097884 3300005546 Bacteria 2098
148 Ga0070696_100122013 3300005546 Bacteria 1887
149 Ga0070696_100276542 3300005546 Bacteria 1278
150 Ga0070696_100848695 3300005546 Bacteria 755
151 Ga0070693_100659404 3300005547 Unclassified 762
152 Ga0070693_100822362 3300005547 Bacteria 690
153 Ga0070665_100012476 3300005548 Bacteria 8564
154 Ga0070665_100021274 3300005548 Bacteria 6522
155 Ga0070665_101870752 3300005548 Unclassified 606
156 Ga0070665_101961851 3300005548 Bacteria 591
157 Ga0070704_100002400 3300005549 Bacteria 10513
158 Ga0070704_100062768 3300005549 Bacteria 2664
159 Ga0070704_100094096 3300005549 Bacteria 2241
160 Ga0070704_100233382 3300005549 Bacteria 1502
161 Ga0070704_100254430 3300005549 Bacteria 1444
162 Ga0070704_100550186 3300005549 Bacteria 1008
163 Ga0070704_100820735 3300005549 Unclassified 832
164 Ga0070704_101046721 3300005549 Unclassified 740
165 Ga0070704_101088599 3300005549 Unclassified 725
166 Ga0068855_100187811 3300005563 Unclassified 2333
167 Ga0068855_101113340 3300005563 Unclassified 825
168 Ga0070664_100898088 3300005564 Bacteria 831
169 Ga0068854_100103012 3300005578 Bacteria 2142
170 Ga0068854_100211467 3300005578 Bacteria 1530
171 Ga0068854_100479956 3300005578 Bacteria 1044
172 Ga0068854_101610953 3300005578 Bacteria 592
173 Ga0068856_100064040 3300005614 Unclassified 3632
174 Ga0070702_100028861 3300005615 Bacteria 3011
175 Ga0070702_100077806 3300005615 Bacteria 1978
176 Ga0068852_100925777 3300005616 Unclassified 889
177 Ga0068852_101439937 3300005616 Unclassified 711
178 Ga0068852_102042355 3300005616 Bacteria 595
179 Ga0068859_100247614 3300005617 Bacteria 1872
180 Ga0068859_100415204 3300005617 Bacteria 1442
181 Ga0068859_100673718 3300005617 Unclassified 1126
182 Ga0068859_101012069 3300005617 Bacteria 913
183 Ga0068859_101841759 3300005617 Unclassified 668
184 Ga0068859_102153859 3300005617 Unclassified 615
185 Ga0068864_101102058 3300005618 Unclassified 790
186 Ga0068866_10049041 3300005718 Bacteria 2137
187 Ga0068866_10271450 3300005718 Bacteria 1047
188 Ga0068866_10601922 3300005718 Bacteria 742
189 Ga0068866_10871787 3300005718 Unclassified 631
190 Ga0068861_100060729 3300005719 Bacteria 2898
191 Ga0068861_100387450 3300005719 Unclassified 1236
192 Ga0068861_100426644 3300005719 Unclassified 1183
193 Ga0068861_101068328 3300005719 Unclassified 774
194 Ga0068861_101973773 3300005719 Unclassified 582
195 Ga0068851_10084637 3300005834 Bacteria 1661
196 Ga0068851_10331641 3300005834 Unclassified 881
197 Ga0068870_10270965 3300005840 Unclassified 1060
198 Ga0068870_10356201 3300005840 Unclassified 940
199 Ga0068870_10937755 3300005840 Unclassified 614
200 Ga0068863_100021003 3300005841 Bacteria 6236
201 Ga0068863_100769449 3300005841 Bacteria 959
202 Ga0068863_100898347 3300005841 Bacteria 886
203 Ga0068863_102160688 3300005841 Bacteria 567
204 Ga0068858_100006439 3300005842 Bacteria 11435
205 Ga0068858_100120620 3300005842 Bacteria 2452
206 Ga0068858_100284339 3300005842 Unclassified 1575
207 Ga0068858_100290997 3300005842 Bacteria 1557
208 Ga0068858_101521670 3300005842 Unclassified 660
209 Ga0068860_100046483 3300005843 Unclassified 4139
210 Ga0068860_100232402 3300005843 Unclassified 1792
211 Ga0068860_100257039 3300005843 Bacteria 1702
212 Ga0068860_100296910 3300005843 Bacteria 1582
213 Ga0068860_100503768 3300005843 Bacteria 1209
214 Ga0068860_100646949 3300005843 Unclassified 1065
215 Ga0068860_100855507 3300005843 Unclassified 924
216 Ga0068860_101289810 3300005843 Bacteria 751
217 Ga0068860_101665708 3300005843 Unclassified 660
218 Ga0068860_102045075 3300005843 Bacteria 594
219 Ga0068862_100412830 3300005844 Bacteria 1265
220 Ga0068862_100500204 3300005844 Bacteria 1153
221 Ga0068862_101580418 3300005844 Unclassified 662
222 Ga0068862_102280675 3300005844 Unclassified 553
223 Ga0081455_10061550 3300005937 Unclassified 3158
224 Ga0081455_10076100 3300005937 Bacteria 2766
225 Ga0081538_10160505 3300005981 Bacteria 1000
226 Ga0081539_10031442 3300005985 Bacteria 3270
227 Ga0081539_10116092 3300005985 Bacteria 1338
228 Ga0075364_10032484 3300006051 Bacteria 3356
229 Ga0075432_10037609 3300006058 Bacteria 1685
230 Ga0075432_10068819 3300006058 Bacteria 1269
231 Ga0070715_10036139 3300006163 Archaea 2036
232 Ga0070715_10857340 3300006163 Unclassified 556
233 Ga0075367_10429610 3300006178 Bacteria 836
234 Ga0075369_10233187 3300006186 Unclassified 853
235 Ga0097621_100011538 3300006237 Bacteria 6511
236 Ga0097621_100013023 3300006237 Bacteria 6183
237 Ga0097621_100020364 3300006237 Bacteria 5110
238 Ga0097621_100060503 3300006237 Bacteria 3105
239 Ga0097621_100095975 3300006237 Bacteria 2488
240 Ga0097621_100302170 3300006237 Bacteria 1414
241 Ga0097621_100323170 3300006237 Bacteria 1367
242 Ga0097621_101088664 3300006237 Unclassified 750
243 Ga0075370_10353511 3300006353 Unclassified 878
244 Ga0068871_100003046 3300006358 Bacteria 11499
245 Ga0068871_100014180 3300006358 Archaea 5933
246 Ga0068871_100041977 3300006358 Bacteria 3670
247 Ga0068871_100254380 3300006358 Bacteria 1531
248 Ga0068871_100278667 3300006358 Bacteria 1462
249 Ga0068871_100320394 3300006358 Bacteria 1365
250 Ga0068871_100670375 3300006358 Bacteria 948
251 Ga0068871_101326107 3300006358 Unclassified 677
252 Ga0075428_100001914 3300006844 Bacteria 22338
253 Ga0075428_100156797 3300006844 Bacteria 2473
254 Ga0075428_100167422 3300006844 Bacteria 2384
255 Ga0075428_100180110 3300006844 Unclassified 2288
256 Ga0075428_100798189 3300006844 Unclassified 1003
257 Ga0075430_100214613 3300006846 Bacteria 1597
258 Ga0075431_100022643 3300006847 Bacteria 6423
259 Ga0075431_100063135 3300006847 Bacteria 3822
260 Ga0075431_100105871 3300006847 Unclassified 2902
261 Ga0075433_10056597 3300006852 Unclassified 3425
262 Ga0075433_10062979 3300006852 Bacteria 3249
263 Ga0075433_10367226 3300006852 Unclassified 1271
264 Ga0075433_10379434 3300006852 Bacteria 1248
265 Ga0075433_10450517 3300006852 Bacteria 1135
266 Ga0075433_10989221 3300006852 Unclassified 733
267 Ga0075433_11170490 3300006852 Bacteria 668
268 Ga0075433_11323903 3300006852 Bacteria 624
269 Ga0075434_100002495 3300006871 Bacteria 16216
270 Ga0075434_100003115 3300006871 Bacteria 14769
271 Ga0075434_100045768 3300006871 Bacteria 4341
272 Ga0075434_100053023 3300006871 Bacteria 4031
273 Ga0075434_100067806 3300006871 Bacteria 3554
274 Ga0075434_100115177 3300006871 Unclassified 2701
275 Ga0075434_100124929 3300006871 Bacteria 2590
276 Ga0075434_100234351 3300006871 Unclassified 1855
277 Ga0075434_100344126 3300006871 Unclassified 1512
278 Ga0075434_100423285 3300006871 Bacteria 1353
279 Ga0075434_100732034 3300006871 Bacteria 1006
280 Ga0075434_100748801 3300006871 Unclassified 994
281 Ga0075434_101110085 3300006871 Unclassified 804
282 Ga0075434_101173066 3300006871 Unclassified 780
283 Ga0075434_101685570 3300006871 Bacteria 642
284 Ga0075429_100124680 3300006880 Bacteria 2252
285 Ga0075429_101890064 3300006880 Unclassified 517
286 Ga0068865_100004678 3300006881 Bacteria 8267
287 Ga0068865_100210623 3300006881 Unclassified 1514
288 Ga0068865_100439126 3300006881 Unclassified 1077
289 Ga0068865_101461090 3300006881 Unclassified 612
290 Ga0075436_100007761 3300006914 Bacteria 7336
291 Ga0075436_100011754 3300006914 Bacteria 6009
292 Ga0075436_100013550 3300006914 Bacteria 5584
293 Ga0075436_100017206 3300006914 Bacteria 4947
294 Ga0075436_100024643 3300006914 Unclassified 4137
295 Ga0075436_100041363 3300006914 Bacteria 3180
296 Ga0075436_100056807 3300006914 Bacteria 2703
297 Ga0075436_100187361 3300006914 Bacteria 1463
298 Ga0097620_100247638 3300006931 Bacteria 1872
299 Ga0097620_100415251 3300006931 Bacteria 1442
300 Ga0097620_100673752 3300006931 Unclassified 1126
301 Ga0097620_101011923 3300006931 Bacteria 913
302 Ga0097620_101840925 3300006931 Unclassified 668
303 Ga0075435_100000189 3300007076 Bacteria 36888
304 Ga0075435_100000953 3300007076 Bacteria 18255
305 Ga0075435_100017549 3300007076 Bacteria 5421
306 Ga0075435_100108605 3300007076 Bacteria 2305
307 Ga0075435_100384052 3300007076 Unclassified 1206
308 Ga0075435_100792756 3300007076 Bacteria 825
309 Ga0075435_101033254 3300007076 Unclassified 718
310 Ga0099794_10136736 3300007265 Unclassified 1239
311 Ga0099794_10652019 3300007265 Unclassified 559
312 Ga0105240_10193768 3300009093 Unclassified 2388
313 Ga0105240_10231702 3300009093 Unclassified 2146
314 Ga0105240_10597075 3300009093 Bacteria 1216
315 Ga0111539_10000827 3300009094 Bacteria 40203
316 Ga0111539_10005847 3300009094 Bacteria 15901
317 Ga0111539_10122347 3300009094 Bacteria 3050
318 Ga0111539_10165435 3300009094 Bacteria 2586
319 Ga0111539_10698202 3300009094 Unclassified 1181
320 Ga0111539_10833391 3300009094 Bacteria 1073
321 Ga0111539_10919965 3300009094 Bacteria 1017
322 Ga0105245_10021776 3300009098 Bacteria 5627
323 Ga0105245_10082618 3300009098 Bacteria 2939
324 Ga0105245_10249931 3300009098 Bacteria 1722
325 Ga0105245_10273695 3300009098 Bacteria 1648
326 Ga0105245_10353010 3300009098 Unclassified 1458
327 Ga0105245_11112736 3300009098 Unclassified 836
328 Ga0105245_13051194 3300009098 Unclassified 519
329 Ga0105247_10084002 3300009101 Bacteria 2012
330 Ga0105247_10211871 3300009101 Unclassified 1307
331 Ga0105247_10263387 3300009101 Unclassified 1183
332 Ga0105247_10586108 3300009101 Bacteria 825
333 Ga0114129_10000973 3300009147 Bacteria 37498
334 Ga0114129_10001102 3300009147 Bacteria 35507
335 Ga0114129_10001441 3300009147 Bacteria 32078
336 Ga0114129_10007052 3300009147 Bacteria 15997
337 Ga0114129_10008836 3300009147 Bacteria 14376
338 Ga0114129_10012162 3300009147 Bacteria 12247
339 Ga0114129_10046423 3300009147 Bacteria 6104
340 Ga0114129_10056045 3300009147 Bacteria 5523
341 Ga0114129_10117733 3300009147 Bacteria 3660
342 Ga0114129_10140995 3300009147 Bacteria 3304
343 Ga0114129_10162374 3300009147 Bacteria 3050
344 Ga0114129_10357425 3300009147 Unclassified 1933
345 Ga0114129_10360060 3300009147 Bacteria 1925
346 Ga0114129_10773054 3300009147 Bacteria 1227
347 Ga0114129_10820921 3300009147 Archaea 1184
348 Ga0114129_11075869 3300009147 Unclassified 1008
349 Ga0114129_11526150 3300009147 Unclassified 820
350 Ga0114129_12010440 3300009147 Unclassified 699
351 Ga0114129_13047191 3300009147 Unclassified 549
352 Ga0105243_10487390 3300009148 Archaea 1165
353 Ga0105243_10765628 3300009148 Unclassified 948
354 Ga0105243_11714628 3300009148 Unclassified 657
355 Ga0105243_11740809 3300009148 Unclassified 653
356 Ga0105241_10142246 3300009174 Bacteria 1955
357 Ga0105241_10428626 3300009174 Bacteria 1166
358 Ga0105241_11545698 3300009174 Unclassified 640
359 Ga0105241_12419794 3300009174 Unclassified 524
360 Ga0105242_10004295 3300009176 Bacteria 11102
361 Ga0105242_10009611 3300009176 Bacteria 7414
362 Ga0105242_10010855 3300009176 Bacteria 6995
363 Ga0105242_10928133 3300009176 Bacteria 873
364 Ga0105242_11028722 3300009176 Bacteria 833
365 Ga0105242_11281472 3300009176 Unclassified 756
366 Ga0105242_11974461 3300009176 Bacteria 625
367 Ga0105248_10012085 3300009177 Bacteria 9525
368 Ga0105248_10022872 3300009177 Bacteria 6941
369 Ga0105248_10077260 3300009177 Bacteria 3743
370 Ga0105248_10095700 3300009177 Bacteria 3343
371 Ga0105248_10096692 3300009177 Unclassified 3326
372 Ga0105248_10118405 3300009177 Bacteria 2987
373 Ga0105248_10417140 3300009177 Bacteria 1512
374 Ga0105248_10542671 3300009177 Bacteria 1312
375 Ga0105248_10570168 3300009177 Unclassified 1277
376 Ga0105248_10650838 3300009177 Unclassified 1189
377 Ga0105248_10853666 3300009177 Bacteria 1028
378 Ga0105248_12086775 3300009177 Unclassified 644
379 Ga0105248_12416353 3300009177 Unclassified 599
380 Ga0105237_10167748 3300009545 Unclassified 2195
381 Ga0105237_10331170 3300009545 Bacteria 1527
382 Ga0105237_10515704 3300009545 Bacteria 1202
383 Ga0105238_12218084 3300009551 Bacteria 584
384 Ga0105249_10307105 3300009553 Bacteria 1593
385 Ga0105249_11164351 3300009553 Bacteria 842
386 Ga0105249_11247266 3300009553 Unclassified 815
387 Ga0105249_11261293 3300009553 Unclassified 810
388 Ga0105249_12928077 3300009553 Bacteria 548
389 Ga0099796_10208150 3300010159 Unclassified 796
390 Ga0105239_11029374 3300010375 Bacteria 947
391 Ga0105239_13551940 3300010375 Unclassified 507
392 Ga0105246_10740989 3300011119 Unclassified 866
393 Ga0105246_10897003 3300011119 Bacteria 795
394 Ga0105246_11313087 3300011119 Unclassified 671
395 Ga0105246_11659259 3300011119 Unclassified 606
396 Ga0105246_12482975 3300011119 Unclassified 510
397 Ga0157325_1019212 3300012485 Bacteria 595
398 Ga0157373_11057231 3300013100 Unclassified 608
399 Ga0157369_10570234 3300013105 Bacteria 1169
400 Ga0157374_10044550 3300013296 Bacteria 4101
401 Ga0157374_10243728 3300013296 Bacteria 1768
402 Ga0157374_10515034 3300013296 Bacteria 1202
403 Ga0157374_10697860 3300013296 Unclassified 1028
404 Ga0157378_10477619 3300013297 Unclassified 1241
405 Ga0157378_10496283 3300013297 Bacteria 1219
406 Ga0157378_10571261 3300013297 Unclassified 1139
407 Ga0157378_10814763 3300013297 Archaea 960
408 Ga0157378_10888253 3300013297 Unclassified 921
409 Ga0157378_11506605 3300013297 Unclassified 717
410 Ga0163162_10125726 3300013306 Bacteria 2670
411 Ga0163162_10214608 3300013306 Bacteria 2054
412 Ga0163162_10967267 3300013306 Bacteria 962
413 Ga0163162_11434811 3300013306 Unclassified 786
414 Ga0157372_10282343 3300013307 Bacteria 1930
415 Ga0157375_10177604 3300013308 Bacteria 2280
416 Ga0157375_11637985 3300013308 Unclassified 761
417 Ga0157375_13231068 3300013308 Unclassified 543
418 Ga0163163_10033220 3300014325 Unclassified 4990
419 Ga0163163_10917115 3300014325 Unclassified 939
420 Ga0163163_11421354 3300014325 Bacteria 755
421 Ga0163163_11858105 3300014325 Unclassified 662
422 Ga0157380_10071392 3300014326 Bacteria 2809
423 Ga0157380_10394823 3300014326 Unclassified 1310
424 Ga0157380_10466333 3300014326 Unclassified 1217
425 Ga0157380_10953520 3300014326 Unclassified 888
426 Ga0157380_12518016 3300014326 Unclassified 580
427 Ga0157380_12939229 3300014326 Unclassified 543
428 Ga0157377_10155865 3300014745 Bacteria 1416
429 Ga0157379_10035762 3300014968 Bacteria 4429
430 Ga0157379_10393818 3300014968 Bacteria 1272
431 Ga0157379_10851945 3300014968 Unclassified 862
432 Ga0157379_10951973 3300014968 Bacteria 817
433 Ga0157376_10032850 3300014969 Bacteria 4171
434 Ga0157376_10048878 3300014969 Bacteria 3501
435 Ga0157376_10120409 3300014969 Bacteria 2325
436 Ga0157376_10313558 3300014969 Archaea 1489
437 Ga0157376_11261913 3300014969 Bacteria 768
438 Ga0157376_12047078 3300014969 Unclassified 610
439 Ga0163161_10226306 3300017792 Bacteria 1450
440 Ga0163161_10464717 3300017792 Bacteria 1025
441 Ga0163161_10762137 3300017792 Bacteria 810
442 Ga0207697_10103042 3300025315 Bacteria 1218
443 Ga0207656_10260569 3300025321 Unclassified 851
444 Ga0207682_10198958 3300025893 Bacteria 921
445 Ga0207642_10093435 3300025899 Archaea 1492
446 Ga0207642_10105916 3300025899 Bacteria 1422
447 Ga0207688_10377807 3300025901 Unclassified 876
448 Ga0207688_10526710 3300025901 Bacteria 741
449 Ga0207680_10005172 3300025903 Bacteria 6225
450 Ga0207680_10028974 3300025903 Bacteria 3105
451 Ga0207680_10338364 3300025903 Unclassified 1055
452 Ga0207680_10435114 3300025903 Unclassified 930
453 Ga0207685_10046266 3300025905 Bacteria 1655
454 Ga0207699_10613444 3300025906 Bacteria 793
455 Ga0207699_11039894 3300025906 Unclassified 606
456 Ga0207645_10021046 3300025907 Bacteria 4259
457 Ga0207645_10043008 3300025907 Bacteria 2890
458 Ga0207645_10386693 3300025907 Unclassified 940
459 Ga0207645_10418677 3300025907 Unclassified 902
460 Ga0207645_10839297 3300025907 Unclassified 625
461 Ga0207645_10887241 3300025907 Unclassified 606
462 Ga0207643_10167074 3300025908 Bacteria 1326
463 Ga0207643_10970055 3300025908 Unclassified 550
464 Ga0207684_10177809 3300025910 Bacteria 1835
465 Ga0207654_10172560 3300025911 Bacteria 1405
466 Ga0207654_10466901 3300025911 Bacteria 887
467 Ga0207707_10310384 3300025912 Bacteria 1363
468 Ga0207707_11094939 3300025912 Bacteria 650
469 Ga0207695_10476387 3300025913 Bacteria 1130
470 Ga0207695_11365969 3300025913 Unclassified 589
471 Ga0207662_10007280 3300025918 Bacteria 6017
472 Ga0207662_10137236 3300025918 Bacteria 1547
473 Ga0207662_10589042 3300025918 Unclassified 773
474 Ga0207657_11150755 3300025919 Bacteria 591
475 Ga0207646_10061854 3300025922 Bacteria 3342
476 Ga0207646_10084155 3300025922 Bacteria 2846
477 Ga0207681_10080756 3300025923 Bacteria 2294
478 Ga0207681_10206720 3300025923 Bacteria 1510
479 Ga0207650_10461740 3300025925 Unclassified 1058
480 Ga0207650_10851692 3300025925 Bacteria 773
481 Ga0207659_10000637 3300025926 Bacteria 20834
482 Ga0207659_10018910 3300025926 Bacteria 4524
483 Ga0207659_10562520 3300025926 Bacteria 970
484 Ga0207659_11448225 3300025926 Bacteria 588
485 Ga0207687_10028398 3300025927 Bacteria 3758
486 Ga0207687_10065566 3300025927 Bacteria 2579
487 Ga0207687_10381217 3300025927 Unclassified 1155
488 Ga0207687_10693591 3300025927 Unclassified 864
489 Ga0207644_10640052 3300025931 Unclassified 884
490 Ga0207690_10715512 3300025932 Unclassified 824
491 Ga0207706_10129537 3300025933 Bacteria 2219
492 Ga0207706_10286846 3300025933 Bacteria 1435
493 Ga0207706_10288475 3300025933 Bacteria 1431
494 Ga0207706_10936457 3300025933 Bacteria 730
495 Ga0207706_11599692 3300025933 Unclassified 528
496 Ga0207686_10006649 3300025934 Bacteria 6234
497 Ga0207686_10009477 3300025934 Bacteria 5283
498 Ga0207686_10011429 3300025934 Bacteria 4862
499 Ga0207686_10253434 3300025934 Bacteria 1287
500 Ga0207686_11265201 3300025934 Bacteria 605
501 Ga0207709_10028857 3300025935 Bacteria 3211
502 Ga0207709_10046198 3300025935 Bacteria 2641
503 Ga0207709_10910740 3300025935 Unclassified 715
504 Ga0207709_11639091 3300025935 Bacteria 534
505 Ga0207670_10317954 3300025936 Bacteria 1224
506 Ga0207670_11449622 3300025936 Unclassified 583
507 Ga0207669_10006204 3300025937 Bacteria 5441
508 Ga0207669_11185413 3300025937 Bacteria 647
509 Ga0207704_10004329 3300025938 Bacteria 6490
510 Ga0207704_10022736 3300025938 Bacteria 3365
511 Ga0207704_10047515 3300025938 Unclassified 2566
512 Ga0207691_10028000 3300025940 Bacteria 5279
513 Ga0207691_11402280 3300025940 Unclassified 574
514 Ga0207691_11603669 3300025940 Bacteria 529
515 Ga0207711_10006750 3300025941 Bacteria 9649
516 Ga0207711_10037870 3300025941 Archaea 4099
517 Ga0207711_10129707 3300025941 Unclassified 2260
518 Ga0207711_10152543 3300025941 Bacteria 2086
519 Ga0207711_10195832 3300025941 Archaea 1843
520 Ga0207711_10463630 3300025941 Unclassified 1180
521 Ga0207711_10465927 3300025941 Unclassified 1177
522 Ga0207711_10734071 3300025941 Unclassified 921
523 Ga0207711_11200155 3300025941 Bacteria 700
524 Ga0207689_10380667 3300025942 Unclassified 1175
525 Ga0207689_10850101 3300025942 Bacteria 770
526 Ga0207689_11045476 3300025942 Bacteria 689
527 Ga0207651_10043367 3300025960 Archaea 3002
528 Ga0207651_10120032 3300025960 Bacteria 1992
529 Ga0207651_10175299 3300025960 Bacteria 1695
530 Ga0207651_11504899 3300025960 Unclassified 606
531 Ga0207712_10357023 3300025961 Bacteria 1217
532 Ga0207712_10487437 3300025961 Bacteria 1052
533 Ga0207712_10633902 3300025961 Bacteria 927
534 Ga0207668_11252222 3300025972 Unclassified 667
535 Ga0207640_10014241 3300025981 Bacteria 4574
536 Ga0207640_10158800 3300025981 Bacteria 1670
537 Ga0207640_11488137 3300025981 Unclassified 608
538 Ga0207640_11636083 3300025981 Unclassified 581
539 Ga0207658_10071396 3300025986 Unclassified 2629
540 Ga0207658_10253738 3300025986 Bacteria 1496
541 Ga0207677_10042368 3300026023 Bacteria 3018
542 Ga0207677_10533811 3300026023 Bacteria 1020
543 Ga0207677_11003539 3300026023 Unclassified 757
544 Ga0207677_11642136 3300026023 Unclassified 595
545 Ga0207677_12296827 3300026023 Unclassified 502
546 Ga0207703_10013125 3300026035 Bacteria 6456
547 Ga0207703_10504862 3300026035 Unclassified 1136
548 Ga0207703_11930912 3300026035 Bacteria 566
549 Ga0207678_11517701 3300026067 Unclassified 591
550 Ga0207708_10008602 3300026075 Bacteria 7553
551 Ga0207708_10054265 3300026075 Bacteria 3055
552 Ga0207708_10802626 3300026075 Unclassified 810
553 Ga0207708_10966688 3300026075 Unclassified 739
554 Ga0207708_11272840 3300026075 Unclassified 644
555 Ga0207708_11699656 3300026075 Bacteria 554
556 Ga0207702_10059817 3300026078 Bacteria 3246
557 Ga0207702_12058561 3300026078 Bacteria 561
558 Ga0207641_10214957 3300026088 Bacteria 1780
559 Ga0207641_10417528 3300026088 Bacteria 1291
560 Ga0207641_10502455 3300026088 Unclassified 1178
561 Ga0207641_11600555 3300026088 Bacteria 653
562 Ga0207648_10045763 3300026089 Bacteria 3837
563 Ga0207648_10102746 3300026089 Bacteria 2506
564 Ga0207648_10177607 3300026089 Bacteria 1883
565 Ga0207648_10448654 3300026089 Bacteria 1174
566 Ga0207648_11652467 3300026089 Bacteria 602
567 Ga0207675_100001070 3300026118 Bacteria 27182
568 Ga0207675_100216050 3300026118 Bacteria 1846
569 Ga0207675_100419567 3300026118 Bacteria 1321
570 Ga0207675_100595595 3300026118 Unclassified 1108
571 Ga0207675_100644817 3300026118 Unclassified 1065
572 Ga0207675_101330886 3300026118 Bacteria 739
573 Ga0207683_10505020 3300026121 Bacteria 1117
574 Ga0207683_10966314 3300026121 Unclassified 791
575 Ga0207698_11565578 3300026142 Unclassified 674
576 Ga0207698_11705253 3300026142 Bacteria 645
577 Ga0207698_11879927 3300026142 Unclassified 613
578 Ga0209588_1105673 3300027671 Bacteria 905
579 Ga0209813_10486216 3300027866 Unclassified 510
580 Ga0209974_10269678 3300027876 Unclassified 645
581 Ga0207428_10012068 3300027907 Bacteria 7604
582 Ga0207428_10070931 3300027907 Unclassified 2737
583 Ga0207428_10142940 3300027907 Bacteria 1825
584 Ga0207428_10394084 3300027907 Unclassified 1014
585 Ga0268266_10006303 3300028379 Bacteria 10869
586 Ga0268266_10118002 3300028379 Unclassified 2358
587 Ga0268266_11082378 3300028379 Bacteria 776
588 Ga0268266_11235527 3300028379 Bacteria 722
589 Ga0268265_10072074 3300028380 Unclassified 2693
590 Ga0268265_10747286 3300028380 Bacteria 949
591 Ga0268265_11574966 3300028380 Unclassified 662
592 Ga0268264_10059056 3300028381 Bacteria 3213
593 Ga0268264_10331963 3300028381 Unclassified 1441
594 Ga0268264_10466412 3300028381 Unclassified 1226
595 Ga0268264_10862852 3300028381 Unclassified 907
596 Ga0268264_10896771 3300028381 Bacteria 890
597 Ga0268264_10899860 3300028381 Unclassified 888
598 Ga0265330_10087150 3300031235 Unclassified 1342
599 Ga0307408_101437517 3300031548 Unclassified 650
600 Ga0307408_102512453 3300031548 Unclassified 501
601 Ga0307405_12145516 3300031731 Unclassified 502
602 Ga0307412_10055682 3300031911 Bacteria 2632
603 Ga0307412_11277132 3300031911 Unclassified 660
604 Ga0307409_101573231 3300031995 Unclassified 685
605 Ga0307416_100697270 3300032002 Bacteria 1104
606 Ga0307415_100025011 3300032126 Unclassified 3740
607 Ga0307415_100165133 3300032126 Bacteria 1721
608 Ga0307415_100560769 3300032126 Bacteria 1010
609 Ga0373938_0121554 3300034957 Bacteria 674
610 Ga0373932_0148180 3300035112 Bacteria 803
611 Ga0373939_0101408 3300035114 Unclassified 988
612 Ga0373941_0011516 3300035115 Bacteria 2287
613 Ga0373941_0118390 3300035115 Bacteria 942
614 Ga0373957_0158108 3300035120 Archaea 933
615 Ga0373943_0614924 3300035170 Unclassified 641
616 Ga0373962_0196836 3300035242 Unclassified 680
617 Ga0373924_0064042 3300035410 Bacteria 1543
618 Ga0373931_0140814 3300035691 Bacteria 1397
619 Ga0373935_0236868 3300035692 Bacteria 1273
620 Ga0373935_0766907 3300035692 Unclassified 711
621 Ga0373933_0566816 3300035724 Unclassified 745
622 Ga0373937_0130692 3300036401 Unclassified 2345
623 Ga0395900_0385879 3300037418 Unclassified 1368
624 Ga0395900_1422880 3300037418 Bacteria 606
625 Ga0439436_0056226 3300041404 Unclassified 1105
626 Ga0439453_0121505 3300041408 Unclassified 599
627 Ga0451804_0748340 3300041463 Unclassified 584
628 Ga0451807_2278131 3300041486 Bacteria 505
629 Ga0439464_0044073 3300042439 Bacteria 1277
630 Ga0439460_0166051 3300042461 Unclassified 742
631 Ga0450916_006553 3300042530 Bacteria 1375
632 Ga0453683_0445992 3300044673 Unclassified 837
633 Ga0466963_0079070 3300044694 Archaea 2225
634 Ga0466964_0402147 3300044706 Unclassified 716
635 Ga0451576_0389509 3300045051 Bacteria 1461
636 Ga0451576_2140613 3300045051 Bacteria 575
637 Ga0451576_2312467 3300045051 Bacteria 551
638 Ga0495653_0932764 3300046463 Unclassified 516
639 Ga0495580_0138992 3300046472 Bacteria 1684
640 Ga0495582_0652599 3300046473 Unclassified 609
641 Ga0495630_0898345 3300046517 Unclassified 675
642 Ga0495642_0237592 3300046528 Unclassified 796
643 Ga0495665_0175134 3300046531 Bacteria 1116
644 Ga0495640_0820412 3300046533 Unclassified 554
645 Ga0495656_0438885 3300046615 Unclassified 687
646 Ga0495647_0066937 3300046681 Unclassified 1430
647 Ga0495647_0637705 3300046681 Unclassified 501
648 Ga0495669_0422922 3300046684 Unclassified 646
649 Ga0495613_0737973 3300046689 Unclassified 646
650 Ga0495636_0270023 3300047318 Unclassified 790
651 Ga0495674_0603033 3300047319 Archaea 870
652 Ga0496100_0028114 3300048903 Archaea 3465
653 Ga0496100_0147267 3300048903 Bacteria 1676
654 Ga0496100_1336182 3300048903 Unclassified 566
655 Ga0496101_0000773 3300048904 Bacteria 18926
656 Ga0496101_1381443 3300048904 Unclassified 550
657 Ga0496101_1439987 3300048904 Unclassified 537
658 Ga0496102_0147078 3300048905 Bacteria 2212
659 Ga0496104_0042639 3300048907 Archaea 4259
660 Ga0496104_0581512 3300048907 Bacteria 1030
661 Ga0496106_0385461 3300048909 Unclassified 1126
662 Ga0496106_0675882 3300048909 Unclassified 824
663 Ga0496106_1107562 3300048909 Unclassified 620
664 Ga0496107_0621817 3300048910 Bacteria 797
665 Ga0496107_1050392 3300048910 Unclassified 590
666 Ga0496108_0079534 3300048911 Bacteria 2776
667 Ga0496110_0299868 3300048913 Unclassified 1464
668 Ga0496112_0351604 3300048915 Unclassified 1416
669 Ga0496112_0368617 3300048915 Unclassified 1378
670 Ga0496114_0000233 3300048917 Bacteria 40546
671 Ga0496114_0075661 3300048917 Bacteria 2836
672 Ga0496114_0101844 3300048917 Bacteria 2452
673 Ga0496114_1255249 3300048917 Bacteria 627
674 Ga0496115_0327835 3300048918 Bacteria 1251
675 Ga0501291_004628 3300049514 Bacteria 1763
676 Ga0501292_060286 3300049515 Unclassified 687
677 Ga0501072_1108398 3300049588 Unclassified 616
678 Ga0501076_0876447 3300049592 Bacteria 740
679 Ga0501076_1170821 3300049592 Unclassified 633
680 Ga0501076_1296966 3300049592 Unclassified 599
681 Ga0501198_050609 3300049649 Unclassified 740
682 Ga0501202_212091 3300049652 Unclassified 533
683 Ga0501225_0051546 3300049705 Bacteria 1146
684 Ga0501081_0748069 3300049743 Bacteria 735
685 Ga0501045_0325883 3300049824 Unclassified 1143
686 nmdc:mga06z11_96182_c1 3300050494 Bacteria 1617
687 nmdc:mga04h51_444765_c1 3300050495 Unclassified 548
688 nmdc:mga07m45_204592_c1 3300050496 Bacteria 1148
689 nmdc:mga05p37_1018461_c1 3300050507 Unclassified 877
690 nmdc:mga05p37_1024436_c1 3300050507 Bacteria 874
691 nmdc:mga05p37_1075373_c1 3300050507 Unclassified 845
692 nmdc:mga05p37_1254860_c1 3300050507 Bacteria 760
693 nmdc:mga05p37_133301_c1 3300050507 Unclassified 3048
694 nmdc:mga05p37_154136_c1 3300050507 Unclassified 2809
695 nmdc:mga05p37_1941567_c1 3300050507 Unclassified 560
696 nmdc:mga05p37_277352_c1 3300050507 Bacteria 2001
697 nmdc:mga05p37_33442_c1 3300050507 Bacteria 6297
698 nmdc:mga05p37_404092_c1 3300050507 Bacteria 1594
699 nmdc:mga05p37_44904_c1 3300050507 Archaea 5436
700 nmdc:mga05p37_498211_c1 3300050507 Unclassified 1399
701 nmdc:mga05p37_547744_c1 3300050507 Unclassified 1318
702 nmdc:mga05p37_6071_c1 3300050507 Bacteria 14221
703 nmdc:mga05p37_961774_c1 3300050507 Unclassified 912
704 nmdc:mga05p37_998001_c1 3300050507 Unclassified 890
705 nmdc:mga09592_233185_c1 3300050508 Unclassified 1595
706 nmdc:mga09592_235180_c1 3300050508 Bacteria 1587
707 nmdc:mga09592_530034_c1 3300050508 Bacteria 1012
708 nmdc:mga0qj67_285986_c1 3300050509 Unclassified 1336
709 nmdc:mga0qj67_611938_c1 3300050509 Bacteria 871
710 nmdc:mga06r32_1183347_c1 3300050510 Unclassified 711
711 nmdc:mga06r32_45751_c1 3300050510 Bacteria 4173
712 nmdc:mga08y16_13058_c1 3300050511 Bacteria 8738
713 nmdc:mga08y16_17257_c1 3300050511 Bacteria 7599
714 nmdc:mga08y16_21904_c1 3300050511 Bacteria 6745
715 nmdc:mga08y16_370913_c1 3300050511 Bacteria 1468
716 nmdc:mga08y16_435515_c1 3300050511 Unclassified 1339
717 nmdc:mga08y16_643297_c1 3300050511 Bacteria 1065
718 nmdc:mga08y16_900582_c1 3300050511 Unclassified 871
719 nmdc:mga0n895_1081901_c1 3300050512 Unclassified 780
720 nmdc:mga0n895_121_c1 3300050512 Bacteria 46448
721 nmdc:mga0n895_1493170_c1 3300050512 Unclassified 642
722 nmdc:mga0n895_187435_c1 3300050512 Bacteria 2100
723 nmdc:mga0n895_200866_c1 3300050512 Bacteria 2025
724 nmdc:mga0n895_263936_c1 3300050512 Bacteria 1747
725 nmdc:mga0n895_326240_c1 3300050512 Bacteria 1555
726 nmdc:mga0n895_402432_c1 3300050512 Unclassified 1384
727 nmdc:mga0n895_43914_c1 3300050512 Bacteria 4358
728 nmdc:mga0n895_63886_c1 3300050512 Bacteria 3640
729 nmdc:mga0rr50_107_c1 3300050513 Bacteria 46254
730 nmdc:mga0rr50_1111381_c1 3300050513 Unclassified 672
731 nmdc:mga0rr50_127484_c1 3300050513 Bacteria 2034
732 nmdc:mga0rr50_1699919_c1 3300050513 Bacteria 532
733 nmdc:mga0rr50_33169_c1 3300050513 Bacteria 3687
734 nmdc:mga0rr50_507389_c1 3300050513 Bacteria 1026
735 nmdc:mga0rr50_673_c1 3300050513 Bacteria 18292
736 nmdc:mga0rr50_971518_c1 3300050513 Unclassified 724
737 nmdc:mga08x19_1035588_c1 3300050514 Unclassified 583
738 nmdc:mga08x19_148042_c1 3300050514 Unclassified 1589
739 nmdc:mga08x19_255069_c1 3300050514 Bacteria 1212
740 nmdc:mga08x19_275836_c1 3300050514 Unclassified 1164
741 nmdc:mga08x19_343248_c1 3300050514 Bacteria 1042
742 nmdc:mga08x19_7380_c1 3300050514 Bacteria 6531
743 nmdc:mga08x19_91802_c1 3300050514 Unclassified 2005
744 nmdc:mga0a205_13590_c2 3300050515 Bacteria 3590
745 nmdc:mga0a205_277768_c1 3300050515 Bacteria 1551
746 nmdc:mga0a205_389386_c1 3300050515 Unclassified 1258
747 nmdc:mga0a205_470882_c1 3300050515 Bacteria 1115
748 nmdc:mga0a205_5633_c1 3300050515 Bacteria 11282
749 nmdc:mga0a205_746552_c1 3300050515 Unclassified 827
750 nmdc:mga0a205_890882_c1 3300050515 Unclassified 737
751 nmdc:mga0a205_902928_c1 3300050515 Unclassified 730
752 Ga0495595_0625473 3300053084 Unclassified 551
753 Ga0495619_0190407 3300053085 Bacteria 1420
754 Ga0530510_0400613 3300061734 Unclassified 1034
755 Ga0075433_10258282
756 Ga0058863_11813469
757 Ga0065715_10157029
758 Ga0065715_10774674
759 Ga0070676_10018518
760 Ga0070676_10142367
761 Ga0070676_10196739
762 Ga0070676_10630933
763 Ga0070683_100075211
764 Ga0070683_100462310
765 Ga0070690_100198555
766 Ga0070690_100299690
767 Ga0070670_100154015
768 Ga0070670_100433964
769 Ga0070670_100641948
770 Ga0070670_100844826
771 Ga0070670_101464998
772 Ga0070677_10040882
773 Ga0068869_100279967
774 Ga0068869_100656656
775 Ga0068869_101075083
776 Ga0068869_101600209
777 Ga0070666_10017637
778 Ga0070666_10073739
779 Ga0070666_10234298
780 Ga0070666_10294534
781 Ga0070666_10338324
782 Ga0070680_100532686
783 Ga0070680_100682988
784 Ga0068868_100033764
785 Ga0068868_100196760
786 Ga0068868_100202120
787 Ga0068868_100697477
788 Ga0068868_101125665
789 Ga0068868_101166401
790 Ga0070660_101151436
791 Ga0070689_100848415
792 Ga0070689_101365573
793 Ga0070691_10008506
794 Ga0070687_100030469
795 Ga0070687_100037689
796 Ga0070687_100618244
797 Ga0070692_10107893
798 Ga0070692_10271419
799 Ga0070668_100056011
800 Ga0070668_100172624
801 Ga0070668_100867430
802 Ga0070668_101641042
803 Ga0070669_100009794
804 Ga0070669_100018849
805 Ga0070675_100036346
806 Ga0070675_100691806
807 Ga0070675_100910185
808 Ga0070675_101028186
809 Ga0070675_101796473
810 Ga0070675_101846147
811 Ga0070671_100317751
812 Ga0070674_100031883
813 Ga0070674_100153348
814 Ga0070674_100267775
815 Ga0070674_100354504
816 Ga0070674_101256172
817 Ga0070674_101884961
818 Ga0070673_100035638
819 Ga0070673_100178713
820 Ga0070673_100187345
821 Ga0070673_100302250
822 Ga0070673_102025753
823 Ga0070673_102079754
824 Ga0070688_100021725
825 Ga0070688_100269725
826 Ga0070688_100344434
827 Ga0070688_100390412
828 Ga0070688_101109596
829 Ga0070659_100931820
830 Ga0070667_100076529
831 Ga0070667_100558110
832 Ga0070667_100834128
833 Ga0070709_10037346
834 Ga0070709_10707585
835 Ga0070713_100575484
836 Ga0070710_10710985
837 Ga0070701_10013105
838 Ga0070701_10712877
839 Ga0070705_100013496
840 Ga0070705_100171119
841 Ga0070705_100357521
842 Ga0070705_100442569
843 Ga0070705_101045240
844 Ga0070700_100002015
845 Ga0070700_100060721
846 Ga0070700_100311733
847 Ga0070700_101229638
848 Ga0070700_101391545
849 Ga0070700_101677421
850 Ga0070700_101683987
851 Ga0070694_100013190
852 Ga0070694_100036351
853 Ga0070694_100217844
854 Ga0070694_100243956
855 Ga0070708_100130668
856 Ga0070708_100433324
857 Ga0070678_100163905
858 Ga0070678_100691165
859 Ga0070662_100023061
860 Ga0070662_101726082
861 Ga0070681_10313758
862 Ga0070681_10934912
863 Ga0070681_11248999
864 Ga0068867_100042064
865 Ga0068867_100067274
866 Ga0068867_100374711
867 Ga0068867_100874107
868 Ga0068867_101249274
869 Ga0068867_101352919
870 Ga0068867_101500751
871 Ga0068867_102018799
872 Ga0070706_100315968
873 Ga0070707_100030322
874 Ga0070707_100066712
875 Ga0070707_100098830
876 Ga0070707_102072510
877 Ga0070698_100016948
878 Ga0070698_100049628
879 Ga0070698_100806031
880 Ga0070698_100874517
881 Ga0070698_101329909
882 Ga0070698_101537897
883 Ga0070699_100008361
884 Ga0070699_100172780
885 Ga0070699_100348420
886 Ga0070699_100434215
887 Ga0070679_100340439
888 Ga0070697_101062816
889 Ga0070672_100718661
890 Ga0070672_101269752
891 Ga0070672_101337292
892 Ga0070686_100001249
893 Ga0070686_100033710
894 Ga0070686_100998466
895 Ga0070686_101001729
896 Ga0070695_100002600
897 Ga0070695_100134574
898 Ga0070695_100320091
899 Ga0070695_100848681
900 Ga0070696_100078171
901 Ga0070696_100097884
902 Ga0070696_100122013
903 Ga0070696_100276542
904 Ga0070696_100848695
905 Ga0070693_100659404
906 Ga0070693_100822362
907 Ga0070665_100012476
908 Ga0070665_100021274
909 Ga0070665_101870752
910 Ga0070665_101961851
911 Ga0070704_100002400
912 Ga0070704_100062768
913 Ga0070704_100094096
914 Ga0070704_100233382
915 Ga0070704_100254430
916 Ga0070704_100550186
917 Ga0070704_100820735
918 Ga0070704_101046721
919 Ga0070704_101088599
920 Ga0068855_100187811
921 Ga0068855_101113340
922 Ga0070664_100898088
923 Ga0068854_100103012
924 Ga0068854_100211467
925 Ga0068854_100479956
926 Ga0068854_101610953
927 Ga0068856_100064040
928 Ga0070702_100028861
929 Ga0070702_100077806
930 Ga0068852_100925777
931 Ga0068852_101439937
932 Ga0068852_102042355
933 Ga0068859_100247614
934 Ga0068859_100415204
935 Ga0068859_100673718
936 Ga0068859_101012069
937 Ga0068859_101841759
938 Ga0068859_102153859
939 Ga0068864_101102058
940 Ga0068866_10049041
941 Ga0068866_10271450
942 Ga0068866_10601922
943 Ga0068866_10871787
944 Ga0068861_100060729
945 Ga0068861_100387450
946 Ga0068861_100426644
947 Ga0068861_101068328
948 Ga0068861_101973773
949 Ga0068851_10084637
950 Ga0068851_10331641
951 Ga0068870_10270965
952 Ga0068870_10356201
953 Ga0068870_10937755
954 Ga0068863_100021003
955 Ga0068863_100769449
956 Ga0068863_100898347
957 Ga0068863_102160688
958 Ga0068858_100006439
959 Ga0068858_100120620
960 Ga0068858_100284339
961 Ga0068858_100290997
962 Ga0068858_101521670
963 Ga0068860_100046483
964 Ga0068860_100232402
965 Ga0068860_100257039
966 Ga0068860_100296910
967 Ga0068860_100503768
968 Ga0068860_100646949
969 Ga0068860_100855507
970 Ga0068860_101289810
971 Ga0068860_101665708
972 Ga0068860_102045075
973 Ga0068862_100412830
974 Ga0068862_100500204
975 Ga0068862_101580418
976 Ga0068862_102280675
977 Ga0081455_10061550
978 Ga0081455_10076100
979 Ga0081538_10160505
980 Ga0081539_10031442
981 Ga0081539_10116092
982 Ga0075364_10032484
983 Ga0075432_10037609
984 Ga0075432_10068819
985 Ga0070715_10036139
986 Ga0070715_10857340
987 Ga0075367_10429610
988 Ga0075369_10233187
989 Ga0097621_100011538
990 Ga0097621_100013023
991 Ga0097621_100020364
992 Ga0097621_100060503
993 Ga0097621_100095975
994 Ga0097621_100302170
995 Ga0097621_100323170
996 Ga0097621_101088664
997 Ga0075370_10353511
998 Ga0068871_100003046
999 Ga0068871_100014180
1000 Ga0068871_100041977
1001 Ga0068871_100254380
1002 Ga0068871_100278667
1003 Ga0068871_100320394
1004 Ga0068871_100670375
1005 Ga0068871_101326107
1006 Ga0075428_100001914
1007 Ga0075428_100156797
1008 Ga0075428_100167422
1009 Ga0075428_100180110
1010 Ga0075428_100798189
1011 Ga0075430_100214613
1012 Ga0075431_100022643
1013 Ga0075431_100063135
1014 Ga0075431_100105871
1015 Ga0075433_10056597
1016 Ga0075433_10062979
1017 Ga0075433_10367226
1018 Ga0075433_10379434
1019 Ga0075433_10450517
1020 Ga0075433_10989221
1021 Ga0075433_11170490
1022 Ga0075433_11323903
1023 Ga0075434_100002495
1024 Ga0075434_100003115
1025 Ga0075434_100045768
1026 Ga0075434_100053023
1027 Ga0075434_100067806
1028 Ga0075434_100115177
1029 Ga0075434_100124929
1030 Ga0075434_100234351
1031 Ga0075434_100344126
1032 Ga0075434_100423285
1033 Ga0075434_100732034
1034 Ga0075434_100748801
1035 Ga0075434_101110085
1036 Ga0075434_101173066
1037 Ga0075434_101685570
1038 Ga0075429_100124680
1039 Ga0075429_101890064
1040 Ga0068865_100004678
1041 Ga0068865_100210623
1042 Ga0068865_100439126
1043 Ga0068865_101461090
1044 Ga0075436_100007761
1045 Ga0075436_100011754
1046 Ga0075436_100013550
1047 Ga0075436_100017206
1048 Ga0075436_100024643
1049 Ga0075436_100041363
1050 Ga0075436_100056807
1051 Ga0075436_100187361
1052 Ga0097620_100247638
1053 Ga0097620_100415251
1054 Ga0097620_100673752
1055 Ga0097620_101011923
1056 Ga0097620_101840925
1057 Ga0075435_100000189
1058 Ga0075435_100000953
1059 Ga0075435_100017549
1060 Ga0075435_100108605
1061 Ga0075435_100384052
1062 Ga0075435_100792756
1063 Ga0075435_101033254
1064 Ga0099794_10136736
1065 Ga0099794_10652019
1066 Ga0105240_10193768
1067 Ga0105240_10231702
1068 Ga0105240_10597075
1069 Ga0111539_10000827
1070 Ga0111539_10005847
1071 Ga0111539_10122347
1072 Ga0111539_10165435
1073 Ga0111539_10698202
1074 Ga0111539_10833391
1075 Ga0111539_10919965
1076 Ga0105245_10021776
1077 Ga0105245_10082618
1078 Ga0105245_10249931
1079 Ga0105245_10273695
1080 Ga0105245_10353010
1081 Ga0105245_11112736
1082 Ga0105245_13051194
1083 Ga0105247_10084002
1084 Ga0105247_10211871
1085 Ga0105247_10263387
1086 Ga0105247_10586108
1087 Ga0114129_10000973
1088 Ga0114129_10001102
1089 Ga0114129_10001441
1090 Ga0114129_10007052
1091 Ga0114129_10008836
1092 Ga0114129_10012162
1093 Ga0114129_10046423
1094 Ga0114129_10056045
1095 Ga0114129_10117733
1096 Ga0114129_10140995
1097 Ga0114129_10162374
1098 Ga0114129_10357425
1099 Ga0114129_10360060
1100 Ga0114129_10773054
1101 Ga0114129_10820921
1102 Ga0114129_11075869
1103 Ga0114129_11526150
1104 Ga0114129_12010440
1105 Ga0114129_13047191
1106 Ga0105243_10487390
1107 Ga0105243_10765628
1108 Ga0105243_11714628
1109 Ga0105243_11740809
1110 Ga0105241_10142246
1111 Ga0105241_10428626
1112 Ga0105241_11545698
1113 Ga0105241_12419794
1114 Ga0105242_10004295
1115 Ga0105242_10009611
1116 Ga0105242_10010855
1117 Ga0105242_10928133
1118 Ga0105242_11028722
1119 Ga0105242_11281472
1120 Ga0105242_11974461
1121 Ga0105248_10012085
1122 Ga0105248_10022872
1123 Ga0105248_10077260
1124 Ga0105248_10095700
1125 Ga0105248_10096692
1126 Ga0105248_10118405
1127 Ga0105248_10417140
1128 Ga0105248_10542671
1129 Ga0105248_10570168
1130 Ga0105248_10650838
1131 Ga0105248_10853666
1132 Ga0105248_12086775
1133 Ga0105248_12416353
1134 Ga0105237_10167748
1135 Ga0105237_10331170
1136 Ga0105237_10515704
1137 Ga0105238_12218084
1138 Ga0105249_10307105
1139 Ga0105249_11164351
1140 Ga0105249_11247266
1141 Ga0105249_11261293
1142 Ga0105249_12928077
1143 Ga0099796_10208150
1144 Ga0105239_11029374
1145 Ga0105239_13551940
1146 Ga0105246_10740989
1147 Ga0105246_10897003
1148 Ga0105246_11313087
1149 Ga0105246_11659259
1150 Ga0105246_12482975
1151 Ga0157325_1019212
1152 Ga0157373_11057231
1153 Ga0157369_10570234
1154 Ga0157374_10044550
1155 Ga0157374_10243728
1156 Ga0157374_10515034
1157 Ga0157374_10697860
1158 Ga0157378_10477619
1159 Ga0157378_10496283
1160 Ga0157378_10571261
1161 Ga0157378_10814763
1162 Ga0157378_10888253
1163 Ga0157378_11506605
1164 Ga0163162_10125726
1165 Ga0163162_10214608
1166 Ga0163162_10967267
1167 Ga0163162_11434811
1168 Ga0157372_10282343
1169 Ga0157375_10177604
1170 Ga0157375_11637985
1171 Ga0157375_13231068
1172 Ga0163163_10033220
1173 Ga0163163_10917115
1174 Ga0163163_11421354
1175 Ga0163163_11858105
1176 Ga0157380_10071392
1177 Ga0157380_10394823
1178 Ga0157380_10466333
1179 Ga0157380_10953520
1180 Ga0157380_12518016
1181 Ga0157380_12939229
1182 Ga0157377_10155865
1183 Ga0157379_10035762
1184 Ga0157379_10393818
1185 Ga0157379_10851945
1186 Ga0157379_10951973
1187 Ga0157376_10032850
1188 Ga0157376_10048878
1189 Ga0157376_10120409
1190 Ga0157376_10313558
1191 Ga0157376_11261913
1192 Ga0157376_12047078
1193 Ga0163161_10226306
1194 Ga0163161_10464717
1195 Ga0163161_10762137
1196 Ga0207697_10103042
1197 Ga0207656_10260569
1198 Ga0207682_10198958
1199 Ga0207642_10093435
1200 Ga0207642_10105916
1201 Ga0207688_10377807
1202 Ga0207688_10526710
1203 Ga0207680_10005172
1204 Ga0207680_10028974
1205 Ga0207680_10338364
1206 Ga0207680_10435114
1207 Ga0207685_10046266
1208 Ga0207699_10613444
1209 Ga0207699_11039894
1210 Ga0207645_10021046
1211 Ga0207645_10043008
1212 Ga0207645_10386693
1213 Ga0207645_10418677
1214 Ga0207645_10839297
1215 Ga0207645_10887241
1216 Ga0207643_10167074
1217 Ga0207643_10970055
1218 Ga0207684_10177809
1219 Ga0207654_10172560
1220 Ga0207654_10466901
1221 Ga0207707_10310384
1222 Ga0207707_11094939
1223 Ga0207695_10476387
1224 Ga0207695_11365969
1225 Ga0207662_10007280
1226 Ga0207662_10137236
1227 Ga0207662_10589042
1228 Ga0207657_11150755
1229 Ga0207646_10061854
1230 Ga0207646_10084155
1231 Ga0207681_10080756
1232 Ga0207681_10206720
1233 Ga0207650_10461740
1234 Ga0207650_10851692
1235 Ga0207659_10000637
1236 Ga0207659_10018910
1237 Ga0207659_10562520
1238 Ga0207659_11448225
1239 Ga0207687_10028398
1240 Ga0207687_10065566
1241 Ga0207687_10381217
1242 Ga0207687_10693591
1243 Ga0207644_10640052
1244 Ga0207690_10715512
1245 Ga0207706_10129537
1246 Ga0207706_10286846
1247 Ga0207706_10288475
1248 Ga0207706_10936457
1249 Ga0207706_11599692
1250 Ga0207686_10006649
1251 Ga0207686_10009477
1252 Ga0207686_10011429
1253 Ga0207686_10253434
1254 Ga0207686_11265201
1255 Ga0207709_10028857
1256 Ga0207709_10046198
1257 Ga0207709_10910740
1258 Ga0207709_11639091
1259 Ga0207670_10317954
1260 Ga0207670_11449622
1261 Ga0207669_10006204
1262 Ga0207669_11185413
1263 Ga0207704_10004329
1264 Ga0207704_10022736
1265 Ga0207704_10047515
1266 Ga0207691_10028000
1267 Ga0207691_11402280
1268 Ga0207691_11603669
1269 Ga0207711_10006750
1270 Ga0207711_10037870
1271 Ga0207711_10129707
1272 Ga0207711_10152543
1273 Ga0207711_10195832
1274 Ga0207711_10463630
1275 Ga0207711_10465927
1276 Ga0207711_10734071
1277 Ga0207711_11200155
1278 Ga0207689_10380667
1279 Ga0207689_10850101
1280 Ga0207689_11045476
1281 Ga0207651_10043367
1282 Ga0207651_10120032
1283 Ga0207651_10175299
1284 Ga0207651_11504899
1285 Ga0207712_10357023
1286 Ga0207712_10487437
1287 Ga0207712_10633902
1288 Ga0207668_11252222
1289 Ga0207640_10014241
1290 Ga0207640_10158800
1291 Ga0207640_11488137
1292 Ga0207640_11636083
1293 Ga0207658_10071396
1294 Ga0207658_10253738
1295 Ga0207677_10042368
1296 Ga0207677_10533811
1297 Ga0207677_11003539
1298 Ga0207677_11642136
1299 Ga0207677_12296827
1300 Ga0207703_10013125
1301 Ga0207703_10504862
1302 Ga0207703_11930912
1303 Ga0207678_11517701
1304 Ga0207708_10008602
1305 Ga0207708_10054265
1306 Ga0207708_10802626
1307 Ga0207708_10966688
1308 Ga0207708_11272840
1309 Ga0207708_11699656
1310 Ga0207702_10059817
1311 Ga0207702_12058561
1312 Ga0207641_10214957
1313 Ga0207641_10417528
1314 Ga0207641_10502455
1315 Ga0207641_11600555
1316 Ga0207648_10045763
1317 Ga0207648_10102746
1318 Ga0207648_10177607
1319 Ga0207648_10448654
1320 Ga0207648_11652467
1321 Ga0207675_100001070
1322 Ga0207675_100216050
1323 Ga0207675_100419567
1324 Ga0207675_100595595
1325 Ga0207675_100644817
1326 Ga0207675_101330886
1327 Ga0207683_10505020
1328 Ga0207683_10966314
1329 Ga0207698_11565578
1330 Ga0207698_11705253
1331 Ga0207698_11879927
1332 Ga0209588_1105673
1333 Ga0209813_10486216
1334 Ga0209974_10269678
1335 Ga0207428_10012068
1336 Ga0207428_10070931
1337 Ga0207428_10142940
1338 Ga0207428_10394084
1339 Ga0268266_10006303
1340 Ga0268266_10118002
1341 Ga0268266_11082378
1342 Ga0268266_11235527
1343 Ga0268265_10072074
1344 Ga0268265_10747286
1345 Ga0268265_11574966
1346 Ga0268264_10059056
1347 Ga0268264_10331963
1348 Ga0268264_10466412
1349 Ga0268264_10862852
1350 Ga0268264_10896771
1351 Ga0268264_10899860
1352 Ga0265330_10087150
1353 Ga0307408_101437517
1354 Ga0307408_102512453
1355 Ga0307405_12145516
1356 Ga0307412_10055682
1357 Ga0307412_11277132
1358 Ga0307409_101573231
1359 Ga0307416_100697270
1360 Ga0307415_100025011
1361 Ga0307415_100165133
1362 Ga0307415_100560769
1363 Ga0373938_0121554
1364 Ga0373932_0148180
1365 Ga0373939_0101408
1366 Ga0373941_0011516
1367 Ga0373941_0118390
1368 Ga0373957_0158108
1369 Ga0373943_0614924
1370 Ga0373962_0196836
1371 Ga0373924_0064042
1372 Ga0373931_0140814
1373 Ga0373935_0236868
1374 Ga0373935_0766907
1375 Ga0373933_0566816
1376 Ga0373937_0130692
1377 Ga0395900_0385879
1378 Ga0395900_1422880
1379 Ga0439436_0056226
1380 Ga0439453_0121505
1381 Ga0451804_0748340
1382 Ga0451807_2278131
1383 Ga0439464_0044073
1384 Ga0439460_0166051
1385 Ga0450916_006553
1386 Ga0453683_0445992
1387 Ga0466963_0079070
1388 Ga0466964_0402147
1389 Ga0451576_0389509
1390 Ga0451576_2140613
1391 Ga0451576_2312467
1392 Ga0495653_0932764
1393 Ga0495580_0138992
1394 Ga0495582_0652599
1395 Ga0495630_0898345
1396 Ga0495642_0237592
1397 Ga0495665_0175134
1398 Ga0495640_0820412
1399 Ga0495656_0438885
1400 Ga0495647_0066937
1401 Ga0495647_0637705
1402 Ga0495669_0422922
1403 Ga0495613_0737973
1404 Ga0495636_0270023
1405 Ga0495674_0603033
1406 Ga0496100_0028114
1407 Ga0496100_0147267
1408 Ga0496100_1336182
1409 Ga0496101_0000773
1410 Ga0496101_1381443
1411 Ga0496101_1439987
1412 Ga0496102_0147078
1413 Ga0496104_0042639
1414 Ga0496104_0581512
1415 Ga0496106_0385461
1416 Ga0496106_0675882
1417 Ga0496106_1107562
1418 Ga0496107_0621817
1419 Ga0496107_1050392
1420 Ga0496108_0079534
1421 Ga0496110_0299868
1422 Ga0496112_0351604
1423 Ga0496112_0368617
1424 Ga0496114_0000233
1425 Ga0496114_0075661
1426 Ga0496114_0101844
1427 Ga0496114_1255249
1428 Ga0496115_0327835
1429 Ga0501291_004628
1430 Ga0501292_060286
1431 Ga0501072_1108398
1432 Ga0501076_0876447
1433 Ga0501076_1170821
1434 Ga0501076_1296966
1435 Ga0501198_050609
1436 Ga0501202_212091
1437 Ga0501225_0051546
1438 Ga0501081_0748069
1439 Ga0501045_0325883
1440 nmdc:mga06z11_96182_c1
1441 nmdc:mga04h51_444765_c1
1442 nmdc:mga07m45_204592_c1
1443 nmdc:mga05p37_1018461_c1
1444 nmdc:mga05p37_1024436_c1
1445 nmdc:mga05p37_1075373_c1
1446 nmdc:mga05p37_1254860_c1
1447 nmdc:mga05p37_133301_c1
1448 nmdc:mga05p37_154136_c1
1449 nmdc:mga05p37_1941567_c1
1450 nmdc:mga05p37_277352_c1
1451 nmdc:mga05p37_33442_c1
1452 nmdc:mga05p37_404092_c1
1453 nmdc:mga05p37_44904_c1
1454 nmdc:mga05p37_498211_c1
1455 nmdc:mga05p37_547744_c1
1456 nmdc:mga05p37_6071_c1
1457 nmdc:mga05p37_961774_c1
1458 nmdc:mga05p37_998001_c1
1459 nmdc:mga09592_233185_c1
1460 nmdc:mga09592_235180_c1
1461 nmdc:mga09592_530034_c1
1462 nmdc:mga0qj67_285986_c1
1463 nmdc:mga0qj67_611938_c1
1464 nmdc:mga06r32_1183347_c1
1465 nmdc:mga06r32_45751_c1
1466 nmdc:mga08y16_13058_c1
1467 nmdc:mga08y16_17257_c1
1468 nmdc:mga08y16_21904_c1
1469 nmdc:mga08y16_370913_c1
1470 nmdc:mga08y16_435515_c1
1471 nmdc:mga08y16_643297_c1
1472 nmdc:mga08y16_900582_c1
1473 nmdc:mga0n895_1081901_c1
1474 nmdc:mga0n895_121_c1
1475 nmdc:mga0n895_1493170_c1
1476 nmdc:mga0n895_187435_c1
1477 nmdc:mga0n895_200866_c1
1478 nmdc:mga0n895_263936_c1
1479 nmdc:mga0n895_326240_c1
1480 nmdc:mga0n895_402432_c1
1481 nmdc:mga0n895_43914_c1
1482 nmdc:mga0n895_63886_c1
1483 nmdc:mga0rr50_107_c1
1484 nmdc:mga0rr50_1111381_c1
1485 nmdc:mga0rr50_127484_c1
1486 nmdc:mga0rr50_1699919_c1
1487 nmdc:mga0rr50_33169_c1
1488 nmdc:mga0rr50_507389_c1
1489 nmdc:mga0rr50_673_c1
1490 nmdc:mga0rr50_971518_c1
1491 nmdc:mga08x19_1035588_c1
1492 nmdc:mga08x19_148042_c1
1493 nmdc:mga08x19_255069_c1
1494 nmdc:mga08x19_275836_c1
1495 nmdc:mga08x19_343248_c1
1496 nmdc:mga08x19_7380_c1
1497 nmdc:mga08x19_91802_c1
1498 nmdc:mga0a205_13590_c2
1499 nmdc:mga0a205_277768_c1
1500 nmdc:mga0a205_389386_c1
1501 nmdc:mga0a205_470882_c1
1502 nmdc:mga0a205_5633_c1
1503 nmdc:mga0a205_746552_c1
1504 nmdc:mga0a205_890882_c1
1505 nmdc:mga0a205_902928_c1
1506 Ga0495595_0625473
1507 Ga0495619_0190407
1508 Ga0530510_0400613

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nvk-assembly1.cif.gz_X crystal structure of thioredoxin reductase from drosophila melanogaster 0.8825 4 33
5o8p-assembly1.cif.gz_B the crystal structure of dfoa bound to fad, the desferrioxamine biosynthetic pathway cadaverine monooxygenase from the fire blight disease pathogen erwinia amylovora 0.8729 4 33
7psc-assembly1.cif.gz_B crystal structure of the disease-causing i358t mutant of the human dihydrolipoamide dehydrogenase 0.8606 4 33
7q2p-assembly1.cif.gz_BBB beta-lactoglobulin mutant faw (i56f/l39a/m107w) in complex with desipramine (faw-dsm#2) 0.7851 4 38
5y90-assembly1.cif.gz_A map2k7 mutant -c218s 0.7818 4 33
ID Description Score Start End Superfamily
af_Q2FV16_5_493_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9182 4 33 3.50.50.60
af_P9WJP5_5_490_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9078 4 31 3.50.50.60
af_P33940_30_518_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9007 4 33 3.50.50.60
3dh9B02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.899 4 33 3.50.50.60
6ftoA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.8683 3 34 2.40.50.40
ID Description Score Start End GO Terms
AF-A0A7W0K930-F1-model_v4 Secreted protein 0.9919 2 53
AF-A0A529V2L5-F1-model_v4 Uncharacterized protein 0.9746 4 33
AF-A0A2V8HBX6-F1-model_v4 Secreted protein 0.9699 1 52
AF-A0A520WDW1-F1-model_v4 Uncharacterized protein 0.9458 4 51
AF-A0A2V8HHH8-F1-model_v4 Uncharacterized protein 0.9405 1 51

Map