F479086

General Info

Members Datasets Scaffolds Average Seq Length
751 291 1502 75

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_101315864|Ga0070683_1013158642
Length 87
Sequence MSRQPLKASWKMSWPKTMATLAGAMAALMIAGCGERPQVVNYKQGTYSGKPDTPAFDNAPWNGNHEQWIKDLKQRAQAQNEYKRIGG

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
193 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
194 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
195 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
198 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
199 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
200 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
201 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
202 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
203 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
204 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
205 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
207 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
209 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
210 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
211 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
218 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
219 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
220 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
221 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
222 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
223 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
224 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
225 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
226 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
227 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
228 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
229 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
230 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
231 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
232 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
233 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
234 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
235 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
236 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
237 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
238 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
239 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
240 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
241 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
242 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
243 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
244 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
245 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
246 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
247 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
248 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
249 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
250 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
251 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
252 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
255 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
256 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
257 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
258 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
262 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
265 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
266 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
267 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
269 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
270 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
273 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
274 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
275 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
276 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
281 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
282 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
283 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
284 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
285 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
286 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.14
Metatranscriptomes 1.86
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.06
Rhizosphere 96.54
Stem 0
Stem Tuber 0
Unclassified 6.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_101315864 3300005329 Bacteria 694
2 Ga0058862_12601173 3300004803 Bacteria 773
3 Ga0070658_10047589 3300005327 Bacteria 3471
4 Ga0070658_10064642 3300005327 Bacteria 2984
5 Ga0070658_10207698 3300005327 Bacteria 1654
6 Ga0070658_10651037 3300005327 Bacteria 914
7 Ga0070658_10711983 3300005327 Bacteria 872
8 Ga0070676_10008388 3300005328 Bacteria 5568
9 Ga0070676_10573922 3300005328 Bacteria 810
10 Ga0070676_10710414 3300005328 Bacteria 735
11 Ga0070683_100043242 3300005329 Bacteria 4152
12 Ga0070683_100207360 3300005329 Bacteria 1861
13 Ga0070683_100840438 3300005329 Bacteria 880
14 Ga0070683_101789171 3300005329 Unclassified 591
15 Ga0070690_100012312 3300005330 Bacteria 5033
16 Ga0070690_100193034 3300005330 Bacteria 1413
17 Ga0070670_100019027 3300005331 Bacteria 5889
18 Ga0070670_100040620 3300005331 Bacteria 3998
19 Ga0070670_100049409 3300005331 Bacteria 3616
20 Ga0070670_100049714 3300005331 Bacteria 3605
21 Ga0070670_100099521 3300005331 Bacteria 2502
22 Ga0070670_100118296 3300005331 Bacteria 2285
23 Ga0070670_100403508 3300005331 Bacteria 1207
24 Ga0070677_10610894 3300005333 Bacteria 605
25 Ga0068869_100010460 3300005334 Bacteria 6051
26 Ga0068869_100028097 3300005334 Bacteria 3927
27 Ga0068869_100232014 3300005334 Bacteria 1467
28 Ga0068869_100244731 3300005334 Bacteria 1430
29 Ga0068869_100714972 3300005334 Bacteria 855
30 Ga0070666_10014301 3300005335 Bacteria 5052
31 Ga0070666_10085933 3300005335 Bacteria 2155
32 Ga0070666_10566503 3300005335 Bacteria 827
33 Ga0070680_100034056 3300005336 Bacteria 4107
34 Ga0070680_100745019 3300005336 Bacteria 843
35 Ga0070682_100268378 3300005337 Bacteria 1238
36 Ga0070682_100288616 3300005337 Bacteria 1199
37 Ga0068868_100002005 3300005338 Bacteria 14015
38 Ga0068868_100072715 3300005338 Bacteria 2744
39 Ga0068868_100077016 3300005338 Bacteria 2668
40 Ga0068868_100314057 3300005338 Bacteria 1334
41 Ga0068868_100364918 3300005338 Bacteria 1240
42 Ga0068868_100704587 3300005338 Bacteria 903
43 Ga0070660_100000365 3300005339 Bacteria 30098
44 Ga0070660_100075839 3300005339 Bacteria 2633
45 Ga0070660_100156866 3300005339 Bacteria 1832
46 Ga0070660_100419157 3300005339 Bacteria 1108
47 Ga0070660_100482730 3300005339 Bacteria 1030
48 Ga0070660_100838963 3300005339 Bacteria 774
49 Ga0070660_100849851 3300005339 Bacteria 769
50 Ga0070689_100007573 3300005340 Bacteria 7604
51 Ga0070689_100131860 3300005340 Bacteria 2004
52 Ga0070691_10095638 3300005341 Bacteria 1470
53 Ga0070687_100005943 3300005343 Bacteria 4965
54 Ga0070687_100904094 3300005343 Unclassified 633
55 Ga0070661_100003648 3300005344 Bacteria 10599
56 Ga0070661_100018040 3300005344 Bacteria 5014
57 Ga0070661_100019233 3300005344 Bacteria 4865
58 Ga0070661_100034406 3300005344 Bacteria 3674
59 Ga0070661_100064656 3300005344 Bacteria 2688
60 Ga0070661_101493071 3300005344 Bacteria 570
61 Ga0070692_10010933 3300005345 Bacteria 4152
62 Ga0070668_100002155 3300005347 Bacteria 14418
63 Ga0070668_100048818 3300005347 Bacteria 3256
64 Ga0070668_100196410 3300005347 Bacteria 1655
65 Ga0070668_100206063 3300005347 Bacteria 1616
66 Ga0070669_100018177 3300005353 Bacteria 5022
67 Ga0070669_100665907 3300005353 Bacteria 877
68 Ga0070675_100074015 3300005354 Bacteria 2828
69 Ga0070675_100099251 3300005354 Bacteria 2451
70 Ga0070675_100559111 3300005354 Bacteria 1035
71 Ga0070675_101332247 3300005354 Bacteria 662
72 Ga0070675_101404103 3300005354 Unclassified 644
73 Ga0070675_101828221 3300005354 Bacteria 560
74 Ga0070671_100067084 3300005355 Bacteria 2991
75 Ga0070671_100144282 3300005355 Unclassified 2009
76 Ga0070671_100677292 3300005355 Bacteria 894
77 Ga0070671_101057070 3300005355 Unclassified 712
78 Ga0070671_101622610 3300005355 Bacteria 573
79 Ga0070674_100354578 3300005356 Bacteria 1186
80 Ga0070673_100000324 3300005364 Bacteria 25089
81 Ga0070673_100009545 3300005364 Bacteria 6516
82 Ga0070673_101245674 3300005364 Unclassified 698
83 Ga0070688_100002357 3300005365 Bacteria 9529
84 Ga0070688_100382397 3300005365 Bacteria 1038
85 Ga0070688_101228466 3300005365 Bacteria 603
86 Ga0070659_100004698 3300005366 Bacteria 9749
87 Ga0070659_100087781 3300005366 Bacteria 2490
88 Ga0070659_101038705 3300005366 Bacteria 720
89 Ga0070659_101121711 3300005366 Bacteria 694
90 Ga0070667_100001782 3300005367 Bacteria 19178
91 Ga0070667_100004198 3300005367 Bacteria 12165
92 Ga0070667_100167889 3300005367 Bacteria 1936
93 Ga0070667_100184716 3300005367 Bacteria 1845
94 Ga0070667_100455116 3300005367 Bacteria 1170
95 Ga0070667_101579013 3300005367 Bacteria 617
96 Ga0070709_10013878 3300005434 Bacteria 4542
97 Ga0070709_10028489 3300005434 Bacteria 3331
98 Ga0070709_10078952 3300005434 Bacteria 2142
99 Ga0070709_10099991 3300005434 Bacteria 1930
100 Ga0070709_10544574 3300005434 Bacteria 887
101 Ga0070714_100004104 3300005435 Bacteria 10952
102 Ga0070714_100762759 3300005435 Bacteria 936
103 Ga0070714_101083244 3300005435 Bacteria 781
104 Ga0070714_101221238 3300005435 Bacteria 733
105 Ga0070713_100000694 3300005436 Bacteria 21627
106 Ga0070713_100018657 3300005436 Bacteria 5273
107 Ga0070713_100466860 3300005436 Bacteria 1187
108 Ga0070710_10010607 3300005437 Bacteria 4529
109 Ga0070710_10063869 3300005437 Bacteria 2104
110 Ga0070701_10156736 3300005438 Bacteria 1316
111 Ga0070711_100006795 3300005439 Bacteria 6926
112 Ga0070711_100082603 3300005439 Bacteria 2293
113 Ga0070711_100590144 3300005439 Bacteria 926
114 Ga0070711_100760773 3300005439 Unclassified 819
115 Ga0070705_100033043 3300005440 Bacteria 2880
116 Ga0070700_100195241 3300005441 Bacteria 1418
117 Ga0070700_101215283 3300005441 Bacteria 630
118 Ga0070694_100007279 3300005444 Bacteria 6741
119 Ga0070708_100000333 3300005445 Bacteria 35591
120 Ga0070708_100150204 3300005445 Bacteria 2166
121 Ga0070663_100031833 3300005455 Bacteria 3629
122 Ga0070663_100267175 3300005455 Bacteria 1359
123 Ga0070663_100311917 3300005455 Bacteria 1262
124 Ga0070663_101445824 3300005455 Bacteria 610
125 Ga0070663_101879573 3300005455 Unclassified 537
126 Ga0070678_100828068 3300005456 Bacteria 842
127 Ga0070678_101796354 3300005456 Unclassified 578
128 Ga0070662_100000291 3300005457 Bacteria 29613
129 Ga0070662_100095101 3300005457 Bacteria 2245
130 Ga0070662_100145461 3300005457 Bacteria 1841
131 Ga0070662_100450746 3300005457 Bacteria 1068
132 Ga0070681_10027102 3300005458 Bacteria 5761
133 Ga0070681_10043287 3300005458 Bacteria 4511
134 Ga0070681_10275598 3300005458 Bacteria 1593
135 Ga0070681_10815420 3300005458 Bacteria 850
136 Ga0068867_100007747 3300005459 Bacteria 7593
137 Ga0068867_100137365 3300005459 Bacteria 1907
138 Ga0070685_10006747 3300005466 Bacteria 5855
139 Ga0070706_100016833 3300005467 Bacteria 6751
140 Ga0070706_101647347 3300005467 Bacteria 585
141 Ga0070707_100012540 3300005468 Bacteria 7916
142 Ga0070698_100220429 3300005471 Bacteria 1831
143 Ga0070698_102223898 3300005471 Unclassified 502
144 Ga0070699_100093061 3300005518 Bacteria 2637
145 Ga0070699_100115150 3300005518 Bacteria 2362
146 Ga0070699_100163695 3300005518 Bacteria 1970
147 Ga0070699_102000419 3300005518 Bacteria 530
148 Ga0070679_100005607 3300005530 Bacteria 11632
149 Ga0070679_100158528 3300005530 Bacteria 2237
150 Ga0070679_100565363 3300005530 Bacteria 1081
151 Ga0070679_100650864 3300005530 Bacteria 996
152 Ga0070684_100134099 3300005535 Bacteria 2235
153 Ga0070684_100705511 3300005535 Unclassified 941
154 Ga0070684_101003436 3300005535 Bacteria 783
155 Ga0070684_101106352 3300005535 Bacteria 745
156 Ga0070697_100248580 3300005536 Bacteria 1520
157 Ga0068853_100041652 3300005539 Bacteria 3925
158 Ga0068853_100083963 3300005539 Bacteria 2790
159 Ga0068853_100134023 3300005539 Bacteria 2219
160 Ga0068853_100422047 3300005539 Bacteria 1251
161 Ga0068853_100449645 3300005539 Bacteria 1212
162 Ga0068853_101559648 3300005539 Bacteria 640
163 Ga0068853_101569299 3300005539 Bacteria 638
164 Ga0068853_101769732 3300005539 Bacteria 599
165 Ga0068853_102451491 3300005539 Unclassified 505
166 Ga0070672_100003665 3300005543 Bacteria 9979
167 Ga0070672_100031801 3300005543 Bacteria 3977
168 Ga0070672_100559907 3300005543 Bacteria 993
169 Ga0070686_100057282 3300005544 Bacteria 2503
170 Ga0070695_100047645 3300005545 Bacteria 2738
171 Ga0070696_100025912 3300005546 Bacteria 3988
172 Ga0070696_100111966 3300005546 Bacteria 1966
173 Ga0070696_100908436 3300005546 Bacteria 731
174 Ga0070696_101437973 3300005546 Bacteria 589
175 Ga0070693_100065064 3300005547 Bacteria 2130
176 Ga0070693_100230696 3300005547 Bacteria 1218
177 Ga0070693_101631916 3300005547 Bacteria 507
178 Ga0070693_101676567 3300005547 Unclassified 501
179 Ga0070665_100004289 3300005548 Bacteria 14987
180 Ga0070665_100070286 3300005548 Bacteria 3508
181 Ga0070665_100915137 3300005548 Bacteria 890
182 Ga0070665_101289007 3300005548 Bacteria 741
183 Ga0070665_102467641 3300005548 Bacteria 522
184 Ga0070704_100020038 3300005549 Bacteria 4305
185 Ga0070704_100233398 3300005549 Bacteria 1502
186 Ga0068855_100001546 3300005563 Bacteria 28944
187 Ga0068855_100073768 3300005563 Bacteria 3964
188 Ga0068855_100145201 3300005563 Bacteria 2702
189 Ga0068855_100347401 3300005563 Bacteria 1634
190 Ga0068855_100649793 3300005563 Bacteria 1133
191 Ga0070664_100043303 3300005564 Bacteria 3798
192 Ga0070664_100138383 3300005564 Bacteria 2142
193 Ga0070664_100437436 3300005564 Bacteria 1199
194 Ga0070664_100614662 3300005564 Bacteria 1008
195 Ga0070664_100622532 3300005564 Bacteria 1002
196 Ga0070664_100753639 3300005564 Bacteria 909
197 Ga0068857_100007190 3300005577 Bacteria 9587
198 Ga0068857_100115248 3300005577 Bacteria 2417
199 Ga0068857_100197641 3300005577 Bacteria 1833
200 Ga0068857_100201859 3300005577 Bacteria 1813
201 Ga0068857_100609233 3300005577 Bacteria 1033
202 Ga0068857_101297389 3300005577 Bacteria 706
203 Ga0068857_101501083 3300005577 Bacteria 657
204 Ga0068854_100012301 3300005578 Bacteria 5601
205 Ga0068854_100121251 3300005578 Bacteria 1985
206 Ga0068854_100229281 3300005578 Bacteria 1473
207 Ga0068854_100239198 3300005578 Unclassified 1445
208 Ga0068854_101893586 3300005578 Unclassified 548
209 Ga0068856_100034613 3300005614 Bacteria 4947
210 Ga0068856_100040490 3300005614 Bacteria 4578
211 Ga0068856_100237586 3300005614 Bacteria 1838
212 Ga0068856_100289634 3300005614 Bacteria 1654
213 Ga0068856_101237533 3300005614 Unclassified 762
214 Ga0070702_100188773 3300005615 Bacteria 1354
215 Ga0068852_100006450 3300005616 Bacteria 8477
216 Ga0068852_100015304 3300005616 Bacteria 5940
217 Ga0068852_100151669 3300005616 Bacteria 2156
218 Ga0068852_100166847 3300005616 Bacteria 2061
219 Ga0068852_101274669 3300005616 Bacteria 756
220 Ga0068859_100000273 3300005617 Bacteria 51339
221 Ga0068859_100023653 3300005617 Bacteria 6167
222 Ga0068859_100377193 3300005617 Bacteria 1514
223 Ga0068859_102643653 3300005617 Bacteria 552
224 Ga0068864_100003949 3300005618 Bacteria 12219
225 Ga0068864_100019173 3300005618 Bacteria 5717
226 Ga0068866_10648564 3300005718 Bacteria 718
227 Ga0068861_100000427 3300005719 Bacteria 24490
228 Ga0068861_100007141 3300005719 Bacteria 7648
229 Ga0068861_100013796 3300005719 Bacteria 5661
230 Ga0068861_100272010 3300005719 Bacteria 1455
231 Ga0068851_10011106 3300005834 Bacteria 4218
232 Ga0068851_10075232 3300005834 Bacteria 1754
233 Ga0068851_10364957 3300005834 Bacteria 843
234 Ga0068851_10494570 3300005834 Bacteria 732
235 Ga0068870_10049726 3300005840 Bacteria 2213
236 Ga0068870_10080488 3300005840 Bacteria 1800
237 Ga0068870_10396420 3300005840 Bacteria 897
238 Ga0068870_10688718 3300005840 Bacteria 704
239 Ga0068863_100000481 3300005841 Bacteria 40838
240 Ga0068863_100013669 3300005841 Bacteria 7827
241 Ga0068863_100119355 3300005841 Bacteria 2514
242 Ga0068863_100208431 3300005841 Bacteria 1882
243 Ga0068863_100233343 3300005841 Bacteria 1775
244 Ga0068863_101181090 3300005841 Bacteria 771
245 Ga0068863_102260535 3300005841 Unclassified 554
246 Ga0068858_100002596 3300005842 Bacteria 18194
247 Ga0068858_100005607 3300005842 Bacteria 12275
248 Ga0068858_100109037 3300005842 Bacteria 2584
249 Ga0068858_100177237 3300005842 Bacteria 2012
250 Ga0068858_100457807 3300005842 Bacteria 1230
251 Ga0068860_100007130 3300005843 Bacteria 11183
252 Ga0068860_100010432 3300005843 Bacteria 9186
253 Ga0068860_100199058 3300005843 Bacteria 1941
254 Ga0068860_100788039 3300005843 Bacteria 963
255 Ga0068860_102103596 3300005843 Unclassified 586
256 Ga0068862_100027120 3300005844 Bacteria 4820
257 Ga0068862_100047894 3300005844 Bacteria 3648
258 Ga0068862_101929460 3300005844 Bacteria 601
259 Ga0068862_102173050 3300005844 Unclassified 566
260 Ga0070715_10020116 3300006163 Bacteria 2570
261 Ga0070716_100041430 3300006173 Bacteria 2565
262 Ga0070716_100165368 3300006173 Bacteria 1438
263 Ga0070712_100013307 3300006175 Bacteria 5254
264 Ga0070712_100079203 3300006175 Bacteria 2374
265 Ga0070712_100842957 3300006175 Bacteria 788
266 Ga0097621_100106481 3300006237 Bacteria 2365
267 Ga0097621_100352726 3300006237 Bacteria 1309
268 Ga0097621_100405148 3300006237 Bacteria 1222
269 Ga0097621_101347679 3300006237 Bacteria 675
270 Ga0068871_100092564 3300006358 Bacteria 2521
271 Ga0068871_100726159 3300006358 Bacteria 912
272 Ga0068871_100907973 3300006358 Bacteria 817
273 Ga0075428_100094004 3300006844 Bacteria 3269
274 Ga0075433_10697812 3300006852 Bacteria 889
275 Ga0075434_100482918 3300006871 Bacteria 1260
276 Ga0075434_101616017 3300006871 Bacteria 656
277 Ga0068865_100211626 3300006881 Bacteria 1511
278 Ga0075436_100057199 3300006914 Bacteria 2693
279 Ga0075436_100298711 3300006914 Bacteria 1154
280 Ga0075436_100959435 3300006914 Bacteria 641
281 Ga0097620_100000273 3300006931 Bacteria 51339
282 Ga0097620_100023652 3300006931 Bacteria 6167
283 Ga0097620_100377210 3300006931 Bacteria 1514
284 Ga0097620_102643894 3300006931 Bacteria 552
285 Ga0075435_100311210 3300007076 Bacteria 1348
286 Ga0075435_100651893 3300007076 Bacteria 914
287 Ga0105240_10080186 3300009093 Bacteria 4015
288 Ga0105240_10081138 3300009093 Bacteria 3986
289 Ga0105240_12215406 3300009093 Bacteria 570
290 Ga0105240_12689018 3300009093 Unclassified 513
291 Ga0111539_10940122 3300009094 Bacteria 1005
292 Ga0111539_12941483 3300009094 Bacteria 551
293 Ga0105245_10001222 3300009098 Bacteria 23189
294 Ga0105245_10031955 3300009098 Bacteria 4660
295 Ga0105247_10033255 3300009101 Bacteria 3136
296 Ga0105243_10198252 3300009148 Unclassified 1759
297 Ga0105241_10074769 3300009174 Bacteria 2639
298 Ga0105241_10184023 3300009174 Bacteria 1735
299 Ga0105241_11023674 3300009174 Bacteria 774
300 Ga0105242_10004578 3300009176 Bacteria 10725
301 Ga0105242_12174421 3300009176 Unclassified 600
302 Ga0105248_10002702 3300009177 Bacteria 19705
303 Ga0105248_10005230 3300009177 Bacteria 14296
304 Ga0105248_10174522 3300009177 Bacteria 2423
305 Ga0105248_10319383 3300009177 Bacteria 1749
306 Ga0105248_11230793 3300009177 Unclassified 847
307 Ga0105237_10063258 3300009545 Bacteria 3698
308 Ga0105237_10240787 3300009545 Bacteria 1810
309 Ga0105237_12687750 3300009545 Bacteria 509
310 Ga0105238_10140966 3300009551 Bacteria 2387
311 Ga0105238_10352163 3300009551 Bacteria 1461
312 Ga0105238_10396227 3300009551 Bacteria 1373
313 Ga0105249_11594703 3300009553 Bacteria 725
314 Ga0105239_10111660 3300010375 Bacteria 3031
315 Ga0105239_10161915 3300010375 Bacteria 2500
316 Ga0105239_10865987 3300010375 Bacteria 1036
317 Ga0105239_11652395 3300010375 Bacteria 741
318 Ga0105239_12832640 3300010375 Unclassified 566
319 Ga0105246_10098741 3300011119 Bacteria 2122
320 Ga0105246_10116576 3300011119 Bacteria 1972
321 Ga0157373_10000765 3300013100 Bacteria 24875
322 Ga0157373_10013081 3300013100 Bacteria 6090
323 Ga0157373_10157579 3300013100 Bacteria 1597
324 Ga0157373_10198832 3300013100 Bacteria 1413
325 Ga0157373_10344588 3300013100 Bacteria 1062
326 Ga0157373_10883045 3300013100 Bacteria 663
327 Ga0157371_10001306 3300013102 Bacteria 26185
328 Ga0157371_10262386 3300013102 Bacteria 1245
329 Ga0157371_10483799 3300013102 Unclassified 913
330 Ga0157371_10540369 3300013102 Bacteria 863
331 Ga0157370_10006265 3300013104 Bacteria 13174
332 Ga0157370_10014919 3300013104 Bacteria 7924
333 Ga0157370_10038341 3300013104 Bacteria 4636
334 Ga0157370_10207359 3300013104 Bacteria 1817
335 Ga0157370_10932918 3300013104 Bacteria 787
336 Ga0157369_10154258 3300013105 Bacteria 2427
337 Ga0157369_10278921 3300013105 Bacteria 1741
338 Ga0157369_11225614 3300013105 Bacteria 766
339 Ga0157369_12189313 3300013105 Unclassified 561
340 Ga0157374_10000975 3300013296 Bacteria 24811
341 Ga0157374_10053149 3300013296 Bacteria 3775
342 Ga0157374_10229285 3300013296 Bacteria 1824
343 Ga0157378_10004310 3300013297 Bacteria 12526
344 Ga0157378_10318159 3300013297 Bacteria 1511
345 Ga0157378_11981715 3300013297 Bacteria 632
346 Ga0157378_12142767 3300013297 Bacteria 610
347 Ga0163162_10000605 3300013306 Bacteria 33245
348 Ga0163162_10007895 3300013306 Bacteria 10370
349 Ga0157372_10000844 3300013307 Bacteria 33248
350 Ga0157372_10066011 3300013307 Bacteria 4065
351 Ga0157372_10145653 3300013307 Bacteria 2732
352 Ga0157372_10283069 3300013307 Bacteria 1928
353 Ga0157372_11903369 3300013307 Bacteria 684
354 Ga0157372_12068389 3300013307 Bacteria 654
355 Ga0157375_10003600 3300013308 Bacteria 13446
356 Ga0157375_10010115 3300013308 Bacteria 8293
357 Ga0157375_10152030 3300013308 Bacteria 2451
358 Ga0157375_11107814 3300013308 Bacteria 927
359 Ga0157375_11185699 3300013308 Bacteria 895
360 Ga0163163_10001296 3300014325 Bacteria 21137
361 Ga0163163_10018828 3300014325 Bacteria 6475
362 Ga0163163_10399762 3300014325 Bacteria 1432
363 Ga0157380_12183519 3300014326 Bacteria 617
364 Ga0182008_10477867 3300014497 Bacteria 682
365 Ga0157377_10230374 3300014745 Bacteria 1191
366 Ga0157377_10254568 3300014745 Bacteria 1140
367 Ga0157377_10427501 3300014745 Bacteria 909
368 Ga0157379_10000447 3300014968 Bacteria 33364
369 Ga0157379_10001351 3300014968 Bacteria 20063
370 Ga0157379_10103743 3300014968 Bacteria 2552
371 Ga0157379_10119220 3300014968 Bacteria 2373
372 Ga0157376_10001010 3300014969 Bacteria 18347
373 Ga0157376_10332511 3300014969 Bacteria 1448
374 Ga0157376_10408465 3300014969 Bacteria 1315
375 Ga0163161_10093401 3300017792 Bacteria 2229
376 Ga0197907_10459860 3300020069 Bacteria 561
377 Ga0206356_10387343 3300020070 Bacteria 1289
378 Ga0206356_10559324 3300020070 Bacteria 1770
379 Ga0206356_11441577 3300020070 Bacteria 611
380 Ga0206352_11228818 3300020078 Bacteria 1380
381 Ga0206350_11237156 3300020080 Bacteria 559
382 Ga0206354_10276827 3300020081 Bacteria 744
383 Ga0206353_10635863 3300020082 Bacteria 747
384 Ga0207697_10190805 3300025315 Bacteria 900
385 Ga0207656_10017740 3300025321 Bacteria 2792
386 Ga0207656_10070620 3300025321 Bacteria 1551
387 Ga0207656_10511028 3300025321 Bacteria 610
388 Ga0207692_10005550 3300025898 Bacteria 5061
389 Ga0207692_10389716 3300025898 Bacteria 866
390 Ga0207688_10720131 3300025901 Bacteria 631
391 Ga0207688_10945225 3300025901 Unclassified 545
392 Ga0207680_10007336 3300025903 Bacteria 5367
393 Ga0207685_10015508 3300025905 Bacteria 2416
394 Ga0207699_10019454 3300025906 Bacteria 3622
395 Ga0207699_10058310 3300025906 Bacteria 2309
396 Ga0207699_10126499 3300025906 Bacteria 1660
397 Ga0207699_10424601 3300025906 Unclassified 950
398 Ga0207699_10625418 3300025906 Bacteria 785
399 Ga0207645_10022731 3300025907 Bacteria 4076
400 Ga0207645_10031635 3300025907 Bacteria 3404
401 Ga0207645_10413725 3300025907 Bacteria 908
402 Ga0207643_10007633 3300025908 Bacteria 5813
403 Ga0207643_10037176 3300025908 Bacteria 2731
404 Ga0207643_10177933 3300025908 Bacteria 1286
405 Ga0207705_10033797 3300025909 Bacteria 3654
406 Ga0207705_10088974 3300025909 Bacteria 2259
407 Ga0207705_11458869 3300025909 Unclassified 519
408 Ga0207684_10036606 3300025910 Bacteria 4165
409 Ga0207654_10067151 3300025911 Bacteria 2118
410 Ga0207654_10107820 3300025911 Bacteria 1727
411 Ga0207654_10225633 3300025911 Bacteria 1245
412 Ga0207707_10007535 3300025912 Bacteria 9482
413 Ga0207707_10014161 3300025912 Bacteria 6949
414 Ga0207707_10064773 3300025912 Bacteria 3182
415 Ga0207707_10085186 3300025912 Bacteria 2761
416 Ga0207707_11084845 3300025912 Bacteria 653
417 Ga0207707_11159829 3300025912 Bacteria 627
418 Ga0207695_10066269 3300025913 Bacteria 3710
419 Ga0207695_10108830 3300025913 Bacteria 2755
420 Ga0207695_10120149 3300025913 Bacteria 2597
421 Ga0207695_10442373 3300025913 Bacteria 1183
422 Ga0207671_10049579 3300025914 Bacteria 3109
423 Ga0207671_10063565 3300025914 Bacteria 2743
424 Ga0207671_10430019 3300025914 Bacteria 1051
425 Ga0207693_10007409 3300025915 Bacteria 9025
426 Ga0207693_10050932 3300025915 Bacteria 3251
427 Ga0207693_10096303 3300025915 Bacteria 2320
428 Ga0207693_10230602 3300025915 Bacteria 1454
429 Ga0207663_10003277 3300025916 Bacteria 7899
430 Ga0207663_10041968 3300025916 Bacteria 2792
431 Ga0207663_10114023 3300025916 Bacteria 1839
432 Ga0207663_10214623 3300025916 Unclassified 1397
433 Ga0207660_10097859 3300025917 Bacteria 2187
434 Ga0207660_10641075 3300025917 Bacteria 866
435 Ga0207660_10913853 3300025917 Bacteria 716
436 Ga0207660_10984005 3300025917 Bacteria 688
437 Ga0207662_10049371 3300025918 Bacteria 2496
438 Ga0207657_10000936 3300025919 Bacteria 30891
439 Ga0207657_10015390 3300025919 Bacteria 7411
440 Ga0207657_10103367 3300025919 Bacteria 2361
441 Ga0207657_10345554 3300025919 Bacteria 1174
442 Ga0207657_10439668 3300025919 Bacteria 1024
443 Ga0207657_10858278 3300025919 Bacteria 700
444 Ga0207649_10003799 3300025920 Bacteria 8238
445 Ga0207649_10017139 3300025920 Bacteria 4102
446 Ga0207649_10048206 3300025920 Bacteria 2626
447 Ga0207649_10053932 3300025920 Bacteria 2501
448 Ga0207649_10134082 3300025920 Bacteria 1686
449 Ga0207649_11071716 3300025920 Bacteria 635
450 Ga0207649_11173511 3300025920 Bacteria 607
451 Ga0207652_10075575 3300025921 Bacteria 2936
452 Ga0207652_10098612 3300025921 Bacteria 2577
453 Ga0207652_10227726 3300025921 Bacteria 1680
454 Ga0207652_10253537 3300025921 Bacteria 1587
455 Ga0207646_10517495 3300025922 Bacteria 1074
456 Ga0207681_10005991 3300025923 Bacteria 7457
457 Ga0207681_10477311 3300025923 Bacteria 1018
458 Ga0207694_10125268 3300025924 Bacteria 2054
459 Ga0207694_10162545 3300025924 Bacteria 1804
460 Ga0207694_10270660 3300025924 Bacteria 1393
461 Ga0207650_10003642 3300025925 Bacteria 10555
462 Ga0207650_10008766 3300025925 Bacteria 6911
463 Ga0207650_10045903 3300025925 Unclassified 3215
464 Ga0207650_10045996 3300025925 Bacteria 3213
465 Ga0207650_10609986 3300025925 Bacteria 918
466 Ga0207659_10007101 3300025926 Bacteria 6877
467 Ga0207659_10103993 3300025926 Bacteria 2147
468 Ga0207659_10896017 3300025926 Bacteria 763
469 Ga0207659_10968711 3300025926 Unclassified 732
470 Ga0207687_10001719 3300025927 Bacteria 15101
471 Ga0207687_10052243 3300025927 Bacteria 2852
472 Ga0207700_10000042 3300025928 Bacteria 95374
473 Ga0207700_10177707 3300025928 Bacteria 1780
474 Ga0207700_10221102 3300025928 Bacteria 1605
475 Ga0207700_10621416 3300025928 Bacteria 962
476 Ga0207664_10005177 3300025929 Bacteria 8888
477 Ga0207664_10028518 3300025929 Bacteria 4243
478 Ga0207664_10077481 3300025929 Bacteria 2693
479 Ga0207664_10345144 3300025929 Bacteria 1317
480 Ga0207664_10786549 3300025929 Bacteria 856
481 Ga0207644_10010064 3300025931 Bacteria 6227
482 Ga0207644_10098307 3300025931 Bacteria 2193
483 Ga0207644_10353308 3300025931 Bacteria 1194
484 Ga0207644_10407340 3300025931 Bacteria 1112
485 Ga0207690_10001284 3300025932 Bacteria 15861
486 Ga0207690_10186262 3300025932 Bacteria 1566
487 Ga0207690_10396540 3300025932 Bacteria 1100
488 Ga0207690_10921531 3300025932 Bacteria 725
489 Ga0207690_11661864 3300025932 Bacteria 534
490 Ga0207706_10000631 3300025933 Bacteria 37435
491 Ga0207706_10009362 3300025933 Bacteria 8995
492 Ga0207706_10065400 3300025933 Bacteria 3202
493 Ga0207706_10278047 3300025933 Bacteria 1460
494 Ga0207706_11057621 3300025933 Unclassified 680
495 Ga0207686_10024077 3300025934 Bacteria 3522
496 Ga0207709_10102170 3300025935 Bacteria 1897
497 Ga0207670_10009887 3300025936 Bacteria 5463
498 Ga0207669_10194564 3300025937 Bacteria 1466
499 Ga0207704_11154194 3300025938 Bacteria 659
500 Ga0207665_10194537 3300025939 Bacteria 1475
501 Ga0207691_10000380 3300025940 Bacteria 44703
502 Ga0207691_10049384 3300025940 Bacteria 3855
503 Ga0207711_10000761 3300025941 Bacteria 31642
504 Ga0207711_10011222 3300025941 Bacteria 7446
505 Ga0207711_10050868 3300025941 Bacteria 3548
506 Ga0207689_10000118 3300025942 Bacteria 65374
507 Ga0207689_10004444 3300025942 Bacteria 12717
508 Ga0207689_10164000 3300025942 Bacteria 1831
509 Ga0207689_10306626 3300025942 Bacteria 1316
510 Ga0207689_10379978 3300025942 Bacteria 1176
511 Ga0207661_10046550 3300025944 Bacteria 3440
512 Ga0207661_10075208 3300025944 Bacteria 2770
513 Ga0207661_11380492 3300025944 Bacteria 647
514 Ga0207679_10007049 3300025945 Bacteria 7127
515 Ga0207679_10136125 3300025945 Bacteria 1978
516 Ga0207679_10153143 3300025945 Bacteria 1879
517 Ga0207679_10523571 3300025945 Bacteria 1061
518 Ga0207679_11184306 3300025945 Bacteria 701
519 Ga0207667_10002636 3300025949 Bacteria 22187
520 Ga0207667_10085814 3300025949 Bacteria 3258
521 Ga0207667_10136640 3300025949 Bacteria 2524
522 Ga0207667_10233885 3300025949 Bacteria 1881
523 Ga0207667_10324593 3300025949 Bacteria 1572
524 Ga0207667_10680402 3300025949 Bacteria 1032
525 Ga0207651_10001194 3300025960 Bacteria 11632
526 Ga0207651_10050075 3300025960 Bacteria 2834
527 Ga0207712_12120350 3300025961 Bacteria 503
528 Ga0207668_10003515 3300025972 Bacteria 9203
529 Ga0207668_10119581 3300025972 Bacteria 1992
530 Ga0207668_10125463 3300025972 Bacteria 1951
531 Ga0207668_10830350 3300025972 Bacteria 819
532 Ga0207668_10958363 3300025972 Bacteria 763
533 Ga0207668_11246105 3300025972 Bacteria 669
534 Ga0207640_10022825 3300025981 Bacteria 3752
535 Ga0207640_10024277 3300025981 Bacteria 3656
536 Ga0207640_10170055 3300025981 Bacteria 1623
537 Ga0207640_10213385 3300025981 Bacteria 1472
538 Ga0207640_10861934 3300025981 Bacteria 789
539 Ga0207640_11393351 3300025981 Unclassified 628
540 Ga0207658_10021443 3300025986 Bacteria 4485
541 Ga0207658_10037696 3300025986 Bacteria 3476
542 Ga0207658_10127967 3300025986 Bacteria 2035
543 Ga0207658_10275836 3300025986 Bacteria 1439
544 Ga0207658_11851543 3300025986 Unclassified 550
545 Ga0207658_12091230 3300025986 Bacteria 515
546 Ga0207677_10000579 3300026023 Bacteria 22831
547 Ga0207677_10311323 3300026023 Bacteria 1305
548 Ga0207677_10362753 3300026023 Bacteria 1218
549 Ga0207677_10427648 3300026023 Bacteria 1129
550 Ga0207677_11078956 3300026023 Bacteria 731
551 Ga0207703_10000837 3300026035 Bacteria 30296
552 Ga0207703_10006533 3300026035 Bacteria 9303
553 Ga0207703_10617892 3300026035 Bacteria 1026
554 Ga0207639_10052073 3300026041 Bacteria 3117
555 Ga0207639_10080266 3300026041 Bacteria 2580
556 Ga0207639_10153732 3300026041 Bacteria 1930
557 Ga0207639_10292178 3300026041 Bacteria 1437
558 Ga0207678_10044204 3300026067 Bacteria 3854
559 Ga0207678_10132528 3300026067 Bacteria 2127
560 Ga0207678_10289085 3300026067 Bacteria 1408
561 Ga0207678_11525375 3300026067 Bacteria 590
562 Ga0207708_10287055 3300026075 Bacteria 1335
563 Ga0207708_11326405 3300026075 Bacteria 631
564 Ga0207702_10015054 3300026078 Bacteria 6414
565 Ga0207702_10049659 3300026078 Bacteria 3540
566 Ga0207702_10390274 3300026078 Bacteria 1340
567 Ga0207641_10003274 3300026088 Bacteria 14415
568 Ga0207641_10034867 3300026088 Bacteria 4188
569 Ga0207641_10046082 3300026088 Bacteria 3675
570 Ga0207641_10178200 3300026088 Bacteria 1945
571 Ga0207641_10195112 3300026088 Bacteria 1863
572 Ga0207641_10503272 3300026088 Bacteria 1177
573 Ga0207641_12020022 3300026088 Unclassified 578
574 Ga0207648_10005815 3300026089 Bacteria 12352
575 Ga0207648_10379115 3300026089 Bacteria 1278
576 Ga0207648_10596044 3300026089 Bacteria 1018
577 Ga0207676_10002905 3300026095 Bacteria 12218
578 Ga0207676_10038977 3300026095 Bacteria 3631
579 Ga0207676_10045659 3300026095 Bacteria 3386
580 Ga0207674_10004126 3300026116 Bacteria 17572
581 Ga0207674_10005149 3300026116 Bacteria 15593
582 Ga0207674_10175067 3300026116 Bacteria 2098
583 Ga0207674_10468962 3300026116 Bacteria 1217
584 Ga0207674_11082084 3300026116 Bacteria 771
585 Ga0207675_100000975 3300026118 Bacteria 28412
586 Ga0207675_100005676 3300026118 Bacteria 11943
587 Ga0207675_100011191 3300026118 Bacteria 8401
588 Ga0207675_100085036 3300026118 Bacteria 2968
589 Ga0207683_10495351 3300026121 Unclassified 1128
590 Ga0207683_11076963 3300026121 Bacteria 746
591 Ga0207698_10025332 3300026142 Bacteria 4177
592 Ga0207698_10075624 3300026142 Bacteria 2692
593 Ga0207698_10282705 3300026142 Bacteria 1535
594 Ga0207698_12048784 3300026142 Bacteria 586
595 Ga0209970_1009347 3300027614 Bacteria 1602
596 Ga0207428_10710530 3300027907 Bacteria 718
597 Ga0268266_10011531 3300028379 Bacteria 7675
598 Ga0268266_10116197 3300028379 Bacteria 2376
599 Ga0268266_10561882 3300028379 Bacteria 1094
600 Ga0268266_10709239 3300028379 Bacteria 970
601 Ga0268266_12029580 3300028379 Bacteria 548
602 Ga0268265_10077978 3300028380 Bacteria 2604
603 Ga0268265_10155096 3300028380 Bacteria 1937
604 Ga0268264_10000740 3300028381 Bacteria 37012
605 Ga0268264_10001347 3300028381 Bacteria 23033
606 Ga0268264_10018090 3300028381 Bacteria 5765
607 Ga0268264_10028598 3300028381 Bacteria 4561
608 Ga0268264_10056833 3300028381 Bacteria 3271
609 Ga0307411_11892594 3300032005 Bacteria 555
610 Ga0373928_0191299 3300035084 Bacteria 586
611 Ga0373934_0003700 3300035086 Bacteria 5628
612 Ga0373934_0331310 3300035086 Unclassified 633
613 Ga0373944_0314006 3300035089 Unclassified 590
614 Ga0373923_0008171 3300035111 Bacteria 3718
615 Ga0373936_0059564 3300035113 Bacteria 1556
616 Ga0373945_0044703 3300035116 Unclassified 1611
617 Ga0373953_0022065 3300035117 Bacteria 2396
618 Ga0373954_0002880 3300035118 Bacteria 7257
619 Ga0373954_0073012 3300035118 Bacteria 1632
620 Ga0373954_0378498 3300035118 Bacteria 699
621 Ga0373956_0021441 3300035119 Bacteria 2756
622 Ga0373956_0094435 3300035119 Bacteria 1382
623 Ga0373957_0007733 3300035120 Bacteria 3451
624 Ga0373943_0007473 3300035170 Bacteria 4910
625 Ga0373943_0008501 3300035170 Bacteria 4604
626 Ga0373943_0073635 3300035170 Bacteria 1735
627 Ga0373946_0084884 3300035171 Bacteria 1393
628 Ga0373946_0663964 3300035171 Bacteria 543
629 Ga0373955_0009340 3300035172 Bacteria 4591
630 Ga0373955_0067434 3300035172 Bacteria 1992
631 Ga0373955_0083459 3300035172 Bacteria 1810
632 Ga0373924_0016537 3300035410 Bacteria 2816
633 Ga0373924_0111328 3300035410 Bacteria 1183
634 Ga0373931_0067071 3300035691 Bacteria 1949
635 Ga0373931_0110102 3300035691 Bacteria 1561
636 Ga0373935_0006155 3300035692 Bacteria 7141
637 Ga0373935_0099416 3300035692 Bacteria 1915
638 Ga0373927_0048565 3300035695 Bacteria 2745
639 Ga0373927_0076321 3300035695 Bacteria 2170
640 Ga0373933_0024412 3300035724 Bacteria 3461
641 Ga0373933_0103160 3300035724 Bacteria 1771
642 Ga0373947_0016171 3300035725 Bacteria 4288
643 Ga0373947_0046620 3300035725 Bacteria 2596
644 Ga0373947_0104493 3300035725 Bacteria 1783
645 Ga0373947_0885301 3300035725 Unclassified 609
646 Ga0373937_0041363 3300036401 Bacteria 4203
647 Ga0373937_0057532 3300036401 Bacteria 3572
648 Ga0373937_0115319 3300036401 Bacteria 2501
649 Ga0373925_0024021 3300037068 Bacteria 4448
650 Ga0373925_0382274 3300037068 Bacteria 1146
651 Ga0373925_0402495 3300037068 Bacteria 1116
652 Ga0395900_0058366 3300037418 Bacteria 3973
653 Ga0395900_0142613 3300037418 Bacteria 2452
654 Ga0395898_0353641 3300037466 Bacteria 1401
655 Ga0395905_0254480 3300037471 Bacteria 1640
656 Ga0395901_0239343 3300038443 Bacteria 1893
657 Ga0451807_2424974 3300041486 Unclassified 883
658 Ga0451835_0139379 3300041492 Bacteria 814
659 Ga0451847_0444973 3300041503 Archaea 1001
660 Ga0451853_1881781 3300041512 Bacteria 586
661 Ga0450913_016214 3300042117 Bacteria 649
662 Ga0466959_0973467 3300045049 Bacteria 565
663 Ga0495592_0148125 3300046454 Bacteria 1626
664 Ga0495629_0094560 3300046459 Bacteria 2086
665 Ga0495653_0100509 3300046463 Bacteria 2097
666 Ga0495580_0031489 3300046472 Bacteria 3832
667 Ga0495580_0288663 3300046472 Bacteria 1118
668 Ga0495580_0797505 3300046472 Bacteria 612
669 Ga0495582_0043823 3300046473 Bacteria 2463
670 Ga0495639_0013809 3300046475 Bacteria 3491
671 Ga0495662_0081010 3300046476 Bacteria 1578
672 Ga0495618_0256501 3300046514 Bacteria 1096
673 Ga0495628_0138829 3300046516 Bacteria 1856
674 Ga0495666_0168725 3300046526 Unclassified 1013
675 Ga0495665_0072267 3300046531 Bacteria 1816
676 Ga0495640_0126008 3300046533 Bacteria 1661
677 Ga0495640_0700774 3300046533 Bacteria 607
678 Ga0495586_0316616 3300046535 Unclassified 895
679 Ga0495586_0554304 3300046535 Bacteria 664
680 Ga0495645_0016294 3300046543 Bacteria 5304
681 Ga0495645_0062931 3300046543 Bacteria 2687
682 Ga0495667_0380483 3300046559 Bacteria 890
683 Ga0495635_0025493 3300046663 Bacteria 4119
684 Ga0495635_0147635 3300046663 Unclassified 1601
685 Ga0495657_0421697 3300046675 Bacteria 783
686 Ga0495657_0718723 3300046675 Unclassified 574
687 Ga0495599_0184604 3300046678 Bacteria 1285
688 Ga0495623_0105783 3300046679 Bacteria 1710
689 Ga0495623_0309557 3300046679 Bacteria 870
690 Ga0495647_0051646 3300046681 Bacteria 1598
691 Ga0495658_0068222 3300046683 Bacteria 2058
692 Ga0495613_0057444 3300046689 Bacteria 2857
693 Ga0495600_0074964 3300046809 Bacteria 2210
694 Ga0495581_0247848 3300047315 Bacteria 1041
695 Ga0495684_0429038 3300047471 Bacteria 922
696 Ga0495593_0035273 3300047673 Bacteria 2717
697 Ga0495602_0135170 3300048088 Bacteria 1960
698 Ga0495602_0181157 3300048088 Bacteria 1625
699 Ga0495614_0035172 3300048089 Bacteria 2153
700 Ga0496100_0237108 3300048903 Bacteria 1345
701 Ga0496101_0741377 3300048904 Bacteria 775
702 Ga0496102_0013361 3300048905 Bacteria 7112
703 Ga0496102_0152658 3300048905 Bacteria 2171
704 Ga0496102_0487337 3300048905 Bacteria 1154
705 Ga0496103_0104567 3300048906 Bacteria 1795
706 Ga0496103_0280923 3300048906 Bacteria 1071
707 Ga0496104_0120924 3300048907 Bacteria 2514
708 Ga0496105_0221641 3300048908 Bacteria 1539
709 Ga0496106_0010984 3300048909 Bacteria 6695
710 Ga0496107_0013238 3300048910 Bacteria 5764
711 Ga0496107_0020560 3300048910 Bacteria 4664
712 Ga0496108_0078498 3300048911 Bacteria 2794
713 Ga0496109_0328212 3300048912 Bacteria 1444
714 Ga0496110_0484484 3300048913 Bacteria 1127
715 Ga0496111_0565069 3300048914 Bacteria 834
716 Ga0496112_0016919 3300048915 Bacteria 6843
717 Ga0496112_0098235 3300048915 Bacteria 2898
718 Ga0496113_0354730 3300048916 Bacteria 1177
719 Ga0496114_0632395 3300048917 Bacteria 942
720 Ga0496115_0025357 3300048918 Bacteria 4616
721 Ga0496115_0324497 3300048918 Bacteria 1259
722 Ga0501036_1667352 3300049572 Unclassified 514
723 Ga0501067_0085508 3300049583 Bacteria 1750
724 Ga0501068_1086255 3300049584 Bacteria 529
725 Ga0501069_0668028 3300049585 Bacteria 626
726 Ga0501070_0158373 3300049586 Bacteria 1867
727 Ga0501071_1299541 3300049587 Bacteria 562
728 Ga0501076_0541144 3300049592 Bacteria 960
729 Ga0501080_0255009 3300049742 Bacteria 1599
730 Ga0501083_0056326 3300049744 Bacteria 2634
731 Ga0501045_0425074 3300049824 Bacteria 988
732 nmdc:mga08y16_824101_c1 3300050511 Bacteria 919
733 nmdc:mga0n895_1091233_c1 3300050512 Bacteria 776
734 nmdc:mga0rr50_488968_c1 3300050513 Bacteria 1045
735 nmdc:mga08x19_37508_c1 3300050514 Bacteria 3076
736 nmdc:mga08x19_432289_c1 3300050514 Bacteria 925
737 nmdc:mga08x19_568599_c1 3300050514 Bacteria 803
738 nmdc:mga0a205_965429_c1 3300050515 Bacteria 699
739 Ga0495601_0151179 3300053077 Unclassified 1516
740 Ga0495601_0678600 3300053077 Bacteria 658
741 Ga0495612_0239852 3300053078 Bacteria 805
742 Ga0495595_0101470 3300053084 Bacteria 1389
743 Ga0495619_0052331 3300053085 Bacteria 2699
744 Ga0495619_0059578 3300053085 Bacteria 2536
745 Ga0495619_0573571 3300053085 Bacteria 773
746 Ga0587083_0001570 3300059505 Bacteria 2610
747 Ga0587088_003983 3300059508 Bacteria 1837
748 Ga0587107_003238 3300059652 Bacteria 1561
749 Ga0587119_004300 3300059658 Bacteria 1403
750 Ga0587111_0011775 3300060346 Bacteria 1532
751 Ga0501082_0505228 3300060353 Bacteria 1057
752 Ga0070683_101315864
753 Ga0058862_12601173
754 Ga0070658_10047589
755 Ga0070658_10064642
756 Ga0070658_10207698
757 Ga0070658_10651037
758 Ga0070658_10711983
759 Ga0070676_10008388
760 Ga0070676_10573922
761 Ga0070676_10710414
762 Ga0070683_100043242
763 Ga0070683_100207360
764 Ga0070683_100840438
765 Ga0070683_101789171
766 Ga0070690_100012312
767 Ga0070690_100193034
768 Ga0070670_100019027
769 Ga0070670_100040620
770 Ga0070670_100049409
771 Ga0070670_100049714
772 Ga0070670_100099521
773 Ga0070670_100118296
774 Ga0070670_100403508
775 Ga0070677_10610894
776 Ga0068869_100010460
777 Ga0068869_100028097
778 Ga0068869_100232014
779 Ga0068869_100244731
780 Ga0068869_100714972
781 Ga0070666_10014301
782 Ga0070666_10085933
783 Ga0070666_10566503
784 Ga0070680_100034056
785 Ga0070680_100745019
786 Ga0070682_100268378
787 Ga0070682_100288616
788 Ga0068868_100002005
789 Ga0068868_100072715
790 Ga0068868_100077016
791 Ga0068868_100314057
792 Ga0068868_100364918
793 Ga0068868_100704587
794 Ga0070660_100000365
795 Ga0070660_100075839
796 Ga0070660_100156866
797 Ga0070660_100419157
798 Ga0070660_100482730
799 Ga0070660_100838963
800 Ga0070660_100849851
801 Ga0070689_100007573
802 Ga0070689_100131860
803 Ga0070691_10095638
804 Ga0070687_100005943
805 Ga0070687_100904094
806 Ga0070661_100003648
807 Ga0070661_100018040
808 Ga0070661_100019233
809 Ga0070661_100034406
810 Ga0070661_100064656
811 Ga0070661_101493071
812 Ga0070692_10010933
813 Ga0070668_100002155
814 Ga0070668_100048818
815 Ga0070668_100196410
816 Ga0070668_100206063
817 Ga0070669_100018177
818 Ga0070669_100665907
819 Ga0070675_100074015
820 Ga0070675_100099251
821 Ga0070675_100559111
822 Ga0070675_101332247
823 Ga0070675_101404103
824 Ga0070675_101828221
825 Ga0070671_100067084
826 Ga0070671_100144282
827 Ga0070671_100677292
828 Ga0070671_101057070
829 Ga0070671_101622610
830 Ga0070674_100354578
831 Ga0070673_100000324
832 Ga0070673_100009545
833 Ga0070673_101245674
834 Ga0070688_100002357
835 Ga0070688_100382397
836 Ga0070688_101228466
837 Ga0070659_100004698
838 Ga0070659_100087781
839 Ga0070659_101038705
840 Ga0070659_101121711
841 Ga0070667_100001782
842 Ga0070667_100004198
843 Ga0070667_100167889
844 Ga0070667_100184716
845 Ga0070667_100455116
846 Ga0070667_101579013
847 Ga0070709_10013878
848 Ga0070709_10028489
849 Ga0070709_10078952
850 Ga0070709_10099991
851 Ga0070709_10544574
852 Ga0070714_100004104
853 Ga0070714_100762759
854 Ga0070714_101083244
855 Ga0070714_101221238
856 Ga0070713_100000694
857 Ga0070713_100018657
858 Ga0070713_100466860
859 Ga0070710_10010607
860 Ga0070710_10063869
861 Ga0070701_10156736
862 Ga0070711_100006795
863 Ga0070711_100082603
864 Ga0070711_100590144
865 Ga0070711_100760773
866 Ga0070705_100033043
867 Ga0070700_100195241
868 Ga0070700_101215283
869 Ga0070694_100007279
870 Ga0070708_100000333
871 Ga0070708_100150204
872 Ga0070663_100031833
873 Ga0070663_100267175
874 Ga0070663_100311917
875 Ga0070663_101445824
876 Ga0070663_101879573
877 Ga0070678_100828068
878 Ga0070678_101796354
879 Ga0070662_100000291
880 Ga0070662_100095101
881 Ga0070662_100145461
882 Ga0070662_100450746
883 Ga0070681_10027102
884 Ga0070681_10043287
885 Ga0070681_10275598
886 Ga0070681_10815420
887 Ga0068867_100007747
888 Ga0068867_100137365
889 Ga0070685_10006747
890 Ga0070706_100016833
891 Ga0070706_101647347
892 Ga0070707_100012540
893 Ga0070698_100220429
894 Ga0070698_102223898
895 Ga0070699_100093061
896 Ga0070699_100115150
897 Ga0070699_100163695
898 Ga0070699_102000419
899 Ga0070679_100005607
900 Ga0070679_100158528
901 Ga0070679_100565363
902 Ga0070679_100650864
903 Ga0070684_100134099
904 Ga0070684_100705511
905 Ga0070684_101003436
906 Ga0070684_101106352
907 Ga0070697_100248580
908 Ga0068853_100041652
909 Ga0068853_100083963
910 Ga0068853_100134023
911 Ga0068853_100422047
912 Ga0068853_100449645
913 Ga0068853_101559648
914 Ga0068853_101569299
915 Ga0068853_101769732
916 Ga0068853_102451491
917 Ga0070672_100003665
918 Ga0070672_100031801
919 Ga0070672_100559907
920 Ga0070686_100057282
921 Ga0070695_100047645
922 Ga0070696_100025912
923 Ga0070696_100111966
924 Ga0070696_100908436
925 Ga0070696_101437973
926 Ga0070693_100065064
927 Ga0070693_100230696
928 Ga0070693_101631916
929 Ga0070693_101676567
930 Ga0070665_100004289
931 Ga0070665_100070286
932 Ga0070665_100915137
933 Ga0070665_101289007
934 Ga0070665_102467641
935 Ga0070704_100020038
936 Ga0070704_100233398
937 Ga0068855_100001546
938 Ga0068855_100073768
939 Ga0068855_100145201
940 Ga0068855_100347401
941 Ga0068855_100649793
942 Ga0070664_100043303
943 Ga0070664_100138383
944 Ga0070664_100437436
945 Ga0070664_100614662
946 Ga0070664_100622532
947 Ga0070664_100753639
948 Ga0068857_100007190
949 Ga0068857_100115248
950 Ga0068857_100197641
951 Ga0068857_100201859
952 Ga0068857_100609233
953 Ga0068857_101297389
954 Ga0068857_101501083
955 Ga0068854_100012301
956 Ga0068854_100121251
957 Ga0068854_100229281
958 Ga0068854_100239198
959 Ga0068854_101893586
960 Ga0068856_100034613
961 Ga0068856_100040490
962 Ga0068856_100237586
963 Ga0068856_100289634
964 Ga0068856_101237533
965 Ga0070702_100188773
966 Ga0068852_100006450
967 Ga0068852_100015304
968 Ga0068852_100151669
969 Ga0068852_100166847
970 Ga0068852_101274669
971 Ga0068859_100000273
972 Ga0068859_100023653
973 Ga0068859_100377193
974 Ga0068859_102643653
975 Ga0068864_100003949
976 Ga0068864_100019173
977 Ga0068866_10648564
978 Ga0068861_100000427
979 Ga0068861_100007141
980 Ga0068861_100013796
981 Ga0068861_100272010
982 Ga0068851_10011106
983 Ga0068851_10075232
984 Ga0068851_10364957
985 Ga0068851_10494570
986 Ga0068870_10049726
987 Ga0068870_10080488
988 Ga0068870_10396420
989 Ga0068870_10688718
990 Ga0068863_100000481
991 Ga0068863_100013669
992 Ga0068863_100119355
993 Ga0068863_100208431
994 Ga0068863_100233343
995 Ga0068863_101181090
996 Ga0068863_102260535
997 Ga0068858_100002596
998 Ga0068858_100005607
999 Ga0068858_100109037
1000 Ga0068858_100177237
1001 Ga0068858_100457807
1002 Ga0068860_100007130
1003 Ga0068860_100010432
1004 Ga0068860_100199058
1005 Ga0068860_100788039
1006 Ga0068860_102103596
1007 Ga0068862_100027120
1008 Ga0068862_100047894
1009 Ga0068862_101929460
1010 Ga0068862_102173050
1011 Ga0070715_10020116
1012 Ga0070716_100041430
1013 Ga0070716_100165368
1014 Ga0070712_100013307
1015 Ga0070712_100079203
1016 Ga0070712_100842957
1017 Ga0097621_100106481
1018 Ga0097621_100352726
1019 Ga0097621_100405148
1020 Ga0097621_101347679
1021 Ga0068871_100092564
1022 Ga0068871_100726159
1023 Ga0068871_100907973
1024 Ga0075428_100094004
1025 Ga0075433_10697812
1026 Ga0075434_100482918
1027 Ga0075434_101616017
1028 Ga0068865_100211626
1029 Ga0075436_100057199
1030 Ga0075436_100298711
1031 Ga0075436_100959435
1032 Ga0097620_100000273
1033 Ga0097620_100023652
1034 Ga0097620_100377210
1035 Ga0097620_102643894
1036 Ga0075435_100311210
1037 Ga0075435_100651893
1038 Ga0105240_10080186
1039 Ga0105240_10081138
1040 Ga0105240_12215406
1041 Ga0105240_12689018
1042 Ga0111539_10940122
1043 Ga0111539_12941483
1044 Ga0105245_10001222
1045 Ga0105245_10031955
1046 Ga0105247_10033255
1047 Ga0105243_10198252
1048 Ga0105241_10074769
1049 Ga0105241_10184023
1050 Ga0105241_11023674
1051 Ga0105242_10004578
1052 Ga0105242_12174421
1053 Ga0105248_10002702
1054 Ga0105248_10005230
1055 Ga0105248_10174522
1056 Ga0105248_10319383
1057 Ga0105248_11230793
1058 Ga0105237_10063258
1059 Ga0105237_10240787
1060 Ga0105237_12687750
1061 Ga0105238_10140966
1062 Ga0105238_10352163
1063 Ga0105238_10396227
1064 Ga0105249_11594703
1065 Ga0105239_10111660
1066 Ga0105239_10161915
1067 Ga0105239_10865987
1068 Ga0105239_11652395
1069 Ga0105239_12832640
1070 Ga0105246_10098741
1071 Ga0105246_10116576
1072 Ga0157373_10000765
1073 Ga0157373_10013081
1074 Ga0157373_10157579
1075 Ga0157373_10198832
1076 Ga0157373_10344588
1077 Ga0157373_10883045
1078 Ga0157371_10001306
1079 Ga0157371_10262386
1080 Ga0157371_10483799
1081 Ga0157371_10540369
1082 Ga0157370_10006265
1083 Ga0157370_10014919
1084 Ga0157370_10038341
1085 Ga0157370_10207359
1086 Ga0157370_10932918
1087 Ga0157369_10154258
1088 Ga0157369_10278921
1089 Ga0157369_11225614
1090 Ga0157369_12189313
1091 Ga0157374_10000975
1092 Ga0157374_10053149
1093 Ga0157374_10229285
1094 Ga0157378_10004310
1095 Ga0157378_10318159
1096 Ga0157378_11981715
1097 Ga0157378_12142767
1098 Ga0163162_10000605
1099 Ga0163162_10007895
1100 Ga0157372_10000844
1101 Ga0157372_10066011
1102 Ga0157372_10145653
1103 Ga0157372_10283069
1104 Ga0157372_11903369
1105 Ga0157372_12068389
1106 Ga0157375_10003600
1107 Ga0157375_10010115
1108 Ga0157375_10152030
1109 Ga0157375_11107814
1110 Ga0157375_11185699
1111 Ga0163163_10001296
1112 Ga0163163_10018828
1113 Ga0163163_10399762
1114 Ga0157380_12183519
1115 Ga0182008_10477867
1116 Ga0157377_10230374
1117 Ga0157377_10254568
1118 Ga0157377_10427501
1119 Ga0157379_10000447
1120 Ga0157379_10001351
1121 Ga0157379_10103743
1122 Ga0157379_10119220
1123 Ga0157376_10001010
1124 Ga0157376_10332511
1125 Ga0157376_10408465
1126 Ga0163161_10093401
1127 Ga0197907_10459860
1128 Ga0206356_10387343
1129 Ga0206356_10559324
1130 Ga0206356_11441577
1131 Ga0206352_11228818
1132 Ga0206350_11237156
1133 Ga0206354_10276827
1134 Ga0206353_10635863
1135 Ga0207697_10190805
1136 Ga0207656_10017740
1137 Ga0207656_10070620
1138 Ga0207656_10511028
1139 Ga0207692_10005550
1140 Ga0207692_10389716
1141 Ga0207688_10720131
1142 Ga0207688_10945225
1143 Ga0207680_10007336
1144 Ga0207685_10015508
1145 Ga0207699_10019454
1146 Ga0207699_10058310
1147 Ga0207699_10126499
1148 Ga0207699_10424601
1149 Ga0207699_10625418
1150 Ga0207645_10022731
1151 Ga0207645_10031635
1152 Ga0207645_10413725
1153 Ga0207643_10007633
1154 Ga0207643_10037176
1155 Ga0207643_10177933
1156 Ga0207705_10033797
1157 Ga0207705_10088974
1158 Ga0207705_11458869
1159 Ga0207684_10036606
1160 Ga0207654_10067151
1161 Ga0207654_10107820
1162 Ga0207654_10225633
1163 Ga0207707_10007535
1164 Ga0207707_10014161
1165 Ga0207707_10064773
1166 Ga0207707_10085186
1167 Ga0207707_11084845
1168 Ga0207707_11159829
1169 Ga0207695_10066269
1170 Ga0207695_10108830
1171 Ga0207695_10120149
1172 Ga0207695_10442373
1173 Ga0207671_10049579
1174 Ga0207671_10063565
1175 Ga0207671_10430019
1176 Ga0207693_10007409
1177 Ga0207693_10050932
1178 Ga0207693_10096303
1179 Ga0207693_10230602
1180 Ga0207663_10003277
1181 Ga0207663_10041968
1182 Ga0207663_10114023
1183 Ga0207663_10214623
1184 Ga0207660_10097859
1185 Ga0207660_10641075
1186 Ga0207660_10913853
1187 Ga0207660_10984005
1188 Ga0207662_10049371
1189 Ga0207657_10000936
1190 Ga0207657_10015390
1191 Ga0207657_10103367
1192 Ga0207657_10345554
1193 Ga0207657_10439668
1194 Ga0207657_10858278
1195 Ga0207649_10003799
1196 Ga0207649_10017139
1197 Ga0207649_10048206
1198 Ga0207649_10053932
1199 Ga0207649_10134082
1200 Ga0207649_11071716
1201 Ga0207649_11173511
1202 Ga0207652_10075575
1203 Ga0207652_10098612
1204 Ga0207652_10227726
1205 Ga0207652_10253537
1206 Ga0207646_10517495
1207 Ga0207681_10005991
1208 Ga0207681_10477311
1209 Ga0207694_10125268
1210 Ga0207694_10162545
1211 Ga0207694_10270660
1212 Ga0207650_10003642
1213 Ga0207650_10008766
1214 Ga0207650_10045903
1215 Ga0207650_10045996
1216 Ga0207650_10609986
1217 Ga0207659_10007101
1218 Ga0207659_10103993
1219 Ga0207659_10896017
1220 Ga0207659_10968711
1221 Ga0207687_10001719
1222 Ga0207687_10052243
1223 Ga0207700_10000042
1224 Ga0207700_10177707
1225 Ga0207700_10221102
1226 Ga0207700_10621416
1227 Ga0207664_10005177
1228 Ga0207664_10028518
1229 Ga0207664_10077481
1230 Ga0207664_10345144
1231 Ga0207664_10786549
1232 Ga0207644_10010064
1233 Ga0207644_10098307
1234 Ga0207644_10353308
1235 Ga0207644_10407340
1236 Ga0207690_10001284
1237 Ga0207690_10186262
1238 Ga0207690_10396540
1239 Ga0207690_10921531
1240 Ga0207690_11661864
1241 Ga0207706_10000631
1242 Ga0207706_10009362
1243 Ga0207706_10065400
1244 Ga0207706_10278047
1245 Ga0207706_11057621
1246 Ga0207686_10024077
1247 Ga0207709_10102170
1248 Ga0207670_10009887
1249 Ga0207669_10194564
1250 Ga0207704_11154194
1251 Ga0207665_10194537
1252 Ga0207691_10000380
1253 Ga0207691_10049384
1254 Ga0207711_10000761
1255 Ga0207711_10011222
1256 Ga0207711_10050868
1257 Ga0207689_10000118
1258 Ga0207689_10004444
1259 Ga0207689_10164000
1260 Ga0207689_10306626
1261 Ga0207689_10379978
1262 Ga0207661_10046550
1263 Ga0207661_10075208
1264 Ga0207661_11380492
1265 Ga0207679_10007049
1266 Ga0207679_10136125
1267 Ga0207679_10153143
1268 Ga0207679_10523571
1269 Ga0207679_11184306
1270 Ga0207667_10002636
1271 Ga0207667_10085814
1272 Ga0207667_10136640
1273 Ga0207667_10233885
1274 Ga0207667_10324593
1275 Ga0207667_10680402
1276 Ga0207651_10001194
1277 Ga0207651_10050075
1278 Ga0207712_12120350
1279 Ga0207668_10003515
1280 Ga0207668_10119581
1281 Ga0207668_10125463
1282 Ga0207668_10830350
1283 Ga0207668_10958363
1284 Ga0207668_11246105
1285 Ga0207640_10022825
1286 Ga0207640_10024277
1287 Ga0207640_10170055
1288 Ga0207640_10213385
1289 Ga0207640_10861934
1290 Ga0207640_11393351
1291 Ga0207658_10021443
1292 Ga0207658_10037696
1293 Ga0207658_10127967
1294 Ga0207658_10275836
1295 Ga0207658_11851543
1296 Ga0207658_12091230
1297 Ga0207677_10000579
1298 Ga0207677_10311323
1299 Ga0207677_10362753
1300 Ga0207677_10427648
1301 Ga0207677_11078956
1302 Ga0207703_10000837
1303 Ga0207703_10006533
1304 Ga0207703_10617892
1305 Ga0207639_10052073
1306 Ga0207639_10080266
1307 Ga0207639_10153732
1308 Ga0207639_10292178
1309 Ga0207678_10044204
1310 Ga0207678_10132528
1311 Ga0207678_10289085
1312 Ga0207678_11525375
1313 Ga0207708_10287055
1314 Ga0207708_11326405
1315 Ga0207702_10015054
1316 Ga0207702_10049659
1317 Ga0207702_10390274
1318 Ga0207641_10003274
1319 Ga0207641_10034867
1320 Ga0207641_10046082
1321 Ga0207641_10178200
1322 Ga0207641_10195112
1323 Ga0207641_10503272
1324 Ga0207641_12020022
1325 Ga0207648_10005815
1326 Ga0207648_10379115
1327 Ga0207648_10596044
1328 Ga0207676_10002905
1329 Ga0207676_10038977
1330 Ga0207676_10045659
1331 Ga0207674_10004126
1332 Ga0207674_10005149
1333 Ga0207674_10175067
1334 Ga0207674_10468962
1335 Ga0207674_11082084
1336 Ga0207675_100000975
1337 Ga0207675_100005676
1338 Ga0207675_100011191
1339 Ga0207675_100085036
1340 Ga0207683_10495351
1341 Ga0207683_11076963
1342 Ga0207698_10025332
1343 Ga0207698_10075624
1344 Ga0207698_10282705
1345 Ga0207698_12048784
1346 Ga0209970_1009347
1347 Ga0207428_10710530
1348 Ga0268266_10011531
1349 Ga0268266_10116197
1350 Ga0268266_10561882
1351 Ga0268266_10709239
1352 Ga0268266_12029580
1353 Ga0268265_10077978
1354 Ga0268265_10155096
1355 Ga0268264_10000740
1356 Ga0268264_10001347
1357 Ga0268264_10018090
1358 Ga0268264_10028598
1359 Ga0268264_10056833
1360 Ga0307411_11892594
1361 Ga0373928_0191299
1362 Ga0373934_0003700
1363 Ga0373934_0331310
1364 Ga0373944_0314006
1365 Ga0373923_0008171
1366 Ga0373936_0059564
1367 Ga0373945_0044703
1368 Ga0373953_0022065
1369 Ga0373954_0002880
1370 Ga0373954_0073012
1371 Ga0373954_0378498
1372 Ga0373956_0021441
1373 Ga0373956_0094435
1374 Ga0373957_0007733
1375 Ga0373943_0007473
1376 Ga0373943_0008501
1377 Ga0373943_0073635
1378 Ga0373946_0084884
1379 Ga0373946_0663964
1380 Ga0373955_0009340
1381 Ga0373955_0067434
1382 Ga0373955_0083459
1383 Ga0373924_0016537
1384 Ga0373924_0111328
1385 Ga0373931_0067071
1386 Ga0373931_0110102
1387 Ga0373935_0006155
1388 Ga0373935_0099416
1389 Ga0373927_0048565
1390 Ga0373927_0076321
1391 Ga0373933_0024412
1392 Ga0373933_0103160
1393 Ga0373947_0016171
1394 Ga0373947_0046620
1395 Ga0373947_0104493
1396 Ga0373947_0885301
1397 Ga0373937_0041363
1398 Ga0373937_0057532
1399 Ga0373937_0115319
1400 Ga0373925_0024021
1401 Ga0373925_0382274
1402 Ga0373925_0402495
1403 Ga0395900_0058366
1404 Ga0395900_0142613
1405 Ga0395898_0353641
1406 Ga0395905_0254480
1407 Ga0395901_0239343
1408 Ga0451807_2424974
1409 Ga0451835_0139379
1410 Ga0451847_0444973
1411 Ga0451853_1881781
1412 Ga0450913_016214
1413 Ga0466959_0973467
1414 Ga0495592_0148125
1415 Ga0495629_0094560
1416 Ga0495653_0100509
1417 Ga0495580_0031489
1418 Ga0495580_0288663
1419 Ga0495580_0797505
1420 Ga0495582_0043823
1421 Ga0495639_0013809
1422 Ga0495662_0081010
1423 Ga0495618_0256501
1424 Ga0495628_0138829
1425 Ga0495666_0168725
1426 Ga0495665_0072267
1427 Ga0495640_0126008
1428 Ga0495640_0700774
1429 Ga0495586_0316616
1430 Ga0495586_0554304
1431 Ga0495645_0016294
1432 Ga0495645_0062931
1433 Ga0495667_0380483
1434 Ga0495635_0025493
1435 Ga0495635_0147635
1436 Ga0495657_0421697
1437 Ga0495657_0718723
1438 Ga0495599_0184604
1439 Ga0495623_0105783
1440 Ga0495623_0309557
1441 Ga0495647_0051646
1442 Ga0495658_0068222
1443 Ga0495613_0057444
1444 Ga0495600_0074964
1445 Ga0495581_0247848
1446 Ga0495684_0429038
1447 Ga0495593_0035273
1448 Ga0495602_0135170
1449 Ga0495602_0181157
1450 Ga0495614_0035172
1451 Ga0496100_0237108
1452 Ga0496101_0741377
1453 Ga0496102_0013361
1454 Ga0496102_0152658
1455 Ga0496102_0487337
1456 Ga0496103_0104567
1457 Ga0496103_0280923
1458 Ga0496104_0120924
1459 Ga0496105_0221641
1460 Ga0496106_0010984
1461 Ga0496107_0013238
1462 Ga0496107_0020560
1463 Ga0496108_0078498
1464 Ga0496109_0328212
1465 Ga0496110_0484484
1466 Ga0496111_0565069
1467 Ga0496112_0016919
1468 Ga0496112_0098235
1469 Ga0496113_0354730
1470 Ga0496114_0632395
1471 Ga0496115_0025357
1472 Ga0496115_0324497
1473 Ga0501036_1667352
1474 Ga0501067_0085508
1475 Ga0501068_1086255
1476 Ga0501069_0668028
1477 Ga0501070_0158373
1478 Ga0501071_1299541
1479 Ga0501076_0541144
1480 Ga0501080_0255009
1481 Ga0501083_0056326
1482 Ga0501045_0425074
1483 nmdc:mga08y16_824101_c1
1484 nmdc:mga0n895_1091233_c1
1485 nmdc:mga0rr50_488968_c1
1486 nmdc:mga08x19_37508_c1
1487 nmdc:mga08x19_432289_c1
1488 nmdc:mga08x19_568599_c1
1489 nmdc:mga0a205_965429_c1
1490 Ga0495601_0151179
1491 Ga0495601_0678600
1492 Ga0495612_0239852
1493 Ga0495595_0101470
1494 Ga0495619_0052331
1495 Ga0495619_0059578
1496 Ga0495619_0573571
1497 Ga0587083_0001570
1498 Ga0587088_003983
1499 Ga0587107_003238
1500 Ga0587119_004300
1501 Ga0587111_0011775
1502 Ga0501082_0505228

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map