F479104

General Info

Members Datasets Scaffolds Average Seq Length
751 320 645 255

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10004667|Ga0105244_100046678
Length 264
Sequence MRSPSRRLWAAGFAVLAGALSNVVAVQAASSVLIWPIDPVLEADQQASALWLENRGTETANLQIRVFAWSQNGFDEQYQNQRDVIGSPPVAKIEPGQKQLVRLTRTREVPPGQELAYRIIIDEIPSPLQVPTPPEGKNTAAAIRFQMRYSVPLFAYGAGLWSKEDATRQRDPKGAGKPDLSWRKVSVAGRSYIEVRNQGAVHARLTDASFKQGGQTRPVADGLLGYVLPGATMRWPVPEAVSADQPLQVRINGAAQVEALAPAR

Samples

Sample ID Description Type Environment
1 2511231006 Pseudomonas sp. GM17 Isolate Nodule
2 2511231010 Pseudomonas sp. GM25 Isolate Nodule
3 2511231011 Pseudomonas sp. GM30 Isolate Nodule
4 2511231018 Pseudomonas sp. GM60 Isolate Nodule
5 2511231019 Pseudomonas sp. GM67 Isolate Nodule
6 2511231021 Pseudomonas sp. GM78 Isolate Nodule
7 2511231024 Pseudomonas sp. GM84 Isolate Nodule
8 2511231031 Pseudomonas sp. GM16 Isolate Nodule
9 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
10 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
11 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
12 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
13 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
14 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
15 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
16 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
17 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
18 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
19 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
20 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
21 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
22 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
23 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
24 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
25 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
26 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
27 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
28 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
29 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
30 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
31 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
32 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
33 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
34 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
35 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
36 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
37 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
38 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
39 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
40 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
41 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
42 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
43 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
44 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
45 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
46 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
47 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
48 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
49 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
50 2765235841 Pseudomonas putida AA7 Isolate Unclassified
51 2773857673 Pseudomonas sp. 443 Isolate Unclassified
52 2784132063 Pseudomonas sp. 424 Isolate Unclassified
53 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
54 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
55 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
56 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
57 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
58 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
59 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
60 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
61 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
62 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
63 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
64 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
65 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
66 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
67 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
68 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
69 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
70 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
71 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
72 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
73 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
74 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
75 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
76 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
77 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
78 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
79 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
80 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
81 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
82 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
83 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
84 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
85 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
86 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
87 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
88 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
89 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
90 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
91 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
92 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
93 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
94 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
95 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
96 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
97 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
98 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
99 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
100 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
101 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
102 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
103 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
104 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
105 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
106 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
107 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
108 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
109 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
110 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
111 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
112 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
113 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
114 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
115 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
116 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
117 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
130 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
131 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
132 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
135 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
136 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
142 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
143 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
145 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
147 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
148 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
150 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
165 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
168 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
169 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
170 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
171 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
172 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
173 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
174 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
175 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
176 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
177 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
178 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
179 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
180 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
181 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
182 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
183 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
184 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
185 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
186 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
187 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
188 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
189 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
190 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
191 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
192 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
193 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
194 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
195 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
196 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
197 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
198 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
199 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
200 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
201 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
202 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
203 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
204 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
205 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
206 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
207 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
208 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
209 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
210 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
211 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
212 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
213 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
214 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
215 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
216 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
217 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
218 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
219 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
220 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
221 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
222 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
223 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
224 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
225 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
226 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
227 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
228 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
229 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
230 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
231 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
232 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
233 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
234 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
235 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
236 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
237 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
238 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
241 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
242 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
243 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
244 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
245 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
246 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
247 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
248 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
249 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
250 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
251 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
252 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
253 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
254 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
255 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
256 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
257 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
258 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
259 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
260 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
261 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
262 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
263 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
264 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
265 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
266 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
267 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
268 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
269 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
270 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
271 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
272 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
273 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
274 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
275 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
276 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
277 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
278 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
287 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
288 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
289 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
290 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
291 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
292 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
293 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
296 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
297 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
298 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
299 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
300 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
301 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
302 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
303 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
304 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
305 8052494512 Pseudomonas putida LD6 Isolate Unclassified
306 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
307 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
308 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
309 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
310 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
311 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
312 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
313 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
314 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
315 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
316 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
317 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
318 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
319 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
320 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.89
Metatranscriptomes 0
Isolates 14.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.52
Nodule 1.46
Rhizoplane 4.66
Rhizosphere 74.83
Stem 0
Stem Tuber 0
Unclassified 12.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000095 3300002737 Bacteria 98329
2 JGI25163J39215_1000303 3300002771 Bacteria 16649
3 JGI25164J39214_1000069 3300002772 Bacteria 103125
4 JGI25165J46597_1000168 3300003214 Bacteria 103125
5 Ga0055538_1000072 3300003751 Bacteria 91545
6 Ga0055539_1000107 3300003752 Bacteria 91545
7 Ga0055533_1000116 3300003756 Bacteria 91545
8 Ga0055532_1000103 3300003758 Bacteria 91541
9 Ga0055525_1000160 3300003759 Bacteria 87810
10 Ga0055536_1000082 3300003781 Bacteria 81873
11 Ga0055536_1000266 3300003781 Bacteria 40173
12 Ga0055536_1006374 3300003781 Bacteria 5531
13 Ga0055536_1023435 3300003781 Bacteria 1814
14 Ga0055530_10000124 3300003791 Bacteria 66816
15 Ga0055530_10000239 3300003791 Bacteria 49412
16 Ga0055540_1000244 3300003792 Bacteria 49750
17 Ga0055540_1000467 3300003792 Bacteria 31316
18 Ga0055531_10000221 3300003794 Bacteria 62838
19 Ga0055541_1000073 3300003841 Bacteria 91545
20 Ga0058692_1000001 3300003856 Bacteria 834230
21 Ga0058692_1000014 3300003856 Bacteria 313984
22 Ga0065714_10006234 3300005288 Bacteria 5537
23 Ga0065714_10064735 3300005288 Bacteria 20692
24 Ga0065714_10065878 3300005288 Bacteria 8211
25 Ga0065704_10070484 3300005289 Bacteria 22867
26 Ga0070670_100003042 3300005331 Bacteria 13876
27 Ga0070669_100000957 3300005353 Bacteria 21077
28 Ga0070669_100025190 3300005353 Bacteria 4272
29 Ga0070662_100002793 3300005457 Bacteria 10813
30 Ga0068854_100221452 3300005578 Bacteria 1497
31 Ga0068851_10000103 3300005834 Bacteria 45687
32 Ga0075364_10340421 3300006051 Bacteria 1022
33 Ga0075432_10002626 3300006058 Bacteria 6006
34 Ga0075432_10054422 3300006058 Bacteria 1417
35 Ga0075436_100057426 3300006914 Bacteria 2688
36 Ga0099823_1000097 3300006944 Bacteria 42542
37 Ga0105251_10000003 3300009011 Bacteria 311814
38 Ga0105251_10001158 3300009011 Bacteria 22899
39 Ga0105251_10002283 3300009011 Bacteria 15191
40 Ga0105251_10009671 3300009011 Bacteria 5666
41 Ga0105251_10009926 3300009011 Bacteria 5572
42 Ga0105251_10010233 3300009011 Bacteria 5460
43 Ga0105251_10015000 3300009011 Bacteria 4252
44 Ga0105251_10019707 3300009011 Bacteria 3557
45 Ga0105251_10020295 3300009011 Bacteria 3493
46 Ga0105251_10042292 3300009011 Bacteria 2213
47 Ga0105251_10045183 3300009011 Bacteria 2124
48 Ga0105251_10076399 3300009011 Bacteria 1554
49 Ga0105251_10110737 3300009011 Bacteria 1251
50 Ga0105244_10000377 3300009036 Bacteria 41493
51 Ga0105244_10000692 3300009036 Bacteria 29284
52 Ga0105244_10001397 3300009036 Bacteria 19611
53 Ga0105244_10003294 3300009036 Bacteria 11630
54 Ga0105244_10003734 3300009036 Bacteria 10747
55 Ga0105244_10004667 3300009036 Bacteria 9345
56 Ga0105244_10016714 3300009036 Bacteria 4171
57 Ga0105244_10032451 3300009036 Bacteria 2764
58 Ga0105244_10035581 3300009036 Bacteria 2616
59 Ga0105244_10036036 3300009036 Bacteria 2595
60 Ga0105244_10073961 3300009036 Bacteria 1696
61 Ga0105244_10119325 3300009036 Bacteria 1278
62 Ga0105244_10163150 3300009036 Bacteria 1063
63 Ga0105250_10000160 3300009092 Bacteria 57969
64 Ga0105250_10001022 3300009092 Bacteria 16151
65 Ga0105250_10001304 3300009092 Bacteria 13668
66 Ga0105250_10002498 3300009092 Bacteria 9221
67 Ga0105250_10067168 3300009092 Bacteria 1446
68 Ga0105243_10000258 3300009148 Bacteria 60821
69 Ga0105243_10006203 3300009148 Bacteria 9244
70 Ga0105243_10044628 3300009148 Bacteria 3478
71 Ga0105243_10084930 3300009148 Bacteria 2594
72 Ga0105243_10131357 3300009148 Bacteria 2124
73 Ga0105249_10010848 3300009553 Bacteria 8007
74 Ga0105249_10375457 3300009553 Bacteria 1446
75 Ga0105246_10000161 3300011119 Bacteria 32152
76 Ga0105246_10000203 3300011119 Bacteria 29981
77 Ga0157345_1000020 3300012498 Bacteria 42602
78 Ga0157373_10001782 3300013100 Bacteria 16369
79 Ga0157373_10005057 3300013100 Bacteria 9906
80 Ga0157373_10006322 3300013100 Bacteria 8849
81 Ga0157373_10011964 3300013100 Bacteria 6375
82 Ga0157373_10015266 3300013100 Bacteria 5614
83 Ga0157371_10001096 3300013102 Bacteria 29365
84 Ga0157371_10007617 3300013102 Bacteria 8733
85 Ga0157371_10072793 3300013102 Bacteria 2433
86 Ga0157371_10127300 3300013102 Bacteria 1812
87 Ga0157370_10015098 3300013104 Bacteria 7869
88 Ga0157370_10047642 3300013104 Bacteria 4108
89 Ga0157370_10256427 3300013104 Bacteria 1617
90 Ga0157369_10004566 3300013105 Bacteria 16275
91 Ga0157369_10055643 3300013105 Bacteria 4270
92 Ga0163162_10000322 3300013306 Bacteria 44081
93 Ga0163162_10010691 3300013306 Bacteria 8927
94 Ga0163162_10317654 3300013306 Bacteria 1690
95 Ga0157372_10002618 3300013307 Bacteria 19476
96 Ga0157372_10028727 3300013307 Bacteria 6071
97 Ga0157375_10001075 3300013308 Bacteria 23675
98 Ga0157375_10010741 3300013308 Bacteria 8070
99 Ga0157375_10041706 3300013308 Bacteria 4434
100 Ga0157375_10111962 3300013308 Bacteria 2829
101 Ga0182008_10002330 3300014497 Bacteria 11961
102 Ga0182008_10003123 3300014497 Bacteria 10136
103 Ga0182008_10019463 3300014497 Bacteria 3503
104 Ga0182008_10043925 3300014497 Bacteria 2224
105 Ga0182008_10181308 3300014497 Bacteria 1066
106 Ga0182006_1001031 3300015261 Bacteria 18153
107 Ga0182006_1070806 3300015261 Bacteria 1294
108 Ga0182006_1076258 3300015261 Bacteria 1232
109 Ga0182007_10001888 3300015262 Bacteria 10932
110 Ga0182007_10009427 3300015262 Bacteria 3935
111 Ga0182005_1000856 3300015265 Bacteria 13546
112 Ga0182005_1002438 3300015265 Bacteria 6647
113 Ga0163161_10001094 3300017792 Bacteria 20507
114 Ga0163161_10001706 3300017792 Bacteria 16121
115 Ga0163161_10004002 3300017792 Bacteria 10315
116 Ga0163161_10010704 3300017792 Bacteria 6352
117 Ga0163161_10109865 3300017792 Bacteria 2060
118 Ga0163161_10168453 3300017792 Bacteria 1673
119 Ga0209435_101810 3300025206 Bacteria 2576
120 Ga0209760_100018 3300025207 Bacteria 172833
121 Ga0209784_100110 3300025224 Bacteria 91931
122 Ga0209566_100131 3300025225 Bacteria 91931
123 Ga0209674_100154 3300025226 Bacteria 91931
124 Ga0209147_100158 3300025229 Bacteria 91931
125 Ga0209563_100133 3300025230 Bacteria 91931
126 Ga0209563_100506 3300025230 Bacteria 13276
127 Ga0207427_100015 3300025231 Bacteria 542133
128 Ga0209437_100027 3300025233 Bacteria 542133
129 Ga0209258_100260 3300025242 Bacteria 91919
130 Ga0209646_1000454 3300025246 Bacteria 21498
131 Ga0209677_100100 3300025253 Bacteria 91931
132 Ga0209759_1007498 3300025256 Bacteria 3503
133 Ga0209233_1000039 3300025261 Bacteria 542133
134 Ga0209565_1013575 3300025263 Bacteria 1903
135 Ga0209130_1031300 3300025284 Bacteria 1092
136 Ga0209676_1000002 3300025292 Bacteria 1732948
137 Ga0209676_1000017 3300025292 Bacteria 643409
138 Ga0209676_1000655 3300025292 Bacteria 49591
139 Ga0209676_1001492 3300025292 Bacteria 21515
140 Ga0209050_1000242 3300025298 Bacteria 118006
141 Ga0209050_1000371 3300025298 Bacteria 85791
142 Ga0209051_1000001 3300025303 Bacteria 1732974
143 Ga0209051_1000234 3300025303 Bacteria 92914
144 Ga0209257_1000167 3300025304 Bacteria 171342
145 Ga0207656_10000161 3300025321 Bacteria 24874
146 Ga0207696_1000023 3300025711 Bacteria 422195
147 Ga0207696_1000075 3300025711 Bacteria 210629
148 Ga0207696_1000147 3300025711 Bacteria 120603
149 Ga0207696_1002068 3300025711 Bacteria 10133
150 Ga0207696_1002953 3300025711 Bacteria 7963
151 Ga0207696_1003863 3300025711 Bacteria 6639
152 Ga0207696_1013955 3300025711 Bacteria 2772
153 Ga0207696_1023621 3300025711 Bacteria 1937
154 Ga0207655_1000528 3300025728 Bacteria 48555
155 Ga0207655_1000536 3300025728 Bacteria 48096
156 Ga0207655_1000646 3300025728 Bacteria 41672
157 Ga0207655_1002183 3300025728 Bacteria 16249
158 Ga0207655_1002208 3300025728 Bacteria 16146
159 Ga0207655_1002899 3300025728 Bacteria 13235
160 Ga0207655_1005354 3300025728 Bacteria 8754
161 Ga0207655_1039321 3300025728 Bacteria 2056
162 Ga0207655_1091714 3300025728 Bacteria 1067
163 Ga0207713_1000009 3300025735 Bacteria 551314
164 Ga0207713_1000870 3300025735 Bacteria 27610
165 Ga0207713_1001103 3300025735 Bacteria 23100
166 Ga0207713_1001848 3300025735 Bacteria 16132
167 Ga0207713_1002127 3300025735 Bacteria 14763
168 Ga0207713_1002273 3300025735 Bacteria 14155
169 Ga0207713_1003746 3300025735 Bacteria 10209
170 Ga0207713_1004431 3300025735 Bacteria 9105
171 Ga0207713_1004670 3300025735 Bacteria 8835
172 Ga0207713_1019506 3300025735 Bacteria 3313
173 Ga0207713_1027004 3300025735 Bacteria 2616
174 Ga0207713_1056251 3300025735 Bacteria 1530
175 Ga0207713_1079246 3300025735 Bacteria 1186
176 Ga0207681_10006256 3300025923 Bacteria 7304
177 Ga0207650_10000874 3300025925 Bacteria 22810
178 Ga0207706_10000566 3300025933 Bacteria 39267
179 Ga0207709_10000014 3300025935 Bacteria 526302
180 Ga0207709_10003534 3300025935 Bacteria 9244
181 Ga0207709_10008296 3300025935 Bacteria 5754
182 Ga0207709_10208824 3300025935 Bacteria 1400
183 Ga0207709_10473702 3300025935 Bacteria 972
184 Ga0207712_10008378 3300025961 Bacteria 6532
185 Ga0207712_10152521 3300025961 Bacteria 1786
186 Ga0207640_10200293 3300025981 Bacteria 1513
187 Ga0209389_1000013 3300027296 Bacteria 208890
188 Ga0209371_1000008 3300027312 Bacteria 1024606
189 Ga0209371_1000040 3300027312 Bacteria 340804
190 Ga0209371_1001433 3300027312 Bacteria 16248
191 Ga0207428_10218501 3300027907 Bacteria 1429
192 Ga0268256_1000009 3300030500 Bacteria 1022625
193 Ga0268256_1000041 3300030500 Bacteria 340725
194 Ga0268256_1001221 3300030500 Bacteria 16248
195 Ga0307511_10136944 3300030521 Bacteria 1454
196 Ga0307511_10142830 3300030521 Bacteria 1400
197 Ga0307510_10001978 3300033180 Bacteria 23077
198 Ga0237819_01806 3300038705 Bacteria 4990
199 Ga0237819_01874 3300038705 Bacteria 4831
200 Ga0439438_000436 3300041405 Bacteria 18989
201 Ga0439438_006616 3300041405 Bacteria 4061
202 Ga0439447_000052 3300041407 Bacteria 41434
203 Ga0439466_0000139 3300041411 Bacteria 28756
204 Ga0439466_0000223 3300041411 Bacteria 22390
205 Ga0439466_0002281 3300041411 Bacteria 7522
206 Ga0439466_0007658 3300041411 Bacteria 4078
207 Ga0439466_0060409 3300041411 Bacteria 1222
208 Ga0439432_000531 3300042006 Bacteria 14205
209 Ga0439432_006397 3300042006 Bacteria 4209
210 Ga0439432_009910 3300042006 Bacteria 3313
211 Ga0439432_013553 3300042006 Bacteria 2771
212 Ga0439432_019079 3300042006 Bacteria 2287
213 Ga0439432_025705 3300042006 Bacteria 1930
214 Ga0439451_004371 3300042009 Bacteria 2870
215 Ga0439452_000316 3300042010 Bacteria 30528
216 Ga0439452_005339 3300042010 Bacteria 4141
217 Ga0439452_016850 3300042010 Bacteria 1976
218 Ga0439456_000028 3300042013 Bacteria 53976
219 Ga0439456_001059 3300042013 Bacteria 5483
220 Ga0439463_000157 3300042016 Bacteria 17433
221 Ga0439463_004300 3300042016 Bacteria 3571
222 Ga0450911_000287 3300042115 Bacteria 18551
223 Ga0450919_001245 3300042121 Bacteria 3326
224 Ga0450922_000779 3300042124 Bacteria 3264
225 Ga0450902_000061 3300042137 Bacteria 10505
226 Ga0450903_001763 3300042138 Bacteria 3960
227 Ga0450904_000506 3300042139 Bacteria 7559
228 Ga0450904_006997 3300042139 Bacteria 1124
229 Ga0450906_009928 3300042145 Bacteria 1807
230 Ga0450907_001934 3300042146 Bacteria 4184
231 Ga0450910_000436 3300042147 Bacteria 4920
232 Ga0439446_0001285 3300042156 Bacteria 5638
233 Ga0450908_003213 3300042184 Bacteria 3180
234 Ga0450909_000116 3300042185 Bacteria 7990
235 Ga0450909_008252 3300042185 Bacteria 1513
236 Ga0439434_0012295 3300042435 Bacteria 2533
237 Ga0439460_0002507 3300042461 Bacteria 4433
238 Ga0450901_000183 3300042533 Bacteria 7353
239 Ga0450901_001759 3300042533 Bacteria 2434
240 Ga0439440_0001113 3300042993 Bacteria 4800
241 Ga0439440_0006485 3300042993 Bacteria 2357
242 Ga0495617_006246 3300046452 Bacteria 4188
243 Ga0495617_013840 3300046452 Bacteria 2743
244 Ga0495617_067785 3300046452 Bacteria 1174
245 Ga0495627_000045 3300046453 Bacteria 180228
246 Ga0495627_000416 3300046453 Bacteria 37635
247 Ga0495627_000668 3300046453 Bacteria 26397
248 Ga0495627_001073 3300046453 Bacteria 17997
249 Ga0495627_001416 3300046453 Bacteria 14126
250 Ga0495627_012678 3300046453 Bacteria 2985
251 Ga0495627_016085 3300046453 Bacteria 2570
252 Ga0495627_069166 3300046453 Bacteria 1033
253 Ga0495592_0059701 3300046454 Bacteria 2807
254 Ga0495590_0000889 3300046457 Bacteria 13399
255 Ga0495590_0124108 3300046457 Bacteria 926
256 Ga0495591_000008 3300046458 Bacteria 353558
257 Ga0495591_000304 3300046458 Bacteria 45011
258 Ga0495591_000386 3300046458 Bacteria 37363
259 Ga0495591_000762 3300046458 Bacteria 23270
260 Ga0495591_009090 3300046458 Bacteria 3985
261 Ga0495591_011142 3300046458 Bacteria 3424
262 Ga0495591_012741 3300046458 Bacteria 3112
263 Ga0495591_025935 3300046458 Bacteria 1830
264 Ga0495591_038775 3300046458 Bacteria 1369
265 Ga0495638_0001009 3300046460 Bacteria 28092
266 Ga0495638_0003439 3300046460 Bacteria 12468
267 Ga0495638_0005776 3300046460 Bacteria 9112
268 Ga0495638_0017417 3300046460 Bacteria 4789
269 Ga0495638_0023588 3300046460 Bacteria 4021
270 Ga0495638_0029294 3300046460 Bacteria 3550
271 Ga0495638_0040953 3300046460 Bacteria 2933
272 Ga0495638_0115014 3300046460 Bacteria 1595
273 Ga0495653_0002377 3300046463 Bacteria 14966
274 Ga0495653_0026843 3300046463 Bacteria 4613
275 Ga0495650_0001880 3300046471 Bacteria 18697
276 Ga0495650_0005738 3300046471 Bacteria 7927
277 Ga0495650_0012408 3300046471 Bacteria 4585
278 Ga0495650_0043172 3300046471 Bacteria 1915
279 Ga0495605_0000506 3300046474 Bacteria 33459
280 Ga0495605_0000868 3300046474 Bacteria 20936
281 Ga0495605_0015026 3300046474 Bacteria 4221
282 Ga0495605_0038091 3300046474 Bacteria 2414
283 Ga0495605_0192224 3300046474 Bacteria 892
284 Ga0495639_0186387 3300046475 Bacteria 1012
285 Ga0495584_0001134 3300046491 Bacteria 16486
286 Ga0495584_0005076 3300046491 Bacteria 6993
287 Ga0495584_0025743 3300046491 Bacteria 2982
288 Ga0495584_0048763 3300046491 Bacteria 2134
289 Ga0495584_0081724 3300046491 Bacteria 1626
290 Ga0495584_0098712 3300046491 Bacteria 1475
291 Ga0495585_0000634 3300046492 Bacteria 32431
292 Ga0495585_0001035 3300046492 Bacteria 23112
293 Ga0495585_0004247 3300046492 Bacteria 9337
294 Ga0495585_0004463 3300046492 Bacteria 9071
295 Ga0495585_0026202 3300046492 Bacteria 3331
296 Ga0495585_0034370 3300046492 Bacteria 2865
297 Ga0495585_0131920 3300046492 Bacteria 1314
298 Ga0495585_0213027 3300046492 Bacteria 978
299 Ga0495596_0000005 3300046500 Bacteria 163644
300 Ga0495596_0008642 3300046500 Bacteria 4519
301 Ga0495596_0055996 3300046500 Bacteria 1540
302 Ga0495607_0001664 3300046501 Bacteria 19233
303 Ga0495607_0002482 3300046501 Bacteria 14981
304 Ga0495607_0006109 3300046501 Bacteria 8519
305 Ga0495607_0006405 3300046501 Bacteria 8291
306 Ga0495607_0027093 3300046501 Bacteria 3549
307 Ga0495607_0133865 3300046501 Bacteria 1286
308 Ga0495583_0001210 3300046506 Bacteria 27537
309 Ga0495583_0002470 3300046506 Bacteria 15744
310 Ga0495606_0000151 3300046507 Bacteria 119548
311 Ga0495606_0001292 3300046507 Bacteria 34691
312 Ga0495606_0003686 3300046507 Bacteria 16022
313 Ga0495606_0003777 3300046507 Bacteria 15738
314 Ga0495606_0004634 3300046507 Bacteria 13605
315 Ga0495606_0010693 3300046507 Bacteria 7576
316 Ga0495606_0017258 3300046507 Bacteria 5466
317 Ga0495606_0041629 3300046507 Bacteria 3079
318 Ga0495606_0042359 3300046507 Bacteria 3045
319 Ga0495606_0060775 3300046507 Bacteria 2419
320 Ga0495610_0000727 3300046512 Bacteria 31278
321 Ga0495610_0000803 3300046512 Bacteria 29467
322 Ga0495610_0001563 3300046512 Bacteria 20169
323 Ga0495610_0005264 3300046512 Bacteria 9257
324 Ga0495610_0013936 3300046512 Bacteria 4750
325 Ga0495610_0019009 3300046512 Bacteria 3859
326 Ga0495610_0051575 3300046512 Bacteria 2001
327 Ga0495610_0125398 3300046512 Bacteria 1120
328 Ga0495616_0000305 3300046513 Bacteria 39363
329 Ga0495616_0006820 3300046513 Bacteria 6881
330 Ga0495616_0008889 3300046513 Bacteria 5905
331 Ga0495616_0011320 3300046513 Bacteria 5120
332 Ga0495616_0020283 3300046513 Bacteria 3618
333 Ga0495616_0025256 3300046513 Bacteria 3176
334 Ga0495620_0000004 3300046515 Bacteria 344148
335 Ga0495620_0000195 3300046515 Bacteria 46532
336 Ga0495620_0001899 3300046515 Bacteria 12260
337 Ga0495620_0007913 3300046515 Bacteria 5735
338 Ga0495620_0014826 3300046515 Bacteria 3950
339 Ga0495620_0024803 3300046515 Bacteria 2847
340 Ga0495620_0042734 3300046515 Bacteria 1977
341 Ga0495620_0093198 3300046515 Bacteria 1206
342 Ga0495620_0099798 3300046515 Bacteria 1158
343 Ga0495630_0033097 3300046517 Bacteria 3854
344 Ga0495631_0000246 3300046518 Bacteria 37428
345 Ga0495631_0001016 3300046518 Bacteria 17424
346 Ga0495631_0002699 3300046518 Bacteria 9857
347 Ga0495631_0003563 3300046518 Bacteria 8508
348 Ga0495631_0013866 3300046518 Bacteria 3901
349 Ga0495631_0039306 3300046518 Bacteria 2100
350 Ga0495631_0079886 3300046518 Bacteria 1411
351 Ga0495632_0000257 3300046519 Bacteria 52817
352 Ga0495632_0001277 3300046519 Bacteria 21324
353 Ga0495632_0001973 3300046519 Bacteria 16301
354 Ga0495632_0002482 3300046519 Bacteria 14007
355 Ga0495632_0004092 3300046519 Bacteria 10058
356 Ga0495632_0004909 3300046519 Bacteria 8963
357 Ga0495632_0005501 3300046519 Bacteria 8359
358 Ga0495632_0007018 3300046519 Bacteria 7144
359 Ga0495632_0020393 3300046519 Bacteria 3589
360 Ga0495632_0032059 3300046519 Bacteria 2710
361 Ga0495632_0061310 3300046519 Bacteria 1826
362 Ga0495632_0158227 3300046519 Bacteria 1044
363 Ga0495637_0000584 3300046520 Bacteria 25967
364 Ga0495637_0000885 3300046520 Bacteria 19343
365 Ga0495637_0004189 3300046520 Bacteria 7488
366 Ga0495637_0008113 3300046520 Bacteria 5169
367 Ga0495637_0020597 3300046520 Bacteria 3032
368 Ga0495637_0025576 3300046520 Bacteria 2658
369 Ga0495643_0000772 3300046522 Bacteria 35775
370 Ga0495643_0000872 3300046522 Bacteria 32201
371 Ga0495643_0003871 3300046522 Bacteria 10765
372 Ga0495643_0023683 3300046522 Bacteria 3488
373 Ga0495643_0030773 3300046522 Bacteria 2993
374 Ga0495643_0036796 3300046522 Bacteria 2687
375 Ga0495643_0105489 3300046522 Bacteria 1439
376 Ga0495643_0106198 3300046522 Bacteria 1433
377 Ga0495643_0128205 3300046522 Bacteria 1276
378 Ga0495644_0001042 3300046523 Bacteria 11548
379 Ga0495644_0007461 3300046523 Bacteria 4213
380 Ga0495644_0109522 3300046523 Bacteria 1047
381 Ga0495648_0000805 3300046524 Bacteria 33238
382 Ga0495648_0000926 3300046524 Bacteria 30528
383 Ga0495648_0001936 3300046524 Bacteria 19720
384 Ga0495648_0005797 3300046524 Bacteria 10185
385 Ga0495648_0007377 3300046524 Bacteria 8807
386 Ga0495648_0016469 3300046524 Bacteria 5331
387 Ga0495648_0023682 3300046524 Bacteria 4197
388 Ga0495648_0044879 3300046524 Bacteria 2755
389 Ga0495648_0092411 3300046524 Bacteria 1689
390 Ga0495648_0114316 3300046524 Bacteria 1462
391 Ga0495648_0118476 3300046524 Bacteria 1427
392 Ga0495648_0183972 3300046524 Bacteria 1059
393 Ga0495666_0015615 3300046526 Bacteria 3780
394 Ga0495654_0000541 3300046530 Bacteria 30486
395 Ga0495654_0000762 3300046530 Bacteria 24922
396 Ga0495654_0001191 3300046530 Bacteria 18496
397 Ga0495654_0002413 3300046530 Bacteria 12050
398 Ga0495654_0003048 3300046530 Bacteria 10433
399 Ga0495654_0004426 3300046530 Bacteria 8337
400 Ga0495654_0013141 3300046530 Bacteria 4433
401 Ga0495654_0013534 3300046530 Bacteria 4364
402 Ga0495654_0038168 3300046530 Bacteria 2403
403 Ga0495654_0077194 3300046530 Bacteria 1568
404 Ga0495654_0107210 3300046530 Bacteria 1278
405 Ga0495587_0098472 3300046536 Bacteria 1685
406 Ga0495609_0001455 3300046538 Bacteria 15706
407 Ga0495609_0001524 3300046538 Bacteria 15257
408 Ga0495609_0030376 3300046538 Bacteria 2459
409 Ga0495597_0002187 3300046542 Bacteria 12846
410 Ga0495597_0002793 3300046542 Bacteria 10733
411 Ga0495597_0002953 3300046542 Bacteria 10312
412 Ga0495597_0010000 3300046542 Bacteria 4659
413 Ga0495597_0015415 3300046542 Bacteria 3619
414 Ga0495597_0026044 3300046542 Bacteria 2688
415 Ga0495597_0039628 3300046542 Bacteria 2109
416 Ga0495597_0085954 3300046542 Bacteria 1339
417 Ga0495622_0001296 3300046557 Bacteria 12824
418 Ga0495622_0074025 3300046557 Bacteria 1571
419 Ga0495622_0099209 3300046557 Bacteria 1335
420 Ga0495633_0003346 3300046558 Bacteria 10758
421 Ga0495633_0036566 3300046558 Bacteria 2352
422 Ga0495633_0071493 3300046558 Bacteria 1618
423 Ga0495656_0081475 3300046615 Bacteria 1461
424 Ga0495668_0000001 3300046616 Bacteria 1013420
425 Ga0495668_0001233 3300046616 Bacteria 25707
426 Ga0495668_0001554 3300046616 Bacteria 21767
427 Ga0495634_0009399 3300046642 Bacteria 7212
428 Ga0495611_0000125 3300046648 Bacteria 53878
429 Ga0495611_0007252 3300046648 Bacteria 4710
430 Ga0495625_0001657 3300046660 Bacteria 26120
431 Ga0495625_0002467 3300046660 Bacteria 19993
432 Ga0495625_0012019 3300046660 Bacteria 7026
433 Ga0495625_0018936 3300046660 Bacteria 5358
434 Ga0495625_0035562 3300046660 Bacteria 3670
435 Ga0495625_0041100 3300046660 Bacteria 3367
436 Ga0495625_0087253 3300046660 Bacteria 2163
437 Ga0495625_0142758 3300046660 Bacteria 1614
438 Ga0495625_0145884 3300046660 Bacteria 1593
439 Ga0495635_0351445 3300046663 Bacteria 983
440 Ga0495661_0000290 3300046665 Bacteria 56929
441 Ga0495661_0002265 3300046665 Bacteria 14884
442 Ga0495661_0012701 3300046665 Bacteria 5684
443 Ga0495661_0039592 3300046665 Bacteria 2928
444 Ga0495661_0040254 3300046665 Bacteria 2900
445 Ga0495661_0065139 3300046665 Bacteria 2147
446 Ga0495661_0073828 3300046665 Bacteria 1986
447 Ga0495661_0099208 3300046665 Bacteria 1642
448 Ga0495661_0106529 3300046665 Bacteria 1568
449 Ga0495588_0052164 3300046674 Bacteria 2108
450 Ga0495657_0017260 3300046675 Bacteria 5244
451 Ga0495623_0102831 3300046679 Bacteria 1739
452 Ga0495646_0007618 3300046680 Bacteria 6880
453 Ga0495613_0017991 3300046689 Bacteria 5267
454 Ga0495613_0299910 3300046689 Bacteria 1112
455 Ga0495624_0001502 3300046690 Bacteria 18056
456 Ga0495624_0184295 3300046690 Bacteria 1271
457 Ga0495670_0000483 3300046691 Bacteria 18876
458 Ga0495670_0020096 3300046691 Bacteria 3291
459 Ga0495671_0001423 3300046692 Bacteria 16090
460 Ga0495671_0006133 3300046692 Bacteria 6975
461 Ga0495671_0036429 3300046692 Bacteria 2491
462 Ga0495671_0166920 3300046692 Bacteria 1070
463 Ga0495649_0001843 3300046694 Bacteria 15542
464 Ga0495649_0002199 3300046694 Bacteria 13927
465 Ga0495649_0024288 3300046694 Bacteria 3380
466 Ga0495649_0038158 3300046694 Bacteria 2636
467 Ga0495649_0055177 3300046694 Bacteria 2147
468 Ga0495649_0074186 3300046694 Bacteria 1822
469 Ga0495649_0258749 3300046694 Bacteria 892
470 Ga0495589_0001578 3300046794 Bacteria 13095
471 Ga0495589_0001834 3300046794 Bacteria 12062
472 Ga0495589_0003110 3300046794 Bacteria 9080
473 Ga0495589_0004094 3300046794 Bacteria 7806
474 Ga0495589_0009111 3300046794 Bacteria 5159
475 Ga0495589_0030456 3300046794 Bacteria 2717
476 Ga0495600_0004909 3300046809 Bacteria 8031
477 Ga0495660_0000704 3300046810 Bacteria 25660
478 Ga0495660_0001292 3300046810 Bacteria 17331
479 Ga0495660_0004973 3300046810 Bacteria 8001
480 Ga0495660_0006842 3300046810 Bacteria 6714
481 Ga0495660_0006966 3300046810 Bacteria 6661
482 Ga0495660_0010111 3300046810 Bacteria 5486
483 Ga0495660_0027899 3300046810 Bacteria 3192
484 Ga0495660_0066273 3300046810 Bacteria 1926
485 Ga0495660_0069059 3300046810 Bacteria 1878
486 Ga0495660_0070316 3300046810 Bacteria 1858
487 Ga0495660_0078550 3300046810 Bacteria 1734
488 Ga0495604_0005745 3300047317 Bacteria 9839
489 Ga0495672_0000261 3300047320 Bacteria 73207
490 Ga0495672_0001089 3300047320 Bacteria 27562
491 Ga0495672_0002321 3300047320 Bacteria 17641
492 Ga0495672_0002829 3300047320 Bacteria 15442
493 Ga0495672_0003744 3300047320 Bacteria 12824
494 Ga0495672_0188394 3300047320 Bacteria 1039
495 Ga0495676_0000534 3300047321 Bacteria 31124
496 Ga0495676_0038421 3300047321 Bacteria 3975
497 Ga0495680_0027059 3300047322 Bacteria 4717
498 Ga0495680_0038538 3300047322 Bacteria 3818
499 Ga0495683_0008190 3300047323 Bacteria 5607
500 Ga0495683_0015717 3300047323 Bacteria 3930
501 Ga0495683_0020331 3300047323 Bacteria 3424
502 Ga0495675_0109875 3300047444 Bacteria 1721
503 Ga0495679_000353 3300047446 Bacteria 35879
504 Ga0495679_001241 3300047446 Bacteria 15133
505 Ga0495679_001477 3300047446 Bacteria 13301
506 Ga0495679_004113 3300047446 Bacteria 6802
507 Ga0495679_004706 3300047446 Bacteria 6206
508 Ga0495679_004732 3300047446 Bacteria 6180
509 Ga0495679_015307 3300047446 Bacteria 2810
510 Ga0495673_0001095 3300047469 Bacteria 23462
511 Ga0495673_0004049 3300047469 Bacteria 9341
512 Ga0495673_0004619 3300047469 Bacteria 8569
513 Ga0495673_0004635 3300047469 Bacteria 8555
514 Ga0495673_0005859 3300047469 Bacteria 7345
515 Ga0495673_0006172 3300047469 Bacteria 7096
516 Ga0495673_0033919 3300047469 Bacteria 2363
517 Ga0495673_0054757 3300047469 Bacteria 1733
518 Ga0495673_0161362 3300047469 Bacteria 860
519 Ga0495673_0211083 3300047469 Bacteria 722
520 Ga0495681_0000134 3300047470 Bacteria 63782
521 Ga0495681_0000627 3300047470 Bacteria 26913
522 Ga0495681_0000702 3300047470 Bacteria 25574
523 Ga0495681_0001761 3300047470 Bacteria 15954
524 Ga0495681_0002828 3300047470 Bacteria 12267
525 Ga0495681_0005004 3300047470 Bacteria 8934
526 Ga0495681_0005151 3300047470 Bacteria 8800
527 Ga0495681_0008998 3300047470 Bacteria 6197
528 Ga0495681_0035900 3300047470 Bacteria 2457
529 Ga0495681_0094913 3300047470 Bacteria 1311
530 Ga0495684_0032410 3300047471 Bacteria 4012
531 Ga0495684_0185889 3300047471 Bacteria 1538
532 Ga0495686_0002026 3300047472 Bacteria 19990
533 Ga0495686_0003274 3300047472 Bacteria 14169
534 Ga0495686_0009606 3300047472 Bacteria 6948
535 Ga0495686_0015626 3300047472 Bacteria 5176
536 Ga0495593_0015599 3300047673 Bacteria 4299
537 Ga0495602_0003788 3300048088 Bacteria 15723
538 Ga0495626_0000040 3300048091 Bacteria 172784
539 Ga0495626_0000584 3300048091 Bacteria 36132
540 Ga0495626_0000833 3300048091 Bacteria 27661
541 Ga0495626_0009253 3300048091 Bacteria 5331
542 Ga0495626_0010156 3300048091 Bacteria 5050
543 Ga0495626_0015507 3300048091 Bacteria 3897
544 Ga0496101_0363809 3300048904 Bacteria 1137
545 Ga0496102_0035552 3300048905 Bacteria 4485
546 Ga0496110_0065647 3300048913 Bacteria 3209
547 Ga0496110_0126291 3300048913 Bacteria 2308
548 Ga0496114_0003645 3300048917 Bacteria 11845
549 Ga0496114_0013404 3300048917 Bacteria 6572
550 Ga0496116_0000195 3300048919 Bacteria 120438
551 Ga0496116_0000514 3300048919 Bacteria 52327
552 Ga0496116_0001103 3300048919 Bacteria 32356
553 Ga0496116_0003657 3300048919 Bacteria 15096
554 Ga0496116_0005493 3300048919 Bacteria 11726
555 Ga0496116_0019965 3300048919 Bacteria 5108
556 Ga0496117_0000876 3300048920 Bacteria 46421
557 Ga0496117_0000916 3300048920 Bacteria 45120
558 Ga0496117_0001404 3300048920 Bacteria 34972
559 Ga0496117_0001529 3300048920 Bacteria 33047
560 Ga0496117_0004246 3300048920 Bacteria 15994
561 Ga0496117_0004562 3300048920 Bacteria 15166
562 Ga0496117_0034064 3300048920 Bacteria 3844
563 Ga0496118_0003330 3300048921 Bacteria 20329
564 Ga0496118_0005213 3300048921 Bacteria 14867
565 Ga0496118_0006140 3300048921 Bacteria 13333
566 Ga0496118_0009033 3300048921 Bacteria 10161
567 Ga0496118_0014087 3300048921 Bacteria 7504
568 Ga0496118_0031107 3300048921 Bacteria 4434
569 Ga0496119_0000046 3300048922 Bacteria 190003
570 Ga0496119_0005612 3300048922 Bacteria 11932
571 Ga0496120_0000485 3300048923 Bacteria 62083
572 Ga0496120_0003942 3300048923 Bacteria 12927
573 Ga0496121_0000955 3300048924 Bacteria 52253
574 Ga0496121_0004252 3300048924 Bacteria 19463
575 Ga0496121_0006324 3300048924 Bacteria 14771
576 Ga0496122_0002553 3300048925 Bacteria 25577
577 Ga0496122_0005026 3300048925 Bacteria 15997
578 Ga0496122_0041709 3300048925 Bacteria 3623
579 Ga0496122_0059734 3300048925 Bacteria 2813
580 Ga0496122_0140262 3300048925 Bacteria 1513
581 Ga0496123_0000779 3300048926 Bacteria 51646
582 Ga0496123_0001630 3300048926 Bacteria 30236
583 Ga0496123_0001656 3300048926 Bacteria 29930
584 Ga0496123_0005537 3300048926 Bacteria 12673
585 Ga0496123_0020427 3300048926 Bacteria 5181
586 Ga0496123_0060411 3300048926 Bacteria 2444
587 Ga0496123_0097300 3300048926 Bacteria 1725
588 Ga0496123_0100764 3300048926 Bacteria 1681
589 Ga0496123_0226756 3300048926 Bacteria 938
590 Ga0496123_0291032 3300048926 Bacteria 784
591 Ga0496124_0000948 3300048927 Bacteria 46382
592 Ga0496124_0001162 3300048927 Bacteria 41251
593 Ga0496124_0003970 3300048927 Bacteria 17635
594 Ga0496124_0007698 3300048927 Bacteria 11395
595 Ga0496124_0011900 3300048927 Bacteria 8659
596 Ga0496124_0081023 3300048927 Bacteria 2670
597 Ga0496125_0000613 3300048928 Bacteria 60403
598 Ga0496125_0000915 3300048928 Bacteria 46451
599 Ga0496125_0003508 3300048928 Bacteria 18941
600 Ga0496125_0009131 3300048928 Bacteria 10257
601 Ga0496125_0016695 3300048928 Bacteria 7039
602 Ga0496125_0029680 3300048928 Bacteria 4909
603 Ga0496125_0031858 3300048928 Bacteria 4691
604 Ga0496125_0033283 3300048928 Bacteria 4564
605 Ga0496125_0119446 3300048928 Bacteria 1885
606 Ga0496126_0000136 3300048929 Bacteria 167497
607 Ga0496126_0014058 3300048929 Bacteria 8109
608 Ga0496126_0044646 3300048929 Bacteria 4079
609 Ga0495678_002005 3300049459 Bacteria 14612
610 Ga0495678_002092 3300049459 Bacteria 14166
611 Ga0495678_003467 3300049459 Bacteria 9764
612 Ga0495678_004604 3300049459 Bacteria 7923
613 Ga0495678_007405 3300049459 Bacteria 5693
614 Ga0495678_012635 3300049459 Bacteria 3996
615 Ga0495678_013636 3300049459 Bacteria 3806
616 Ga0495678_018169 3300049459 Bacteria 3167
617 Ga0495678_067312 3300049459 Bacteria 1323
618 Ga0495682_0000468 3300049460 Bacteria 27907
619 Ga0501032_0282002 3300049569 Unclassified 1075
620 Ga0501033_0157241 3300049570 Unclassified 1637
621 Ga0501034_0000045 3300049571 Bacteria 226186
622 Ga0501034_0331784 3300049571 Bacteria 1452
623 Ga0501036_0003637 3300049572 Bacteria 12326
624 Ga0501037_0017244 3300049573 Bacteria 5316
625 Ga0501038_0041049 3300049574 Bacteria 4036
626 Ga0501043_0017386 3300049579 Bacteria 5638
627 Ga0501048_0000844 3300049582 Bacteria 22558
628 Ga0501067_0001632 3300049583 Bacteria 12314
629 Ga0501068_0000757 3300049584 Bacteria 16615
630 Ga0501070_0048223 3300049586 Bacteria 3538
631 Ga0501073_0007698 3300049589 Bacteria 7998
632 Ga0501074_0272824 3300049590 Unclassified 1202
633 Ga0501076_0260410 3300049592 Bacteria 1420
634 Ga0501080_0115018 3300049742 Bacteria 2494
635 Ga0501035_0131914 3300049822 Unclassified 2177
636 Ga0501044_0045341 3300049823 Bacteria 4555
637 Ga0501044_0445890 3300049823 Unclassified 1201
638 Ga0501045_0008589 3300049824 Bacteria 7119
639 Ga0500643_000653 3300053087 Bacteria 23303
640 Ga0500658_0196628 3300053134 Bacteria 921
641 Ga0500659_0002181 3300053135 Bacteria 11930
642 Ga0500568_0121126 3300053139 Bacteria 975
643 Ga0500586_075323 3300053145 Bacteria 1182
644 Ga0500634_0000719 3300053161 Bacteria 11396
645 Ga0501084_0033677 3300054114 Bacteria 4285

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046530 Ga0495654_0077194 Ga0495654_0077194_17_655 212
2 3300047469 Ga0495673_0211083 Ga0495673_0211083_61_699 212
3 3300048926 Ga0496123_0291032 Ga0496123_0291032_12_680 221
4 3300038705 Ga0237819_01874 Ga0237819_01874_2287_3048 223
5 3300048926 Ga0496123_0226756 Ga0496123_0226756_257_928 223
6 3300049572 Ga0501036_0003637 Ga0501036_0003637_26_733 229
7 3300047469 Ga0495673_0161362 Ga0495673_0161362_27_719 230
8 3300046492 Ga0495585_0131920 Ga0495585_0131920_23_718 231
9 3300048904 Ga0496101_0363809 Ga0496101_0363809_10_744 233
10 3300003781 Ga0055536_1006374 Ga0055536_10063744 234
11 3300025292 Ga0209676_1001492 Ga0209676_10014927 234
12 3300048926 Ga0496123_0097300 Ga0496123_0097300_956_1696 234
13 3300048913 Ga0496110_0065647 Ga0496110_0065647_674_1450 235
14 3300048926 Ga0496123_0060411 Ga0496123_0060411_1569_2345 235
15 3300048927 Ga0496124_0003970 Ga0496124_0003970_2425_3201 235
16 3300048928 Ga0496125_0003508 Ga0496125_0003508_5581_6357 235
17 3300048929 Ga0496126_0044646 Ga0496126_0044646_2014_2790 235
18 3300009011 Ga0105251_10002283 Ga0105251_1000228312 236
19 3300025735 Ga0207713_1004670 Ga0207713_100467010 236
20 iso_pu_bacteria 3007718800 3007724294 236
21 3300013308 Ga0157375_10041706 Ga0157375_100417062 238
22 3300009011 Ga0105251_10110737 Ga0105251_101107371 240
23 3300009553 Ga0105249_10010848 Ga0105249_100108483 240
24 3300046458 Ga0495591_000386 Ga0495591_000386_27175_27897 240
25 3300046524 Ga0495648_0001936 Ga0495648_0001936_5274_5996 240
26 3300046616 Ga0495668_0000001 Ga0495668_0000001_119846_120604 241
27 3300053134 Ga0500658_0196628 Ga0500658_0196628_59_817 241
28 3300046507 Ga0495606_0041629 Ga0495606_0041629_1041_1772 243
29 3300046515 Ga0495620_0001899 Ga0495620_0001899_6167_6898 243
30 3300046518 Ga0495631_0003563 Ga0495631_0003563_3620_4351 243
31 3300047446 Ga0495679_000353 Ga0495679_000353_27164_27895 243
32 3300047446 Ga0495679_001477 Ga0495679_001477_6872_7603 243
33 3300048927 Ga0496124_0081023 Ga0496124_0081023_121_855 243
34 3300009011 Ga0105251_10000003 Ga0105251_10000003245 244
35 3300009092 Ga0105250_10000160 Ga0105250_1000016048 244
36 3300025711 Ga0207696_1000075 Ga0207696_100007549 244
37 3300025735 Ga0207713_1000009 Ga0207713_100000944 244
38 3300046507 Ga0495606_0010693 Ga0495606_0010693_4865_5599 244
39 3300046689 Ga0495613_0299910 Ga0495613_0299910_209_943 244
40 3300048919 Ga0496116_0000195 Ga0496116_0000195_100750_101517 244
41 3300048920 Ga0496117_0034064 Ga0496117_0034064_500_1267 244
42 3300048921 Ga0496118_0014087 Ga0496118_0014087_1361_2128 244
43 3300048926 Ga0496123_0001656 Ga0496123_0001656_10242_11009 244
44 3300048928 Ga0496125_0009131 Ga0496125_0009131_6831_7598 244
45 3300048929 Ga0496126_0000136 Ga0496126_0000136_76591_77358 244
46 3300009011 Ga0105251_10009671 Ga0105251_100096718 245
47 3300009092 Ga0105250_10001304 Ga0105250_1000130410 245
48 3300013306 Ga0163162_10010691 Ga0163162_100106917 245
49 3300013308 Ga0157375_10010741 Ga0157375_100107416 245
50 3300014497 Ga0182008_10019463 Ga0182008_100194632 245
51 3300015261 Ga0182006_1001031 Ga0182006_100103115 245
52 3300015262 Ga0182007_10009427 Ga0182007_100094273 245
53 3300041405 Ga0439438_000436 Ga0439438_000436_6064_6801 245
54 3300041405 Ga0439438_006616 Ga0439438_006616_424_1161 245
55 3300041407 Ga0439447_000052 Ga0439447_000052_11217_11954 245
56 3300041411 Ga0439466_0000139 Ga0439466_0000139_19416_20153 245
57 3300041411 Ga0439466_0002281 Ga0439466_0002281_3827_4564 245
58 3300042006 Ga0439432_009910 Ga0439432_009910_1679_2416 245
59 3300042006 Ga0439432_013553 Ga0439432_013553_1297_2034 245
60 3300042006 Ga0439432_019079 Ga0439432_019079_511_1248 245
61 3300042009 Ga0439451_004371 Ga0439451_004371_566_1303 245
62 3300042010 Ga0439452_000316 Ga0439452_000316_28750_29487 245
63 3300042010 Ga0439452_005339 Ga0439452_005339_1511_2248 245
64 3300042013 Ga0439456_001059 Ga0439456_001059_2765_3502 245
65 3300042016 Ga0439463_004300 Ga0439463_004300_70_807 245
66 3300042115 Ga0450911_000287 Ga0450911_000287_5928_6665 245
67 3300042121 Ga0450919_001245 Ga0450919_001245_1753_2490 245
68 3300042124 Ga0450922_000779 Ga0450922_000779_1906_2643 245
69 3300042138 Ga0450903_001763 Ga0450903_001763_2124_2861 245
70 3300042139 Ga0450904_006997 Ga0450904_006997_265_1002 245
71 3300042145 Ga0450906_009928 Ga0450906_009928_264_1001 245
72 3300042146 Ga0450907_001934 Ga0450907_001934_1613_2350 245
73 3300042147 Ga0450910_000436 Ga0450910_000436_4025_4762 245
74 3300042156 Ga0439446_0001285 Ga0439446_0001285_1728_2465 245
75 3300042185 Ga0450909_000116 Ga0450909_000116_1153_1890 245
76 3300042185 Ga0450909_008252 Ga0450909_008252_140_877 245
77 3300042435 Ga0439434_0012295 Ga0439434_0012295_724_1461 245
78 3300042461 Ga0439460_0002507 Ga0439460_0002507_807_1544 245
79 3300042993 Ga0439440_0001113 Ga0439440_0001113_967_1704 245
80 3300046506 Ga0495583_0001210 Ga0495583_0001210_15855_16592 245
81 3300046530 Ga0495654_0000762 Ga0495654_0000762_11095_11832 245
82 3300048913 Ga0496110_0126291 Ga0496110_0126291_1451_2188 245
83 3300048924 Ga0496121_0004252 Ga0496121_0004252_1905_2642 245
84 3300009036 Ga0105244_10001397 Ga0105244_100013978 246
85 3300009148 Ga0105243_10000258 Ga0105243_1000025819 246
86 3300011119 Ga0105246_10000161 Ga0105246_1000016117 246
87 3300038705 Ga0237819_01806 Ga0237819_01806_2507_3247 246
88 3300046474 Ga0495605_0000506 Ga0495605_0000506_7220_7963 246
89 3300046507 Ga0495606_0000151 Ga0495606_0000151_61235_61978 246
90 3300046665 Ga0495661_0012701 Ga0495661_0012701_4129_4872 246
91 3300047469 Ga0495673_0005859 Ga0495673_0005859_4258_5001 246
92 3300048905 Ga0496102_0035552 Ga0496102_0035552_255_998 246
93 3300046453 Ga0495627_000045 Ga0495627_000045_54581_55354 247
94 3300046518 Ga0495631_0000246 Ga0495631_0000246_22287_23060 247
95 3300046519 Ga0495632_0001277 Ga0495632_0001277_14161_14934 247
96 3300046530 Ga0495654_0001191 Ga0495654_0001191_3964_4737 247
97 3300047320 Ga0495672_0001089 Ga0495672_0001089_22010_22783 247
98 3300053087 Ga0500643_000653 Ga0500643_000653_11504_12271 247
99 3300053139 Ga0500568_0121126 Ga0500568_0121126_152_919 247
100 3300009036 Ga0105244_10163150 Ga0105244_101631502 248
101 3300009092 Ga0105250_10002498 Ga0105250_100024982 248
102 3300012498 Ga0157345_1000020 Ga0157345_10000208 248
103 3300013100 Ga0157373_10001782 Ga0157373_100017828 248
104 3300013100 Ga0157373_10011964 Ga0157373_100119645 248
105 3300013102 Ga0157371_10007617 Ga0157371_100076174 248
106 3300013105 Ga0157369_10004566 Ga0157369_100045668 248
107 3300013306 Ga0163162_10000322 Ga0163162_1000032222 248
108 3300013308 Ga0157375_10111962 Ga0157375_101119622 248
109 3300015265 Ga0182005_1000856 Ga0182005_100085611 248
110 3300041411 Ga0439466_0000223 Ga0439466_0000223_12564_13313 248
111 3300046452 Ga0495617_013840 Ga0495617_013840_1780_2526 248
112 3300046452 Ga0495617_067785 Ga0495617_067785_211_957 248
113 3300046453 Ga0495627_000416 Ga0495627_000416_25495_26241 248
114 3300046453 Ga0495627_001073 Ga0495627_001073_8928_9674 248
115 3300046453 Ga0495627_001416 Ga0495627_001416_1099_1845 248
116 3300046453 Ga0495627_069166 Ga0495627_069166_123_869 248
117 3300046454 Ga0495592_0059701 Ga0495592_0059701_992_1738 248
118 3300046457 Ga0495590_0124108 Ga0495590_0124108_41_787 248
119 3300046458 Ga0495591_000304 Ga0495591_000304_25910_26656 248
120 3300046458 Ga0495591_038775 Ga0495591_038775_142_888 248
121 3300046460 Ga0495638_0005776 Ga0495638_0005776_6103_6849 248
122 3300046463 Ga0495653_0002377 Ga0495653_0002377_8186_8932 248
123 3300046463 Ga0495653_0026843 Ga0495653_0026843_3602_4348 248
124 3300046471 Ga0495650_0012408 Ga0495650_0012408_379_1125 248
125 3300046471 Ga0495650_0043172 Ga0495650_0043172_1016_1762 248
126 3300046474 Ga0495605_0000868 Ga0495605_0000868_5701_6447 248
127 3300046475 Ga0495639_0186387 Ga0495639_0186387_67_813 248
128 3300046491 Ga0495584_0001134 Ga0495584_0001134_8369_9115 248
129 3300046491 Ga0495584_0048763 Ga0495584_0048763_197_943 248
130 3300046492 Ga0495585_0004247 Ga0495585_0004247_247_993 248
131 3300046492 Ga0495585_0034370 Ga0495585_0034370_2001_2747 248
132 3300046492 Ga0495585_0213027 Ga0495585_0213027_195_941 248
133 3300046500 Ga0495596_0008642 Ga0495596_0008642_358_1104 248
134 3300046500 Ga0495596_0055996 Ga0495596_0055996_680_1426 248
135 3300046501 Ga0495607_0001664 Ga0495607_0001664_12628_13374 248
136 3300046501 Ga0495607_0002482 Ga0495607_0002482_9744_10490 248
137 3300046506 Ga0495583_0002470 Ga0495583_0002470_6980_7726 248
138 3300046507 Ga0495606_0004634 Ga0495606_0004634_12115_12861 248
139 3300046512 Ga0495610_0000727 Ga0495610_0000727_17881_18627 248
140 3300046512 Ga0495610_0051575 Ga0495610_0051575_796_1542 248
141 3300046513 Ga0495616_0000305 Ga0495616_0000305_18730_19476 248
142 3300046513 Ga0495616_0006820 Ga0495616_0006820_5975_6721 248
143 3300046513 Ga0495616_0020283 Ga0495616_0020283_164_910 248
144 3300046515 Ga0495620_0000195 Ga0495620_0000195_27000_27746 248
145 3300046515 Ga0495620_0042734 Ga0495620_0042734_624_1370 248
146 3300046515 Ga0495620_0093198 Ga0495620_0093198_163_909 248
147 3300046518 Ga0495631_0001016 Ga0495631_0001016_6431_7177 248
148 3300046519 Ga0495632_0001973 Ga0495632_0001973_6167_6913 248
149 3300046519 Ga0495632_0032059 Ga0495632_0032059_1778_2524 248
150 3300046519 Ga0495632_0158227 Ga0495632_0158227_163_909 248
151 3300046520 Ga0495637_0000584 Ga0495637_0000584_14321_15067 248
152 3300046522 Ga0495643_0003871 Ga0495643_0003871_5637_6383 248
153 3300046522 Ga0495643_0036796 Ga0495643_0036796_147_893 248
154 3300046523 Ga0495644_0001042 Ga0495644_0001042_8215_8961 248
155 3300046524 Ga0495648_0005797 Ga0495648_0005797_5706_6452 248
156 3300046524 Ga0495648_0007377 Ga0495648_0007377_3727_4473 248
157 3300046524 Ga0495648_0092411 Ga0495648_0092411_780_1526 248
158 3300046524 Ga0495648_0183972 Ga0495648_0183972_205_951 248
159 3300046526 Ga0495666_0015615 Ga0495666_0015615_2027_2773 248
160 3300046530 Ga0495654_0000541 Ga0495654_0000541_211_957 248
161 3300046530 Ga0495654_0004426 Ga0495654_0004426_3859_4605 248
162 3300046530 Ga0495654_0038168 Ga0495654_0038168_163_909 248
163 3300046536 Ga0495587_0098472 Ga0495587_0098472_181_927 248
164 3300046538 Ga0495609_0001455 Ga0495609_0001455_13647_14393 248
165 3300046538 Ga0495609_0001524 Ga0495609_0001524_5396_6142 248
166 3300046542 Ga0495597_0002953 Ga0495597_0002953_3543_4289 248
167 3300046557 Ga0495622_0001296 Ga0495622_0001296_2275_3021 248
168 3300046558 Ga0495633_0003346 Ga0495633_0003346_9528_10274 248
169 3300046558 Ga0495633_0071493 Ga0495633_0071493_142_888 248
170 3300046642 Ga0495634_0009399 Ga0495634_0009399_824_1570 248
171 3300046648 Ga0495611_0000125 Ga0495611_0000125_17891_18637 248
172 3300046648 Ga0495611_0007252 Ga0495611_0007252_302_1048 248
173 3300046660 Ga0495625_0001657 Ga0495625_0001657_19300_20046 248
174 3300046660 Ga0495625_0002467 Ga0495625_0002467_6148_6894 248
175 3300046663 Ga0495635_0351445 Ga0495635_0351445_188_934 248
176 3300046665 Ga0495661_0002265 Ga0495661_0002265_8066_8812 248
177 3300046665 Ga0495661_0039592 Ga0495661_0039592_164_910 248
178 3300046665 Ga0495661_0040254 Ga0495661_0040254_164_910 248
179 3300046665 Ga0495661_0073828 Ga0495661_0073828_935_1681 248
180 3300046674 Ga0495588_0052164 Ga0495588_0052164_317_1063 248
181 3300046680 Ga0495646_0007618 Ga0495646_0007618_5152_5898 248
182 3300046689 Ga0495613_0017991 Ga0495613_0017991_890_1636 248
183 3300046690 Ga0495624_0001502 Ga0495624_0001502_9198_9944 248
184 3300046690 Ga0495624_0184295 Ga0495624_0184295_144_890 248
185 3300046691 Ga0495670_0000483 Ga0495670_0000483_5396_6142 248
186 3300046692 Ga0495671_0166920 Ga0495671_0166920_161_907 248
187 3300046694 Ga0495649_0001843 Ga0495649_0001843_1108_1854 248
188 3300046694 Ga0495649_0038158 Ga0495649_0038158_783_1529 248
189 3300046794 Ga0495589_0001834 Ga0495589_0001834_164_910 248
190 3300046794 Ga0495589_0009111 Ga0495589_0009111_164_910 248
191 3300046809 Ga0495600_0004909 Ga0495600_0004909_5233_5979 248
192 3300046810 Ga0495660_0001292 Ga0495660_0001292_14171_14917 248
193 3300046810 Ga0495660_0006842 Ga0495660_0006842_3555_4301 248
194 3300046810 Ga0495660_0027899 Ga0495660_0027899_115_861 248
195 3300047320 Ga0495672_0002321 Ga0495672_0002321_9182_9928 248
196 3300047320 Ga0495672_0188394 Ga0495672_0188394_218_964 248
197 3300047321 Ga0495676_0000534 Ga0495676_0000534_17944_18690 248
198 3300047321 Ga0495676_0038421 Ga0495676_0038421_2056_2802 248
199 3300047322 Ga0495680_0027059 Ga0495680_0027059_1981_2727 248
200 3300047323 Ga0495683_0015717 Ga0495683_0015717_2694_3440 248
201 3300047446 Ga0495679_001241 Ga0495679_001241_6053_6799 248
202 3300047446 Ga0495679_004732 Ga0495679_004732_1084_1830 248
203 3300047469 Ga0495673_0001095 Ga0495673_0001095_16642_17388 248
204 3300047469 Ga0495673_0006172 Ga0495673_0006172_4348_5094 248
205 3300047469 Ga0495673_0033919 Ga0495673_0033919_1312_2058 248
206 3300047470 Ga0495681_0000627 Ga0495681_0000627_17067_17813 248
207 3300047470 Ga0495681_0002828 Ga0495681_0002828_9101_9847 248
208 3300047470 Ga0495681_0094913 Ga0495681_0094913_238_984 248
209 3300047471 Ga0495684_0032410 Ga0495684_0032410_1162_1908 248
210 3300047472 Ga0495686_0002026 Ga0495686_0002026_8485_9231 248
211 3300047472 Ga0495686_0015626 Ga0495686_0015626_164_910 248
212 3300047673 Ga0495593_0015599 Ga0495593_0015599_636_1382 248
213 3300048088 Ga0495602_0003788 Ga0495602_0003788_9242_9988 248
214 3300048091 Ga0495626_0000584 Ga0495626_0000584_19535_20281 248
215 3300048919 Ga0496116_0001103 Ga0496116_0001103_17986_18732 248
216 3300049459 Ga0495678_002005 Ga0495678_002005_159_905 248
217 3300049459 Ga0495678_002092 Ga0495678_002092_159_905 248
218 3300049459 Ga0495678_003467 Ga0495678_003467_8341_9087 248
219 3300049459 Ga0495678_067312 Ga0495678_067312_291_1037 248
220 3300049460 Ga0495682_0000468 Ga0495682_0000468_8343_9089 248
221 3300053161 Ga0500634_0000719 Ga0500634_0000719_4203_4949 248
222 3300041411 Ga0439466_0060409 Ga0439466_0060409_186_935 249
223 3300042184 Ga0450908_003213 Ga0450908_003213_1871_2620 249
224 3300046452 Ga0495617_006246 Ga0495617_006246_1515_2264 249
225 3300046453 Ga0495627_012678 Ga0495627_012678_883_1632 249
226 3300046457 Ga0495590_0000889 Ga0495590_0000889_3831_4580 249
227 3300046458 Ga0495591_000008 Ga0495591_000008_176254_177003 249
228 3300046458 Ga0495591_025935 Ga0495591_025935_497_1246 249
229 3300046460 Ga0495638_0003439 Ga0495638_0003439_2747_3496 249
230 3300046471 Ga0495650_0001880 Ga0495650_0001880_6425_7174 249
231 3300046474 Ga0495605_0192224 Ga0495605_0192224_26_775 249
232 3300046491 Ga0495584_0025743 Ga0495584_0025743_1761_2510 249
233 3300046492 Ga0495585_0026202 Ga0495585_0026202_1130_1879 249
234 3300046500 Ga0495596_0000005 Ga0495596_0000005_86913_87662 249
235 3300046501 Ga0495607_0006109 Ga0495607_0006109_1539_2288 249
236 3300046507 Ga0495606_0042359 Ga0495606_0042359_640_1389 249
237 3300046512 Ga0495610_0000803 Ga0495610_0000803_11672_12424 249
238 3300046512 Ga0495610_0005264 Ga0495610_0005264_4688_5437 249
239 3300046513 Ga0495616_0008889 Ga0495616_0008889_3884_4633 249
240 3300046513 Ga0495616_0011320 Ga0495616_0011320_703_1452 249
241 3300046515 Ga0495620_0024803 Ga0495620_0024803_801_1550 249
242 3300046518 Ga0495631_0002699 Ga0495631_0002699_7143_7892 249
243 3300046519 Ga0495632_0004909 Ga0495632_0004909_5349_6098 249
244 3300046519 Ga0495632_0020393 Ga0495632_0020393_920_1669 249
245 3300046520 Ga0495637_0000885 Ga0495637_0000885_4620_5369 249
246 3300046520 Ga0495637_0020597 Ga0495637_0020597_1850_2599 249
247 3300046522 Ga0495643_0030773 Ga0495643_0030773_1506_2255 249
248 3300046523 Ga0495644_0007461 Ga0495644_0007461_1101_1850 249
249 3300046524 Ga0495648_0023682 Ga0495648_0023682_2966_3715 249
250 3300046524 Ga0495648_0114316 Ga0495648_0114316_650_1399 249
251 3300046530 Ga0495654_0002413 Ga0495654_0002413_5699_6448 249
252 3300046530 Ga0495654_0003048 Ga0495654_0003048_4245_4997 249
253 3300046530 Ga0495654_0013534 Ga0495654_0013534_2838_3587 249
254 3300046542 Ga0495597_0002793 Ga0495597_0002793_8224_8973 249
255 3300046542 Ga0495597_0085954 Ga0495597_0085954_118_867 249
256 3300046615 Ga0495656_0081475 Ga0495656_0081475_578_1327 249
257 3300046616 Ga0495668_0001233 Ga0495668_0001233_6623_7372 249
258 3300046660 Ga0495625_0012019 Ga0495625_0012019_5318_6067 249
259 3300046660 Ga0495625_0018936 Ga0495625_0018936_3966_4715 249
260 3300046665 Ga0495661_0065139 Ga0495661_0065139_935_1684 249
261 3300046665 Ga0495661_0099208 Ga0495661_0099208_451_1200 249
262 3300046691 Ga0495670_0020096 Ga0495670_0020096_365_1114 249
263 3300046692 Ga0495671_0006133 Ga0495671_0006133_5605_6354 249
264 3300046692 Ga0495671_0036429 Ga0495671_0036429_859_1608 249
265 3300046694 Ga0495649_0074186 Ga0495649_0074186_288_1037 249
266 3300046694 Ga0495649_0258749 Ga0495649_0258749_26_775 249
267 3300046794 Ga0495589_0004094 Ga0495589_0004094_897_1646 249
268 3300046810 Ga0495660_0006966 Ga0495660_0006966_1761_2510 249
269 3300047320 Ga0495672_0000261 Ga0495672_0000261_25941_26690 249
270 3300047320 Ga0495672_0003744 Ga0495672_0003744_3689_4438 249
271 3300047323 Ga0495683_0008190 Ga0495683_0008190_897_1646 249
272 3300047323 Ga0495683_0020331 Ga0495683_0020331_2491_3240 249
273 3300047469 Ga0495673_0054757 Ga0495673_0054757_43_792 249
274 3300047470 Ga0495681_0000702 Ga0495681_0000702_3183_3932 249
275 3300047470 Ga0495681_0001761 Ga0495681_0001761_13310_14059 249
276 3300047470 Ga0495681_0008998 Ga0495681_0008998_5211_5960 249
277 3300047472 Ga0495686_0009606 Ga0495686_0009606_889_1638 249
278 3300048091 Ga0495626_0000040 Ga0495626_0000040_107239_107988 249
279 3300048925 Ga0496122_0059734 Ga0496122_0059734_1042_1791 249
280 3300048928 Ga0496125_0033283 Ga0496125_0033283_856_1611 249
281 3300049459 Ga0495678_007405 Ga0495678_007405_2866_3615 249
282 3300027312 Ga0209371_1001433 Ga0209371_10014337 250
283 3300030500 Ga0268256_1001221 Ga0268256_100122111 250
284 iso_pu_bacteria 2511231024 2511376052 250
285 iso_pu_bacteria 2919155634 2919156929 250
286 3300046458 Ga0495591_011142 Ga0495591_011142_1205_1963 252
287 3300046460 Ga0495638_0001009 Ga0495638_0001009_8371_9129 252
288 3300046474 Ga0495605_0038091 Ga0495605_0038091_547_1305 252
289 3300046492 Ga0495585_0004463 Ga0495585_0004463_7285_8043 252
290 3300046501 Ga0495607_0133865 Ga0495607_0133865_325_1083 252
291 3300046513 Ga0495616_0025256 Ga0495616_0025256_1142_1900 252
292 3300046515 Ga0495620_0099798 Ga0495620_0099798_51_809 252
293 3300046518 Ga0495631_0039306 Ga0495631_0039306_84_842 252
294 3300046520 Ga0495637_0008113 Ga0495637_0008113_1009_1767 252
295 3300046524 Ga0495648_0016469 Ga0495648_0016469_3539_4297 252
296 3300046538 Ga0495609_0030376 Ga0495609_0030376_908_1666 252
297 3300046542 Ga0495597_0039628 Ga0495597_0039628_260_1021 252
298 3300046557 Ga0495622_0099209 Ga0495622_0099209_412_1170 252
299 3300046660 Ga0495625_0142758 Ga0495625_0142758_17_775 252
300 3300046692 Ga0495671_0001423 Ga0495671_0001423_7157_7915 252
301 3300046694 Ga0495649_0055177 Ga0495649_0055177_1029_1787 252
302 3300046794 Ga0495589_0030456 Ga0495589_0030456_967_1725 252
303 3300046810 Ga0495660_0004973 Ga0495660_0004973_5172_5930 252
304 3300048091 Ga0495626_0015507 Ga0495626_0015507_2030_2788 252
305 3300049459 Ga0495678_018169 Ga0495678_018169_790_1548 252
306 3300053145 Ga0500586_075323 Ga0500586_075323_217_975 252
307 3300009036 Ga0105244_10016714 Ga0105244_100167145 253
308 3300009092 Ga0105250_10001022 Ga0105250_100010228 253
309 3300013307 Ga0157372_10002618 Ga0157372_100026188 253
310 3300015261 Ga0182006_1070806 Ga0182006_10708062 253
311 3300047320 Ga0495672_0002829 Ga0495672_0002829_5777_6568 253
312 3300048919 Ga0496116_0003657 Ga0496116_0003657_8551_9312 253
313 3300048924 Ga0496121_0006324 Ga0496121_0006324_5611_6372 253
314 3300048925 Ga0496122_0140262 Ga0496122_0140262_136_897 253
315 3300048926 Ga0496123_0100764 Ga0496123_0100764_617_1378 253
316 3300048927 Ga0496124_0011900 Ga0496124_0011900_7750_8511 253
317 3300048928 Ga0496125_0029680 Ga0496125_0029680_1035_1796 253
318 3300048928 Ga0496125_0119446 Ga0496125_0119446_479_1243 253
319 iso_pu_bacteria 2765235841 2765584979 253
320 iso_pu_bacteria 2806310737 2807407594 253
321 iso_pu_bacteria 2806310745 2807455931 253
322 iso_pu_bacteria 2808606445 2809214263 253
323 iso_pu_bacteria 3007619802 3007621014 253
324 iso_pu_bacteria 3007803356 3007807886 253
325 iso_pu_bacteria 3007872151 3007875070 253
326 iso_pu_bacteria 8052494512 8052496523 253
327 iso_pu_bacteria 8054929484 8054932369 253
328 iso_pu_bacteria 8056115690 8056119409 253
329 iso_pu_bacteria 8056120720 8056124179 253
330 iso_pu_bacteria 8056137416 8056139437 253
331 3300013307 Ga0157372_10028727 Ga0157372_100287275 254
332 3300048917 Ga0496114_0003645 Ga0496114_0003645_7640_8407 254
333 3300048922 Ga0496119_0000046 Ga0496119_0000046_113252_114028 254
334 3300048923 Ga0496120_0000485 Ga0496120_0000485_43530_44306 254
335 iso_pu_bacteria 2600254931 2600366790 254
336 iso_pu_bacteria 8055878733 8055881106 254
337 3300025728 Ga0207655_1002183 Ga0207655_100218313 255
338 3300025728 Ga0207655_1002899 Ga0207655_10028992 255
339 3300025961 Ga0207712_10008378 Ga0207712_100083784 255
340 3300042016 Ga0439463_000157 Ga0439463_000157_9100_9891 256
341 3300042993 Ga0439440_0006485 Ga0439440_0006485_25_816 256
342 iso_pu_bacteria 2511231010 2511288260 256
343 iso_pu_bacteria 2600255318 2601797292 256
344 iso_pu_bacteria 2603880185 2606075977 256
345 iso_pu_bacteria 2603880199 2606130734 256
346 iso_pu_bacteria 2623620443 2624481554 256
347 iso_pu_bacteria 2713897149 2715756086 256
348 iso_pu_bacteria 2878029506 2878033543 256
349 iso_pu_bacteria 2919063839 2919069239 256
350 iso_pu_bacteria 2928515477 2928519214 256
351 iso_pu_bacteria 8056172158 8056173600 256
352 3300003781 Ga0055536_1023435 Ga0055536_10234351 257
353 3300005289 Ga0065704_10070484 Ga0065704_100704844 257
354 3300006058 Ga0075432_10054422 Ga0075432_100544222 257
355 3300006944 Ga0099823_1000097 Ga0099823_100009727 257
356 3300009011 Ga0105251_10010233 Ga0105251_100102336 257
357 3300009011 Ga0105251_10045183 Ga0105251_100451832 257
358 3300009036 Ga0105244_10000377 Ga0105244_1000037722 257
359 3300009036 Ga0105244_10000692 Ga0105244_100006926 257
360 3300009036 Ga0105244_10003734 Ga0105244_100037346 257
361 3300009036 Ga0105244_10035581 Ga0105244_100355812 257
362 3300009036 Ga0105244_10073961 Ga0105244_100739611 257
363 3300009148 Ga0105243_10044628 Ga0105243_100446283 257
364 3300009148 Ga0105243_10131357 Ga0105243_101313571 257
365 3300025292 Ga0209676_1000655 Ga0209676_100065515 257
366 3300025711 Ga0207696_1000023 Ga0207696_1000023252 257
367 3300025711 Ga0207696_1003863 Ga0207696_10038633 257
368 3300025711 Ga0207696_1023621 Ga0207696_10236212 257
369 3300025728 Ga0207655_1000528 Ga0207655_100052822 257
370 3300025728 Ga0207655_1000646 Ga0207655_100064622 257
371 3300025728 Ga0207655_1039321 Ga0207655_10393212 257
372 3300025735 Ga0207713_1001103 Ga0207713_100110311 257
373 3300025735 Ga0207713_1003746 Ga0207713_10037469 257
374 3300025735 Ga0207713_1056251 Ga0207713_10562512 257
375 3300025935 Ga0207709_10008296 Ga0207709_100082964 257
376 3300025935 Ga0207709_10473702 Ga0207709_104737022 257
377 3300027296 Ga0209389_1000013 Ga0209389_100001335 257
378 3300027907 Ga0207428_10218501 Ga0207428_102185011 257
379 3300042006 Ga0439432_000531 Ga0439432_000531_2818_3594 257
380 3300042013 Ga0439456_000028 Ga0439456_000028_35092_35883 257
381 3300042137 Ga0450902_000061 Ga0450902_000061_3008_3784 257
382 3300042139 Ga0450904_000506 Ga0450904_000506_5218_5991 257
383 3300042533 Ga0450901_000183 Ga0450901_000183_1066_1842 257
384 3300046458 Ga0495591_009090 Ga0495591_009090_2112_2885 257
385 3300046460 Ga0495638_0115014 Ga0495638_0115014_14_787 257
386 3300046492 Ga0495585_0000634 Ga0495585_0000634_12808_13581 257
387 3300046507 Ga0495606_0003686 Ga0495606_0003686_9266_10039 257
388 3300046512 Ga0495610_0001563 Ga0495610_0001563_13334_14107 257
389 3300046515 Ga0495620_0000004 Ga0495620_0000004_117908_118684 257
390 3300046519 Ga0495632_0000257 Ga0495632_0000257_26661_27437 257
391 3300046522 Ga0495643_0000772 Ga0495643_0000772_10338_11114 257
392 3300046522 Ga0495643_0000872 Ga0495643_0000872_3037_3813 257
393 3300046524 Ga0495648_0000805 Ga0495648_0000805_4689_5465 257
394 3300046530 Ga0495654_0107210 Ga0495654_0107210_196_969 257
395 3300046616 Ga0495668_0001554 Ga0495668_0001554_5800_6573 257
396 3300046694 Ga0495649_0002199 Ga0495649_0002199_538_1311 257
397 3300047446 Ga0495679_015307 Ga0495679_015307_935_1708 257
398 3300048091 Ga0495626_0009253 Ga0495626_0009253_3732_4505 257
399 3300048917 Ga0496114_0013404 Ga0496114_0013404_5017_5793 257
400 3300048919 Ga0496116_0019965 Ga0496116_0019965_3657_4433 257
401 3300048920 Ga0496117_0000916 Ga0496117_0000916_25095_25871 257
402 3300048920 Ga0496117_0001529 Ga0496117_0001529_12402_13178 257
403 3300048920 Ga0496117_0004562 Ga0496117_0004562_13320_14096 257
404 3300048921 Ga0496118_0003330 Ga0496118_0003330_12471_13247 257
405 3300048921 Ga0496118_0006140 Ga0496118_0006140_3168_3944 257
406 3300048925 Ga0496122_0005026 Ga0496122_0005026_3395_4171 257
407 3300048926 Ga0496123_0000779 Ga0496123_0000779_41158_41934 257
408 3300048927 Ga0496124_0001162 Ga0496124_0001162_16949_17725 257
409 3300048927 Ga0496124_0007698 Ga0496124_0007698_7053_7829 257
410 3300048928 Ga0496125_0000613 Ga0496125_0000613_39943_40719 257
411 3300048928 Ga0496125_0016695 Ga0496125_0016695_76_852 257
412 3300049571 Ga0501034_0000045 Ga0501034_0000045_158608_159384 257
413 3300053135 Ga0500659_0002181 Ga0500659_0002181_9239_10015 257
414 iso_pu_bacteria 2597489888 2597864624 257
415 iso_pu_bacteria 2597489889 2597870433 257
416 iso_pu_bacteria 2599185167 2599397798 257
417 iso_pu_bacteria 2599185179 2599452244 257
418 iso_pu_bacteria 2599185189 2599506827 257
419 iso_pu_bacteria 2599185190 2599513377 257
420 iso_pu_bacteria 2599185191 2599518124 257
421 iso_pu_bacteria 2599185290 2599892054 257
422 iso_pu_bacteria 2600255296 2601690083 257
423 iso_pu_bacteria 2643221713 2644622758 257
424 iso_pu_bacteria 2675903420 2677900672 257
425 iso_pu_bacteria 2721755607 2723249406 257
426 iso_pu_bacteria 2834028612 2834032788 257
427 iso_pu_bacteria 2842826826 2842828242 257
428 iso_pu_bacteria 2842837860 2842841160 257
429 iso_pu_bacteria 2908446538 2908450473 257
430 iso_pu_bacteria 2912963787 2912966046 257
431 iso_pu_bacteria 2929189879 2929193195 257
432 iso_pu_bacteria 2931390751 2931393250 257
433 iso_pu_bacteria 2939651529 2939656475 257
434 iso_pu_bacteria 2945961074 2945964762 257
435 iso_pu_bacteria 2946006987 2946009052 257
436 iso_pu_bacteria 2946027586 2946031475 257
437 iso_pu_bacteria 8054285046 8054287742 257
438 iso_pu_bacteria 8054347763 8054348962 257
439 iso_pu_bacteria 8054503363 8054506981 257
440 iso_pu_bacteria 8055817908 8055821942 257
441 iso_pu_bacteria 8056148874 8056154401 257
442 3300042006 Ga0439432_006397 Ga0439432_006397_1152_1928 258
443 3300046491 Ga0495584_0098712 Ga0495584_0098712_210_986 258
444 3300046512 Ga0495610_0019009 Ga0495610_0019009_1005_1781 258
445 3300046518 Ga0495631_0079886 Ga0495631_0079886_480_1256 258
446 3300046524 Ga0495648_0044879 Ga0495648_0044879_875_1651 258
447 3300046660 Ga0495625_0035562 Ga0495625_0035562_1330_2106 258
448 3300046810 Ga0495660_0000704 Ga0495660_0000704_7373_8149 258
449 3300046810 Ga0495660_0010111 Ga0495660_0010111_1748_2524 258
450 3300048091 Ga0495626_0010156 Ga0495626_0010156_16_792 258
451 3300049459 Ga0495678_004604 Ga0495678_004604_5600_6376 258
452 3300049459 Ga0495678_012635 Ga0495678_012635_3067_3843 258
453 iso_pu_bacteria 2511231006 2511264350 258
454 iso_pu_bacteria 2511231011 2511293513 258
455 iso_pu_bacteria 2511231018 2511338661 258
456 iso_pu_bacteria 2511231019 2511344632 258
457 iso_pu_bacteria 2511231021 2511356822 258
458 iso_pu_bacteria 2511231031 2511415057 258
459 iso_pu_bacteria 2582580891 2583793082 258
460 iso_pu_bacteria 2597489887 2597858970 258
461 iso_pu_bacteria 2599185185 2599487592 258
462 iso_pu_bacteria 2599185257 2599806083 258
463 iso_pu_bacteria 2671180172 2671772851 258
464 iso_pu_bacteria 2738543025 2739313638 258
465 iso_pu_bacteria 2740892503 2743738492 258
466 iso_pu_bacteria 2773857673 2774135145 258
467 iso_pu_bacteria 2784132063 2784265218 258
468 iso_pu_bacteria 2818991456 2819657658 258
469 iso_pu_bacteria 2852657418 2852659346 258
470 iso_pu_bacteria 2880230671 2880232745 258
471 iso_pu_bacteria 2904518522 2904520519 258
472 iso_pu_bacteria 2923153595 2923157550 258
473 iso_pu_bacteria 2969304461 2969308307 258
474 iso_pu_bacteria 2984286254 2984288585 258
475 iso_pu_bacteria 3007395558 3007396872 258
476 iso_pu_bacteria 3007614139 3007618684 258
477 iso_pu_bacteria 8055770955 8055774900 258
478 iso_pu_bacteria 8056155041 8056158998 258
479 iso_pu_bacteria 8056177738 8056183806 258
480 3300003856 Ga0058692_1000001 Ga0058692_1000001395 259
481 3300003856 Ga0058692_1000014 Ga0058692_100001442 259
482 3300013104 Ga0157370_10015098 Ga0157370_100150985 259
483 3300025981 Ga0207640_10200293 Ga0207640_102002932 259
484 3300027312 Ga0209371_1000008 Ga0209371_1000008521 259
485 3300027312 Ga0209371_1000040 Ga0209371_1000040248 259
486 3300030500 Ga0268256_1000009 Ga0268256_1000009521 259
487 3300030500 Ga0268256_1000041 Ga0268256_100004167 259
488 iso_pu_bacteria 2551306352 2552748366 259
489 iso_pu_bacteria 2554235341 2555670953 259
490 iso_pu_bacteria 2599185160 2599357484 259
491 iso_pu_bacteria 2599185161 2599364274 259
492 iso_pu_bacteria 2599185162 2599370595 259
493 iso_pu_bacteria 2599185163 2599377212 259
494 iso_pu_bacteria 2599185164 2599382799 259
495 iso_pu_bacteria 2599185165 2599389247 259
496 iso_pu_bacteria 2599185166 2599395820 259
497 iso_pu_bacteria 2599185168 2599408210 259
498 iso_pu_bacteria 2599185181 2599464027 259
499 iso_pu_bacteria 2599185182 2599471054 259
500 iso_pu_bacteria 2599185186 2599493046 259
501 iso_pu_bacteria 2599185356 2600217169 259
502 iso_pu_bacteria 2600255313 2601777340 259
503 iso_pu_bacteria 2667528171 2671100438 259
504 iso_pu_bacteria 2818991464 2819706099 259
505 iso_pu_bacteria 2844665904 2844671502 259
506 iso_pu_bacteria 2917070673 2917074815 259
507 iso_pu_bacteria 2935353572 2935355198 259
508 iso_pu_bacteria 3007419365 3007421523 259
509 iso_pu_bacteria 637000220 637321288 259
510 iso_pu_bacteria 8019769354 8019772108 259
511 iso_pu_bacteria 8057798959 8057801422 259
512 3300003781 Ga0055536_1000266 Ga0055536_100026613 260
513 3300003791 Ga0055530_10000239 Ga0055530_1000023924 260
514 3300003792 Ga0055540_1000244 Ga0055540_100024426 260
515 3300003794 Ga0055531_10000221 Ga0055531_1000022143 260
516 3300005288 Ga0065714_10006234 Ga0065714_100062344 260
517 3300005353 Ga0070669_100025190 Ga0070669_1000251902 260
518 3300009011 Ga0105251_10019707 Ga0105251_100197073 260
519 3300009011 Ga0105251_10020295 Ga0105251_100202953 260
520 3300009011 Ga0105251_10042292 Ga0105251_100422922 260
521 3300009011 Ga0105251_10076399 Ga0105251_100763993 260
522 3300009036 Ga0105244_10003294 Ga0105244_100032949 260
523 3300009036 Ga0105244_10032451 Ga0105244_100324513 260
524 3300009036 Ga0105244_10036036 Ga0105244_100360362 260
525 3300009036 Ga0105244_10119325 Ga0105244_101193252 260
526 3300013102 Ga0157371_10072793 Ga0157371_100727934 260
527 3300014497 Ga0182008_10043925 Ga0182008_100439254 260
528 3300025263 Ga0209565_1013575 Ga0209565_10135752 260
529 3300025292 Ga0209676_1000002 Ga0209676_1000002260 260
530 3300025298 Ga0209050_1000242 Ga0209050_100024230 260
531 3300025303 Ga0209051_1000001 Ga0209051_1000001260 260
532 3300025304 Ga0209257_1000167 Ga0209257_100016788 260
533 3300025711 Ga0207696_1013955 Ga0207696_10139551 260
534 3300025728 Ga0207655_1000536 Ga0207655_100053625 260
535 3300025728 Ga0207655_1005354 Ga0207655_10053547 260
536 3300025735 Ga0207713_1000870 Ga0207713_10008706 260
537 3300025735 Ga0207713_1002127 Ga0207713_100212710 260
538 3300025735 Ga0207713_1019506 Ga0207713_10195063 260
539 3300025935 Ga0207709_10000014 Ga0207709_10000014448 260
540 3300046458 Ga0495591_012741 Ga0495591_012741_1869_2651 260
541 3300046471 Ga0495650_0005738 Ga0495650_0005738_1468_2250 260
542 3300046474 Ga0495605_0015026 Ga0495605_0015026_1796_2578 260
543 3300046491 Ga0495584_0081724 Ga0495584_0081724_706_1488 260
544 3300046507 Ga0495606_0017258 Ga0495606_0017258_2752_3534 260
545 3300046515 Ga0495620_0007913 Ga0495620_0007913_4858_5640 260
546 3300046515 Ga0495620_0014826 Ga0495620_0014826_357_1139 260
547 3300046518 Ga0495631_0013866 Ga0495631_0013866_1407_2189 260
548 3300046519 Ga0495632_0007018 Ga0495632_0007018_2880_3662 260
549 3300046522 Ga0495643_0105489 Ga0495643_0105489_551_1333 260
550 3300046522 Ga0495643_0106198 Ga0495643_0106198_542_1324 260
551 3300046523 Ga0495644_0109522 Ga0495644_0109522_98_880 260
552 3300046524 Ga0495648_0118476 Ga0495648_0118476_121_903 260
553 3300046530 Ga0495654_0013141 Ga0495654_0013141_1715_2497 260
554 3300046542 Ga0495597_0015415 Ga0495597_0015415_2016_2798 260
555 3300046542 Ga0495597_0026044 Ga0495597_0026044_1267_2049 260
556 3300046660 Ga0495625_0041100 Ga0495625_0041100_1380_2195 260
557 3300046660 Ga0495625_0145884 Ga0495625_0145884_455_1237 260
558 3300046665 Ga0495661_0106529 Ga0495661_0106529_705_1487 260
559 3300046810 Ga0495660_0069059 Ga0495660_0069059_392_1174 260
560 3300046810 Ga0495660_0070316 Ga0495660_0070316_1027_1809 260
561 3300046810 Ga0495660_0078550 Ga0495660_0078550_821_1603 260
562 3300047469 Ga0495673_0004619 Ga0495673_0004619_5605_6387 260
563 3300047469 Ga0495673_0004635 Ga0495673_0004635_5819_6601 260
564 3300047470 Ga0495681_0005151 Ga0495681_0005151_3813_4595 260
565 3300048091 Ga0495626_0000833 Ga0495626_0000833_9026_9808 260
566 3300049459 Ga0495678_013636 Ga0495678_013636_2911_3693 260
567 3300003751 Ga0055538_1000072 Ga0055538_100007230 261
568 3300003752 Ga0055539_1000107 Ga0055539_100010730 261
569 3300003756 Ga0055533_1000116 Ga0055533_100011630 261
570 3300003758 Ga0055532_1000103 Ga0055532_100010351 261
571 3300003759 Ga0055525_1000160 Ga0055525_100016027 261
572 3300003841 Ga0055541_1000073 Ga0055541_100007330 261
573 3300005288 Ga0065714_10064735 Ga0065714_1006473515 261
574 3300005331 Ga0070670_100003042 Ga0070670_1000030427 261
575 3300005353 Ga0070669_100000957 Ga0070669_10000095715 261
576 3300005457 Ga0070662_100002793 Ga0070662_1000027931 261
577 3300005578 Ga0068854_100221452 Ga0068854_1002214522 261
578 3300005834 Ga0068851_10000103 Ga0068851_1000010312 261
579 3300006051 Ga0075364_10340421 Ga0075364_103404212 261
580 3300009011 Ga0105251_10001158 Ga0105251_100011588 261
581 3300009011 Ga0105251_10009926 Ga0105251_100099266 261
582 3300009092 Ga0105250_10067168 Ga0105250_100671682 261
583 3300009148 Ga0105243_10084930 Ga0105243_100849304 261
584 3300011119 Ga0105246_10000203 Ga0105246_100002037 261
585 3300013100 Ga0157373_10005057 Ga0157373_100050578 261
586 3300013100 Ga0157373_10006322 Ga0157373_100063221 261
587 3300013100 Ga0157373_10015266 Ga0157373_100152665 261
588 3300013102 Ga0157371_10127300 Ga0157371_101273002 261
589 3300013104 Ga0157370_10047642 Ga0157370_100476422 261
590 3300013105 Ga0157369_10055643 Ga0157369_100556434 261
591 3300013306 Ga0163162_10317654 Ga0163162_103176542 261
592 3300014497 Ga0182008_10003123 Ga0182008_100031238 261
593 3300014497 Ga0182008_10181308 Ga0182008_101813081 261
594 3300015262 Ga0182007_10001888 Ga0182007_100018888 261
595 3300017792 Ga0163161_10004002 Ga0163161_100040024 261
596 3300017792 Ga0163161_10109865 Ga0163161_101098652 261
597 3300025206 Ga0209435_101810 Ga0209435_1018105 261
598 3300025224 Ga0209784_100110 Ga0209784_10011051 261
599 3300025225 Ga0209566_100131 Ga0209566_10013151 261
600 3300025226 Ga0209674_100154 Ga0209674_10015451 261
601 3300025229 Ga0209147_100158 Ga0209147_10015851 261
602 3300025230 Ga0209563_100133 Ga0209563_10013351 261
603 3300025242 Ga0209258_100260 Ga0209258_10026031 261
604 3300025246 Ga0209646_1000454 Ga0209646_100045420 261
605 3300025253 Ga0209677_100100 Ga0209677_10010051 261
606 3300025256 Ga0209759_1007498 Ga0209759_10074983 261
607 3300025321 Ga0207656_10000161 Ga0207656_1000016122 261
608 3300025735 Ga0207713_1001848 Ga0207713_100184810 261
609 3300025735 Ga0207713_1027004 Ga0207713_10270042 261
610 3300025923 Ga0207681_10006256 Ga0207681_100062562 261
611 3300025925 Ga0207650_10000874 Ga0207650_100008747 261
612 3300025933 Ga0207706_10000566 Ga0207706_1000056615 261
613 3300025935 Ga0207709_10208824 Ga0207709_102088242 261
614 3300046453 Ga0495627_000668 Ga0495627_000668_15615_16400 261
615 3300046458 Ga0495591_000762 Ga0495591_000762_16863_17648 261
616 3300046501 Ga0495607_0006405 Ga0495607_0006405_3902_4687 261
617 3300046507 Ga0495606_0001292 Ga0495606_0001292_19950_20735 261
618 3300046507 Ga0495606_0003777 Ga0495606_0003777_9627_10412 261
619 3300046512 Ga0495610_0125398 Ga0495610_0125398_44_832 261
620 3300046519 Ga0495632_0002482 Ga0495632_0002482_5213_5998 261
621 3300046522 Ga0495643_0023683 Ga0495643_0023683_743_1528 261
622 3300046665 Ga0495661_0000290 Ga0495661_0000290_36159_36944 261
623 3300046794 Ga0495589_0001578 Ga0495589_0001578_7488_8273 261
624 3300047446 Ga0495679_004113 Ga0495679_004113_860_1645 261
625 3300047469 Ga0495673_0004049 Ga0495673_0004049_5805_6590 261
626 3300047470 Ga0495681_0005004 Ga0495681_0005004_6895_7680 261
627 3300048920 Ga0496117_0000876 Ga0496117_0000876_16769_17554 261
628 3300048921 Ga0496118_0031107 Ga0496118_0031107_453_1238 261
629 3300048922 Ga0496119_0005612 Ga0496119_0005612_4973_5758 261
630 3300048923 Ga0496120_0003942 Ga0496120_0003942_5238_6023 261
631 3300048925 Ga0496122_0041709 Ga0496122_0041709_2464_3249 261
632 3300048926 Ga0496123_0020427 Ga0496123_0020427_771_1556 261
633 3300048927 Ga0496124_0000948 Ga0496124_0000948_28852_29637 261
634 3300048928 Ga0496125_0000915 Ga0496125_0000915_28598_29383 261
635 3300048928 Ga0496125_0031858 Ga0496125_0031858_586_1374 261
636 3300048929 Ga0496126_0014058 Ga0496126_0014058_5104_5889 261
637 3300049569 Ga0501032_0282002 Ga0501032_0282002_41_853 261
638 3300049570 Ga0501033_0157241 Ga0501033_0157241_785_1597 261
639 3300049571 Ga0501034_0331784 Ga0501034_0331784_290_1102 261
640 3300049573 Ga0501037_0017244 Ga0501037_0017244_2415_3227 261
641 3300049574 Ga0501038_0041049 Ga0501038_0041049_2016_2828 261
642 3300049579 Ga0501043_0017386 Ga0501043_0017386_3009_3821 261
643 3300049582 Ga0501048_0000844 Ga0501048_0000844_7703_8515 261
644 3300049583 Ga0501067_0001632 Ga0501067_0001632_3920_4732 261
645 3300049584 Ga0501068_0000757 Ga0501068_0000757_11766_12578 261
646 3300049586 Ga0501070_0048223 Ga0501070_0048223_351_1163 261
647 3300049589 Ga0501073_0007698 Ga0501073_0007698_657_1469 261
648 3300049590 Ga0501074_0272824 Ga0501074_0272824_40_852 261
649 3300049592 Ga0501076_0260410 Ga0501076_0260410_493_1305 261
650 3300049742 Ga0501080_0115018 Ga0501080_0115018_1026_1838 261
651 3300049822 Ga0501035_0131914 Ga0501035_0131914_41_853 261
652 3300049823 Ga0501044_0045341 Ga0501044_0045341_3511_4323 261
653 3300049823 Ga0501044_0445890 Ga0501044_0445890_157_969 261
654 3300049824 Ga0501045_0008589 Ga0501045_0008589_3987_4799 261
655 3300054114 Ga0501084_0033677 Ga0501084_0033677_552_1364 261
656 3300003781 Ga0055536_1000082 Ga0055536_100008246 262
657 3300003791 Ga0055530_10000124 Ga0055530_1000012434 262
658 3300003792 Ga0055540_1000467 Ga0055540_10004671 262
659 3300005288 Ga0065714_10065878 Ga0065714_100658786 262
660 3300006058 Ga0075432_10002626 Ga0075432_100026264 262
661 3300006914 Ga0075436_100057426 Ga0075436_1000574261 262
662 3300009011 Ga0105251_10015000 Ga0105251_100150005 262
663 3300013104 Ga0157370_10256427 Ga0157370_102564273 262
664 3300014497 Ga0182008_10002330 Ga0182008_100023309 262
665 3300015261 Ga0182006_1076258 Ga0182006_10762582 262
666 3300015265 Ga0182005_1002438 Ga0182005_10024382 262
667 3300017792 Ga0163161_10001094 Ga0163161_1000109419 262
668 3300017792 Ga0163161_10001706 Ga0163161_100017068 262
669 3300017792 Ga0163161_10010704 Ga0163161_100107044 262
670 3300017792 Ga0163161_10168453 Ga0163161_101684532 262
671 3300025230 Ga0209563_100506 Ga0209563_10050611 262
672 3300025284 Ga0209130_1031300 Ga0209130_10313002 262
673 3300025292 Ga0209676_1000017 Ga0209676_1000017257 262
674 3300025298 Ga0209050_1000371 Ga0209050_100037127 262
675 3300025303 Ga0209051_1000234 Ga0209051_100023428 262
676 3300025711 Ga0207696_1000147 Ga0207696_100014743 262
677 3300025711 Ga0207696_1002068 Ga0207696_10020684 262
678 3300025711 Ga0207696_1002953 Ga0207696_10029532 262
679 3300025728 Ga0207655_1002208 Ga0207655_100220810 262
680 3300025728 Ga0207655_1091714 Ga0207655_10917142 262
681 3300025735 Ga0207713_1002273 Ga0207713_10022736 262
682 3300025735 Ga0207713_1004431 Ga0207713_10044313 262
683 3300025735 Ga0207713_1079246 Ga0207713_10792462 262
684 3300030521 Ga0307511_10136944 Ga0307511_101369441 262
685 3300030521 Ga0307511_10142830 Ga0307511_101428301 262
686 3300033180 Ga0307510_10001978 Ga0307510_100019788 262
687 3300041411 Ga0439466_0007658 Ga0439466_0007658_466_1257 262
688 3300042006 Ga0439432_025705 Ga0439432_025705_945_1736 262
689 3300042010 Ga0439452_016850 Ga0439452_016850_417_1208 262
690 3300042533 Ga0450901_001759 Ga0450901_001759_1415_2203 262
691 3300046453 Ga0495627_016085 Ga0495627_016085_623_1414 262
692 3300046460 Ga0495638_0017417 Ga0495638_0017417_3378_4169 262
693 3300046460 Ga0495638_0023588 Ga0495638_0023588_835_1623 262
694 3300046460 Ga0495638_0029294 Ga0495638_0029294_2278_3066 262
695 3300046460 Ga0495638_0040953 Ga0495638_0040953_744_1532 262
696 3300046491 Ga0495584_0005076 Ga0495584_0005076_5362_6150 262
697 3300046492 Ga0495585_0001035 Ga0495585_0001035_13977_14765 262
698 3300046501 Ga0495607_0027093 Ga0495607_0027093_819_1607 262
699 3300046507 Ga0495606_0060775 Ga0495606_0060775_1496_2284 262
700 3300046512 Ga0495610_0013936 Ga0495610_0013936_790_1578 262
701 3300046517 Ga0495630_0033097 Ga0495630_0033097_2646_3434 262
702 3300046519 Ga0495632_0004092 Ga0495632_0004092_8738_9526 262
703 3300046519 Ga0495632_0005501 Ga0495632_0005501_925_1713 262
704 3300046519 Ga0495632_0061310 Ga0495632_0061310_605_1396 262
705 3300046520 Ga0495637_0004189 Ga0495637_0004189_3995_4783 262
706 3300046520 Ga0495637_0025576 Ga0495637_0025576_1612_2400 262
707 3300046522 Ga0495643_0128205 Ga0495643_0128205_359_1147 262
708 3300046524 Ga0495648_0000926 Ga0495648_0000926_5566_6354 262
709 3300046542 Ga0495597_0002187 Ga0495597_0002187_4049_4837 262
710 3300046542 Ga0495597_0010000 Ga0495597_0010000_2194_2982 262
711 3300046557 Ga0495622_0074025 Ga0495622_0074025_159_947 262
712 3300046660 Ga0495625_0087253 Ga0495625_0087253_620_1411 262
713 3300046675 Ga0495657_0017260 Ga0495657_0017260_526_1314 262
714 3300046679 Ga0495623_0102831 Ga0495623_0102831_884_1672 262
715 3300046694 Ga0495649_0024288 Ga0495649_0024288_670_1458 262
716 3300046794 Ga0495589_0003110 Ga0495589_0003110_3045_3833 262
717 3300046810 Ga0495660_0066273 Ga0495660_0066273_903_1691 262
718 3300047317 Ga0495604_0005745 Ga0495604_0005745_7203_7991 262
719 3300047322 Ga0495680_0038538 Ga0495680_0038538_2668_3456 262
720 3300047444 Ga0495675_0109875 Ga0495675_0109875_413_1201 262
721 3300047446 Ga0495679_004706 Ga0495679_004706_3819_4607 262
722 3300047470 Ga0495681_0000134 Ga0495681_0000134_22129_22917 262
723 3300047470 Ga0495681_0035900 Ga0495681_0035900_775_1563 262
724 3300047471 Ga0495684_0185889 Ga0495684_0185889_434_1222 262
725 3300047472 Ga0495686_0003274 Ga0495686_0003274_8040_8828 262
726 3300048919 Ga0496116_0005493 Ga0496116_0005493_5697_6485 262
727 3300048920 Ga0496117_0004246 Ga0496117_0004246_10193_10981 262
728 3300048921 Ga0496118_0005213 Ga0496118_0005213_5759_6547 262
729 3300048926 Ga0496123_0005537 Ga0496123_0005537_10206_10994 262
730 3300002737 JGI25162J39368_1000095 JGI25162J39368_100009555 263
731 3300002771 JGI25163J39215_1000303 JGI25163J39215_100030311 263
732 3300002772 JGI25164J39214_1000069 JGI25164J39214_100006957 263
733 3300003214 JGI25165J46597_1000168 JGI25165J46597_100016836 263
734 3300009036 Ga0105244_10004667 Ga0105244_100046678 263
735 3300009148 Ga0105243_10006203 Ga0105243_100062034 263
736 3300009553 Ga0105249_10375457 Ga0105249_103754572 263
737 3300013102 Ga0157371_10001096 Ga0157371_1000109615 263
738 3300013308 Ga0157375_10001075 Ga0157375_100010759 263
739 3300025207 Ga0209760_100018 Ga0209760_100018106 263
740 3300025231 Ga0207427_100015 Ga0207427_100015402 263
741 3300025233 Ga0209437_100027 Ga0209437_100027113 263
742 3300025261 Ga0209233_1000039 Ga0209233_1000039402 263
743 3300025935 Ga0207709_10003534 Ga0207709_100035348 263
744 3300025961 Ga0207712_10152521 Ga0207712_101525212 263
745 3300046558 Ga0495633_0036566 Ga0495633_0036566_775_1566 263
746 3300048919 Ga0496116_0000514 Ga0496116_0000514_15974_16765 263
747 3300048920 Ga0496117_0001404 Ga0496117_0001404_15895_16686 263
748 3300048921 Ga0496118_0009033 Ga0496118_0009033_902_1693 263
749 3300048924 Ga0496121_0000955 Ga0496121_0000955_35566_36357 263
750 3300048925 Ga0496122_0002553 Ga0496122_0002553_12088_12879 263
751 3300048926 Ga0496123_0001630 Ga0496123_0001630_15908_16699 263

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00345

PapD_N

Pili and flagellar-assembly chaperone, PapD N-terminal domain

37

160

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fq0-assembly2.cif.gz_C crystal structure of the csuc-csua/b chaperone-subunit preassembly complex of the archaic chaperone-usher csu pili of acinetobacter baumannii 0.8628 31 262
6fq0-assembly2.cif.gz_C crystal structure of the csuc-csua/b chaperone-subunit preassembly complex of the archaic chaperone-usher csu pili of acinetobacter baumannii 0.855 31 262
6fqa-assembly2.cif.gz_C crystal structure of the csuc-csua/b chaperone-subunit preassembly complex of the archaic chaperone-usher csu pili of acinetobacter baumannii 0.8545 31 262
6fq0-assembly1.cif.gz_A crystal structure of the csuc-csua/b chaperone-subunit preassembly complex of the archaic chaperone-usher csu pili of acinetobacter baumannii 0.853 31 262
6fqa-assembly2.cif.gz_C crystal structure of the csuc-csua/b chaperone-subunit preassembly complex of the archaic chaperone-usher csu pili of acinetobacter baumannii 0.8475 31 262
ID Description Score Start End Superfamily
4djmH01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.819 33 156 2.60.40.10
1p5uA01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8153 33 156 2.60.40.10
af_P33342_35_154_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7997 33 157 2.60.40.10
4ayfA01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7994 33 156 2.60.40.10
4djmH01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.799 33 156 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A1W9F6U6-F1-model_v4 deleted 0.9406 41 125
AF-I3UPG0-F1-model_v4 Type 1 pili usher pathway chaperone CsuC 0.9393 33 263 GO:0030288
GO:0071555
AF-A0A267ABU9-F1-model_v4 Molecular chaperone 0.939 26 263 GO:0030288
GO:0071555
AF-A0A2T6GHK3-F1-model_v4 Molecular chaperone 0.9333 35 263 GO:0030288
GO:0071555
AF-I3UPG0-F1-model_v4 Type 1 pili usher pathway chaperone CsuC 0.9315 33 263 GO:0030288
GO:0071555

Feature Viewer

pLDDT pTM Quality
83.31 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map