F478999

General Info

Members Datasets Scaffolds Average Seq Length
749 202 1498 114

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10014146|Ga0105240_1001414613
Length 118
Sequence MGELMDPEVTQVFDFLLQLFPYIAIIVVVSVCGGVLSTWLKIKNGYPLSNSWGMPMHPKSDKEAGERIRLLTTENAQLRAQLGSVMDRLETLERIATDQPSRLARDIDALTIDKGGNA

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
154 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
162 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
163 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
166 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
167 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
168 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
175 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
176 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0.8
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.54
Rhizosphere 95.19
Stem 0
Stem Tuber 0
Unclassified 8.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10014146 3300009093 Bacteria 10901
2 JGI24741J21665_1005189 3300001915 Bacteria 2766
3 JGI24740J21852_10010449 3300001979 Bacteria 3573
4 JGI24740J21852_10032047 3300001979 Bacteria 1686
5 JGI24739J22299_10031244 3300001989 Bacteria 1841
6 JGI24739J22299_10033337 3300001989 Bacteria 1763
7 JGI24739J22299_10103458 3300001989 Bacteria 858
8 JGI24737J22298_10021302 3300001990 Bacteria 2067
9 JGI24737J22298_10024715 3300001990 Bacteria 1902
10 JGI24737J22298_10157563 3300001990 Unclassified 670
11 JGI24737J22298_10165083 3300001990 Unclassified 654
12 JGI24743J22301_10032040 3300001991 Unclassified 1037
13 JGI24735J21928_10002270 3300002067 Bacteria 6708
14 JGI24735J21928_10006779 3300002067 Bacteria 3755
15 JGI24735J21928_10008646 3300002067 Bacteria 3287
16 JGI24750J21931_1033160 3300002070 Bacteria 764
17 JGI24738J21930_10019368 3300002075 Bacteria 1419
18 JGI24738J21930_10029412 3300002075 Bacteria 1123
19 rootH2_10167831 3300003320 Bacteria 1216
20 Ga0065712_10416170 3300005290 Unclassified 716
21 Ga0070658_10005934 3300005327 Bacteria 9911
22 Ga0070658_10016041 3300005327 Bacteria 5992
23 Ga0070658_10029121 3300005327 Bacteria 4435
24 Ga0070658_10031607 3300005327 Bacteria 4251
25 Ga0070658_10049929 3300005327 Bacteria 3390
26 Ga0070658_10063659 3300005327 Bacteria 3007
27 Ga0070658_10137400 3300005327 Bacteria 2040
28 Ga0070658_11003293 3300005327 Bacteria 726
29 Ga0070658_11338061 3300005327 Bacteria 622
30 Ga0070658_11626763 3300005327 Bacteria 559
31 Ga0070676_10048676 3300005328 Bacteria 2479
32 Ga0070676_10066865 3300005328 Bacteria 2148
33 Ga0070676_10177810 3300005328 Bacteria 1381
34 Ga0070676_11001396 3300005328 Unclassified 627
35 Ga0070683_100002413 3300005329 Bacteria 14852
36 Ga0070683_100029324 3300005329 Bacteria 4980
37 Ga0070683_100035499 3300005329 Bacteria 4557
38 Ga0070683_100468468 3300005329 Bacteria 1203
39 Ga0070683_101210018 3300005329 Bacteria 726
40 Ga0070683_101597113 3300005329 Unclassified 627
41 Ga0070690_100007920 3300005330 Bacteria 6097
42 Ga0070690_100017039 3300005330 Bacteria 4361
43 Ga0070690_100334187 3300005330 Unclassified 1095
44 Ga0070670_100047157 3300005331 Bacteria 3707
45 Ga0070666_10010081 3300005335 Bacteria 5899
46 Ga0070666_10039338 3300005335 Bacteria 3151
47 Ga0070666_10047173 3300005335 Bacteria 2891
48 Ga0070666_10123150 3300005335 Bacteria 1799
49 Ga0070666_10446707 3300005335 Bacteria 933
50 Ga0070680_100014984 3300005336 Bacteria 6068
51 Ga0070680_100027340 3300005336 Bacteria 4568
52 Ga0070680_100165132 3300005336 Bacteria 1861
53 Ga0070680_100182354 3300005336 Bacteria 1768
54 Ga0070680_100501245 3300005336 Bacteria 1039
55 Ga0070680_101170980 3300005336 Bacteria 665
56 Ga0070682_100023515 3300005337 Bacteria 3658
57 Ga0070682_100025859 3300005337 Bacteria 3507
58 Ga0070682_100174281 3300005337 Bacteria 1497
59 Ga0070682_100230708 3300005337 Bacteria 1323
60 Ga0068868_100003382 3300005338 Bacteria 11101
61 Ga0068868_100006429 3300005338 Bacteria 8317
62 Ga0068868_100039161 3300005338 Bacteria 3682
63 Ga0068868_100382381 3300005338 Unclassified 1211
64 Ga0068868_101380463 3300005338 Unclassified 656
65 Ga0068868_102349485 3300005338 Bacteria 509
66 Ga0070660_100022352 3300005339 Bacteria 4675
67 Ga0070660_100048282 3300005339 Bacteria 3269
68 Ga0070660_100061566 3300005339 Bacteria 2914
69 Ga0070660_100138453 3300005339 Bacteria 1951
70 Ga0070660_100237307 3300005339 Unclassified 1484
71 Ga0070660_100559429 3300005339 Bacteria 954
72 Ga0070660_100580004 3300005339 Bacteria 937
73 Ga0070660_100760463 3300005339 Bacteria 814
74 Ga0070660_101084733 3300005339 Bacteria 677
75 Ga0070660_101129355 3300005339 Unclassified 664
76 Ga0070660_101472825 3300005339 Unclassified 579
77 Ga0070689_100101344 3300005340 Bacteria 2279
78 Ga0070689_100101498 3300005340 Bacteria 2277
79 Ga0070691_10000225 3300005341 Bacteria 19202
80 Ga0070687_100260224 3300005343 Bacteria 1082
81 Ga0070661_100021031 3300005344 Bacteria 4658
82 Ga0070661_100023382 3300005344 Bacteria 4429
83 Ga0070661_100057585 3300005344 Bacteria 2848
84 Ga0070661_100085182 3300005344 Bacteria 2335
85 Ga0070661_100087253 3300005344 Bacteria 2308
86 Ga0070661_100180586 3300005344 Bacteria 1605
87 Ga0070661_100232787 3300005344 Bacteria 1416
88 Ga0070661_100251981 3300005344 Unclassified 1363
89 Ga0070661_100260624 3300005344 Bacteria 1340
90 Ga0070661_100496968 3300005344 Unclassified 976
91 Ga0070661_101718062 3300005344 Unclassified 532
92 Ga0070692_10019568 3300005345 Bacteria 3269
93 Ga0070692_10039965 3300005345 Bacteria 2397
94 Ga0070692_10075260 3300005345 Bacteria 1807
95 Ga0070668_100137963 3300005347 Bacteria 1963
96 Ga0070668_100860269 3300005347 Bacteria 808
97 Ga0070669_100345701 3300005353 Unclassified 1206
98 Ga0070675_100229726 3300005354 Bacteria 1618
99 Ga0070675_100300065 3300005354 Unclassified 1415
100 Ga0070671_100000541 3300005355 Bacteria 26649
101 Ga0070671_100000963 3300005355 Bacteria 21072
102 Ga0070671_100061919 3300005355 Bacteria 3116
103 Ga0070671_100067759 3300005355 Bacteria 2976
104 Ga0070671_100130028 3300005355 Bacteria 2121
105 Ga0070671_100146628 3300005355 Bacteria 1992
106 Ga0070671_100427213 3300005355 Unclassified 1135
107 Ga0070674_100005418 3300005356 Bacteria 7370
108 Ga0070674_100039907 3300005356 Bacteria 3173
109 Ga0070674_100124680 3300005356 Bacteria 1911
110 Ga0070673_100008296 3300005364 Bacteria 6902
111 Ga0070673_100017862 3300005364 Bacteria 5055
112 Ga0070673_100023106 3300005364 Bacteria 4539
113 Ga0070673_100879445 3300005364 Unclassified 830
114 Ga0070688_100032694 3300005365 Bacteria 3139
115 Ga0070688_100456079 3300005365 Unclassified 957
116 Ga0070659_100037494 3300005366 Bacteria 3779
117 Ga0070659_100130933 3300005366 Bacteria 2037
118 Ga0070659_100131344 3300005366 Bacteria 2034
119 Ga0070659_100136344 3300005366 Bacteria 1996
120 Ga0070659_100589490 3300005366 Bacteria 954
121 Ga0070659_101064568 3300005366 Bacteria 712
122 Ga0070659_101354424 3300005366 Bacteria 632
123 Ga0070667_100000764 3300005367 Bacteria 30578
124 Ga0070667_100025017 3300005367 Bacteria 4961
125 Ga0070667_100037646 3300005367 Bacteria 4055
126 Ga0070667_100079063 3300005367 Bacteria 2811
127 Ga0070714_100059117 3300005435 Bacteria 3286
128 Ga0070714_100120792 3300005435 Bacteria 2330
129 Ga0070714_100395509 3300005435 Bacteria 1305
130 Ga0070714_100629260 3300005435 Bacteria 1032
131 Ga0070713_100147383 3300005436 Bacteria 2090
132 Ga0070713_100436287 3300005436 Bacteria 1228
133 Ga0070663_100036012 3300005455 Bacteria 3437
134 Ga0070663_100037038 3300005455 Bacteria 3393
135 Ga0070663_100055102 3300005455 Bacteria 2845
136 Ga0070663_100077781 3300005455 Bacteria 2430
137 Ga0070663_100127590 3300005455 Bacteria 1928
138 Ga0070663_100327472 3300005455 Bacteria 1234
139 Ga0070678_100016095 3300005456 Bacteria 4773
140 Ga0070678_100034768 3300005456 Bacteria 3512
141 Ga0070678_101895732 3300005456 Unclassified 563
142 Ga0070678_102115689 3300005456 Unclassified 533
143 Ga0070662_100043476 3300005457 Bacteria 3214
144 Ga0070662_100055181 3300005457 Bacteria 2882
145 Ga0070662_100093384 3300005457 Bacteria 2263
146 Ga0070662_100117665 3300005457 Bacteria 2033
147 Ga0070662_100123514 3300005457 Bacteria 1987
148 Ga0070662_100599725 3300005457 Bacteria 926
149 Ga0070681_10009797 3300005458 Bacteria 9432
150 Ga0070681_10122707 3300005458 Bacteria 2531
151 Ga0070681_10244996 3300005458 Bacteria 1705
152 Ga0070681_10347204 3300005458 Bacteria 1394
153 Ga0070681_10625267 3300005458 Bacteria 991
154 Ga0070681_10845034 3300005458 Bacteria 833
155 Ga0070681_11688538 3300005458 Bacteria 559
156 Ga0068867_100024750 3300005459 Bacteria 4303
157 Ga0068867_100193703 3300005459 Bacteria 1623
158 Ga0070685_10069399 3300005466 Bacteria 2084
159 Ga0070679_100111369 3300005530 Bacteria 2724
160 Ga0070679_100127930 3300005530 Bacteria 2522
161 Ga0070679_100271240 3300005530 Bacteria 1651
162 Ga0070679_100557531 3300005530 Bacteria 1089
163 Ga0070679_100897729 3300005530 Bacteria 830
164 Ga0070679_101203315 3300005530 Bacteria 703
165 Ga0070684_100003296 3300005535 Bacteria 12088
166 Ga0070684_100121257 3300005535 Bacteria 2352
167 Ga0070684_100186534 3300005535 Bacteria 1886
168 Ga0070684_100690611 3300005535 Bacteria 951
169 Ga0070684_101285319 3300005535 Bacteria 688
170 Ga0068853_100048021 3300005539 Bacteria 3664
171 Ga0068853_100061071 3300005539 Bacteria 3259
172 Ga0068853_100083512 3300005539 Bacteria 2798
173 Ga0068853_100224777 3300005539 Bacteria 1715
174 Ga0068853_100358373 3300005539 Bacteria 1358
175 Ga0068853_100492043 3300005539 Bacteria 1157
176 Ga0068853_100665763 3300005539 Bacteria 991
177 Ga0070672_100004037 3300005543 Bacteria 9576
178 Ga0070672_100052922 3300005543 Bacteria 3172
179 Ga0070686_100030618 3300005544 Bacteria 3283
180 Ga0070696_101274551 3300005546 Unclassified 623
181 Ga0070693_100174896 3300005547 Bacteria 1378
182 Ga0070693_100200947 3300005547 Bacteria 1295
183 Ga0070665_100082197 3300005548 Bacteria 3226
184 Ga0070665_100114961 3300005548 Bacteria 2693
185 Ga0070665_100430782 3300005548 Unclassified 1328
186 Ga0068855_100027178 3300005563 Bacteria 6846
187 Ga0068855_100046168 3300005563 Bacteria 5150
188 Ga0068855_100236900 3300005563 Bacteria 2041
189 Ga0068855_100407792 3300005563 Bacteria 1488
190 Ga0068855_100420607 3300005563 Bacteria 1462
191 Ga0068855_100656675 3300005563 Bacteria 1126
192 Ga0068855_100689663 3300005563 Bacteria 1094
193 Ga0068855_101138841 3300005563 Bacteria 814
194 Ga0068855_101468772 3300005563 Bacteria 701
195 Ga0070664_100004863 3300005564 Bacteria 10760
196 Ga0070664_100088421 3300005564 Bacteria 2679
197 Ga0070664_100149715 3300005564 Bacteria 2060
198 Ga0070664_100255395 3300005564 Bacteria 1576
199 Ga0070664_100321895 3300005564 Bacteria 1401
200 Ga0070664_100432573 3300005564 Bacteria 1206
201 Ga0070664_100654957 3300005564 Bacteria 976
202 Ga0068857_100071138 3300005577 Bacteria 3099
203 Ga0068857_100182584 3300005577 Bacteria 1909
204 Ga0068857_100797586 3300005577 Bacteria 902
205 Ga0068857_101160694 3300005577 Bacteria 747
206 Ga0068854_100010831 3300005578 Bacteria 5918
207 Ga0068854_100057705 3300005578 Bacteria 2801
208 Ga0068854_100074410 3300005578 Bacteria 2492
209 Ga0068854_100076202 3300005578 Bacteria 2464
210 Ga0068854_100076777 3300005578 Bacteria 2456
211 Ga0068854_100165774 3300005578 Bacteria 1715
212 Ga0068854_100171405 3300005578 Bacteria 1689
213 Ga0068854_100320555 3300005578 Bacteria 1259
214 Ga0068854_100331132 3300005578 Bacteria 1241
215 Ga0068854_100572538 3300005578 Bacteria 961
216 Ga0068854_101176576 3300005578 Bacteria 686
217 Ga0068856_100025534 3300005614 Bacteria 5761
218 Ga0068856_100050193 3300005614 Bacteria 4112
219 Ga0068856_100073447 3300005614 Bacteria 3386
220 Ga0068856_100087301 3300005614 Bacteria 3101
221 Ga0068856_100103811 3300005614 Bacteria 2836
222 Ga0068856_100205080 3300005614 Bacteria 1986
223 Ga0068856_100208853 3300005614 Bacteria 1967
224 Ga0068856_100227552 3300005614 Bacteria 1880
225 Ga0068856_100248381 3300005614 Bacteria 1794
226 Ga0068856_100432533 3300005614 Unclassified 1336
227 Ga0068856_100470601 3300005614 Bacteria 1277
228 Ga0068856_100875039 3300005614 Bacteria 917
229 Ga0068856_101122890 3300005614 Unclassified 803
230 Ga0068856_101531958 3300005614 Unclassified 680
231 Ga0068852_100001353 3300005616 Bacteria 16442
232 Ga0068852_100003815 3300005616 Bacteria 10581
233 Ga0068852_100024721 3300005616 Bacteria 4859
234 Ga0068852_100048902 3300005616 Bacteria 3615
235 Ga0068852_100057579 3300005616 Bacteria 3363
236 Ga0068852_100064099 3300005616 Bacteria 3202
237 Ga0068852_100105874 3300005616 Bacteria 2549
238 Ga0068852_100109724 3300005616 Bacteria 2506
239 Ga0068852_100134931 3300005616 Bacteria 2278
240 Ga0068852_100229903 3300005616 Bacteria 1767
241 Ga0068852_102772422 3300005616 Bacteria 509
242 Ga0068859_100023097 3300005617 Bacteria 6238
243 Ga0068864_100068516 3300005618 Bacteria 3083
244 Ga0068864_100148260 3300005618 Bacteria 2123
245 Ga0068864_100432327 3300005618 Bacteria 1256
246 Ga0068866_10003739 3300005718 Bacteria 6239
247 Ga0068866_10039151 3300005718 Bacteria 2339
248 Ga0068861_101079155 3300005719 Bacteria 771
249 Ga0068851_10008093 3300005834 Bacteria 4852
250 Ga0068851_10011457 3300005834 Bacteria 4159
251 Ga0068851_10073412 3300005834 Bacteria 1774
252 Ga0068851_10075083 3300005834 Bacteria 1756
253 Ga0068851_10097236 3300005834 Unclassified 1558
254 Ga0068851_10129208 3300005834 Bacteria 1365
255 Ga0068851_10258194 3300005834 Unclassified 990
256 Ga0068870_10759262 3300005840 Unclassified 674
257 Ga0068863_100085105 3300005841 Bacteria 2996
258 Ga0068863_101097977 3300005841 Unclassified 800
259 Ga0068858_100000640 3300005842 Bacteria 36414
260 Ga0068858_100012514 3300005842 Bacteria 8002
261 Ga0068858_100323512 3300005842 Bacteria 1474
262 Ga0068860_100139424 3300005843 Bacteria 2330
263 Ga0068860_102761883 3300005843 Bacteria 509
264 Ga0068862_100552375 3300005844 Bacteria 1100
265 Ga0081539_10011851 3300005985 Bacteria 6819
266 Ga0097621_100030726 3300006237 Bacteria 4256
267 Ga0097621_101216402 3300006237 Unclassified 710
268 Ga0097621_101466149 3300006237 Bacteria 647
269 Ga0068871_100009938 3300006358 Bacteria 6910
270 Ga0068871_100179672 3300006358 Bacteria 1818
271 Ga0068871_100392877 3300006358 Bacteria 1234
272 Ga0068865_100017772 3300006881 Bacteria 4578
273 Ga0068865_100424975 3300006881 Bacteria 1093
274 Ga0097620_100023097 3300006931 Bacteria 6238
275 Ga0105240_10010272 3300009093 Bacteria 13180
276 Ga0105240_10021159 3300009093 Bacteria 8659
277 Ga0105240_10348949 3300009093 Bacteria 1679
278 Ga0105240_11186738 3300009093 Bacteria 809
279 Ga0105245_10030094 3300009098 Bacteria 4800
280 Ga0105245_10057890 3300009098 Bacteria 3487
281 Ga0105247_10266929 3300009101 Unclassified 1176
282 Ga0105243_10018559 3300009148 Bacteria 5271
283 Ga0105241_10107402 3300009174 Bacteria 2229
284 Ga0105241_10230097 3300009174 Bacteria 1562
285 Ga0105241_10270455 3300009174 Bacteria 1448
286 Ga0105241_10297932 3300009174 Bacteria 1383
287 Ga0105241_10615309 3300009174 Bacteria 983
288 Ga0105241_10615476 3300009174 Bacteria 983
289 Ga0105241_11149714 3300009174 Bacteria 733
290 Ga0105242_10020178 3300009176 Bacteria 5224
291 Ga0105248_10002046 3300009177 Bacteria 22341
292 Ga0105248_10067210 3300009177 Bacteria 4024
293 Ga0105248_10116877 3300009177 Bacteria 3008
294 Ga0105248_10451558 3300009177 Bacteria 1448
295 Ga0105248_10700973 3300009177 Bacteria 1142
296 Ga0105237_10037933 3300009545 Bacteria 4868
297 Ga0105237_10057841 3300009545 Bacteria 3880
298 Ga0105238_10003335 3300009551 Bacteria 16027
299 Ga0105238_10019845 3300009551 Bacteria 6841
300 Ga0105238_10025038 3300009551 Bacteria 6083
301 Ga0105238_10293971 3300009551 Unclassified 1607
302 Ga0105238_11431319 3300009551 Unclassified 719
303 Ga0105239_10718887 3300010375 Bacteria 1142
304 Ga0105239_10933446 3300010375 Bacteria 996
305 Ga0105239_11298797 3300010375 Bacteria 839
306 Ga0105239_11719097 3300010375 Bacteria 726
307 Ga0105239_11723203 3300010375 Bacteria 725
308 Ga0105246_10556582 3300011119 Bacteria 984
309 Ga0105246_11090848 3300011119 Bacteria 728
310 Ga0157373_10030009 3300013100 Bacteria 3913
311 Ga0157373_10046290 3300013100 Bacteria 3103
312 Ga0157373_10046475 3300013100 Bacteria 3098
313 Ga0157373_10047279 3300013100 Bacteria 3069
314 Ga0157373_10049373 3300013100 Bacteria 2999
315 Ga0157373_10051218 3300013100 Bacteria 2941
316 Ga0157373_10143111 3300013100 Bacteria 1682
317 Ga0157373_10154424 3300013100 Bacteria 1615
318 Ga0157373_10326335 3300013100 Bacteria 1092
319 Ga0157373_10362499 3300013100 Bacteria 1035
320 Ga0157373_10897967 3300013100 Bacteria 657
321 Ga0157373_11552555 3300013100 Bacteria 506
322 Ga0157371_10016795 3300013102 Bacteria 5451
323 Ga0157371_10024128 3300013102 Bacteria 4443
324 Ga0157371_10030855 3300013102 Bacteria 3863
325 Ga0157371_10042876 3300013102 Bacteria 3224
326 Ga0157371_10097561 3300013102 Bacteria 2083
327 Ga0157371_10131219 3300013102 Bacteria 1783
328 Ga0157371_10193330 3300013102 Bacteria 1457
329 Ga0157371_11179812 3300013102 Bacteria 589
330 Ga0157370_10005375 3300013104 Bacteria 14378
331 Ga0157370_10014208 3300013104 Bacteria 8159
332 Ga0157370_10043843 3300013104 Bacteria 4302
333 Ga0157370_10069701 3300013104 Bacteria 3320
334 Ga0157370_10081596 3300013104 Bacteria 3042
335 Ga0157370_10124117 3300013104 Bacteria 2411
336 Ga0157370_10462354 3300013104 Bacteria 1166
337 Ga0157370_10481963 3300013104 Bacteria 1140
338 Ga0157369_10073109 3300013105 Bacteria 3679
339 Ga0157369_10142024 3300013105 Bacteria 2540
340 Ga0157369_10142796 3300013105 Bacteria 2532
341 Ga0157369_10144719 3300013105 Bacteria 2513
342 Ga0157369_10163505 3300013105 Bacteria 2348
343 Ga0157369_10207620 3300013105 Bacteria 2054
344 Ga0157369_10930254 3300013105 Bacteria 891
345 Ga0157369_12546049 3300013105 Unclassified 518
346 Ga0157369_12670682 3300013105 Unclassified 503
347 Ga0157374_10053258 3300013296 Bacteria 3772
348 Ga0157374_10078091 3300013296 Bacteria 3135
349 Ga0157374_10109105 3300013296 Bacteria 2661
350 Ga0157374_10213583 3300013296 Bacteria 1892
351 Ga0157374_10273743 3300013296 Bacteria 1665
352 Ga0157374_10978926 3300013296 Bacteria 865
353 Ga0157374_11199292 3300013296 Unclassified 780
354 Ga0157378_10040383 3300013297 Bacteria 4137
355 Ga0157378_10499256 3300013297 Bacteria 1215
356 Ga0163162_10035301 3300013306 Bacteria 4979
357 Ga0163162_10055886 3300013306 Bacteria 3976
358 Ga0157372_10039580 3300013307 Bacteria 5203
359 Ga0157372_10051802 3300013307 Bacteria 4569
360 Ga0157372_10133418 3300013307 Bacteria 2859
361 Ga0157372_10272826 3300013307 Bacteria 1966
362 Ga0157372_10414471 3300013307 Unclassified 1570
363 Ga0157372_10895627 3300013307 Bacteria 1030
364 Ga0157372_11022347 3300013307 Bacteria 957
365 Ga0157372_11629175 3300013307 Bacteria 743
366 Ga0157375_10037522 3300013308 Bacteria 4644
367 Ga0157375_10317026 3300013308 Bacteria 1724
368 Ga0157375_10489934 3300013308 Bacteria 1394
369 Ga0157375_10519038 3300013308 Bacteria 1355
370 Ga0157375_11288820 3300013308 Bacteria 859
371 Ga0157379_10034838 3300014968 Bacteria 4489
372 Ga0157379_10041644 3300014968 Bacteria 4100
373 Ga0157376_10012404 3300014969 Bacteria 6325
374 Ga0157376_10432284 3300014969 Bacteria 1280
375 Ga0163161_11271022 3300017792 Bacteria 639
376 Ga0197907_10832370 3300020069 Bacteria 1868
377 Ga0206355_1597635 3300020076 Archaea 508
378 Ga0207697_10057339 3300025315 Bacteria 1617
379 Ga0207697_10102755 3300025315 Bacteria 1219
380 Ga0207656_10010108 3300025321 Bacteria 3522
381 Ga0207656_10041974 3300025321 Bacteria 1945
382 Ga0207656_10121976 3300025321 Bacteria 1214
383 Ga0207656_10396210 3300025321 Unclassified 693
384 Ga0207642_10017239 3300025899 Bacteria 2742
385 Ga0207710_10282979 3300025900 Bacteria 835
386 Ga0207680_10002423 3300025903 Bacteria 8696
387 Ga0207680_10066844 3300025903 Bacteria 2212
388 Ga0207680_10190739 3300025903 Bacteria 1391
389 Ga0207647_10001869 3300025904 Bacteria 16121
390 Ga0207647_10008618 3300025904 Bacteria 7296
391 Ga0207647_10023155 3300025904 Bacteria 4112
392 Ga0207647_10038714 3300025904 Bacteria 3014
393 Ga0207647_10078390 3300025904 Bacteria 1984
394 Ga0207647_10107418 3300025904 Bacteria 1651
395 Ga0207647_10186214 3300025904 Bacteria 1204
396 Ga0207647_10201749 3300025904 Bacteria 1150
397 Ga0207647_10260416 3300025904 Bacteria 993
398 Ga0207645_10050245 3300025907 Bacteria 2662
399 Ga0207645_10071608 3300025907 Bacteria 2219
400 Ga0207645_10232366 3300025907 Bacteria 1217
401 Ga0207645_11076465 3300025907 Unclassified 543
402 Ga0207705_10006944 3300025909 Bacteria 8364
403 Ga0207705_10007205 3300025909 Bacteria 8191
404 Ga0207705_10009509 3300025909 Bacteria 7073
405 Ga0207705_10022470 3300025909 Bacteria 4497
406 Ga0207705_10042975 3300025909 Bacteria 3245
407 Ga0207705_10104146 3300025909 Bacteria 2090
408 Ga0207705_10148650 3300025909 Bacteria 1754
409 Ga0207705_10158287 3300025909 Bacteria 1700
410 Ga0207705_10397882 3300025909 Bacteria 1065
411 Ga0207705_10531687 3300025909 Bacteria 914
412 Ga0207654_10039701 3300025911 Bacteria 2649
413 Ga0207654_10188770 3300025911 Bacteria 1349
414 Ga0207707_10104523 3300025912 Bacteria 2475
415 Ga0207707_10163924 3300025912 Bacteria 1943
416 Ga0207707_10198858 3300025912 Bacteria 1748
417 Ga0207695_10015342 3300025913 Bacteria 9022
418 Ga0207695_10044807 3300025913 Bacteria 4702
419 Ga0207695_10288162 3300025913 Bacteria 1535
420 Ga0207671_10307134 3300025914 Bacteria 1254
421 Ga0207671_10613721 3300025914 Bacteria 867
422 Ga0207660_10001957 3300025917 Bacteria 13740
423 Ga0207660_10003177 3300025917 Bacteria 10745
424 Ga0207660_10013429 3300025917 Bacteria 5367
425 Ga0207660_10019708 3300025917 Bacteria 4514
426 Ga0207660_10101126 3300025917 Bacteria 2153
427 Ga0207660_11141730 3300025917 Bacteria 635
428 Ga0207662_10639096 3300025918 Bacteria 743
429 Ga0207657_10000857 3300025919 Bacteria 32134
430 Ga0207657_10030378 3300025919 Bacteria 4904
431 Ga0207657_10032621 3300025919 Bacteria 4703
432 Ga0207657_10033313 3300025919 Bacteria 4645
433 Ga0207657_10034671 3300025919 Bacteria 4535
434 Ga0207657_10045673 3300025919 Bacteria 3841
435 Ga0207657_10080385 3300025919 Bacteria 2740
436 Ga0207657_10109602 3300025919 Bacteria 2281
437 Ga0207649_10016374 3300025920 Bacteria 4179
438 Ga0207649_10052847 3300025920 Bacteria 2522
439 Ga0207649_10368618 3300025920 Bacteria 1068
440 Ga0207649_10459217 3300025920 Bacteria 963
441 Ga0207649_10535865 3300025920 Unclassified 894
442 Ga0207649_10630944 3300025920 Bacteria 826
443 Ga0207649_10732023 3300025920 Unclassified 769
444 Ga0207652_10011380 3300025921 Bacteria 7169
445 Ga0207652_10034753 3300025921 Bacteria 4250
446 Ga0207652_10230204 3300025921 Bacteria 1670
447 Ga0207652_10928517 3300025921 Bacteria 768
448 Ga0207652_11237349 3300025921 Bacteria 649
449 Ga0207681_10223471 3300025923 Bacteria 1458
450 Ga0207681_11445831 3300025923 Unclassified 577
451 Ga0207694_10001409 3300025924 Bacteria 20627
452 Ga0207694_10045358 3300025924 Bacteria 3396
453 Ga0207694_10058218 3300025924 Bacteria 3005
454 Ga0207694_10076073 3300025924 Bacteria 2628
455 Ga0207694_10117552 3300025924 Bacteria 2120
456 Ga0207650_10165519 3300025925 Bacteria 1755
457 Ga0207650_10242660 3300025925 Bacteria 1456
458 Ga0207650_10434552 3300025925 Bacteria 1091
459 Ga0207659_10271701 3300025926 Bacteria 1383
460 Ga0207700_10176533 3300025928 Bacteria 1785
461 Ga0207700_10366786 3300025928 Bacteria 1257
462 Ga0207700_11224764 3300025928 Bacteria 670
463 Ga0207664_10203717 3300025929 Bacteria 1709
464 Ga0207664_10559003 3300025929 Bacteria 1027
465 Ga0207664_10645360 3300025929 Bacteria 951
466 Ga0207644_10000452 3300025931 Bacteria 26514
467 Ga0207644_10028517 3300025931 Bacteria 3865
468 Ga0207644_10152900 3300025931 Bacteria 1787
469 Ga0207690_10007460 3300025932 Bacteria 6489
470 Ga0207690_10016021 3300025932 Bacteria 4556
471 Ga0207690_10022929 3300025932 Bacteria 3889
472 Ga0207690_10040621 3300025932 Bacteria 3042
473 Ga0207690_10070961 3300025932 Bacteria 2401
474 Ga0207690_10076697 3300025932 Bacteria 2321
475 Ga0207690_11103357 3300025932 Bacteria 661
476 Ga0207706_10000967 3300025933 Bacteria 29354
477 Ga0207706_10064263 3300025933 Bacteria 3231
478 Ga0207706_10078329 3300025933 Bacteria 2907
479 Ga0207706_10128357 3300025933 Bacteria 2230
480 Ga0207706_10143800 3300025933 Bacteria 2098
481 Ga0207706_10584385 3300025933 Bacteria 960
482 Ga0207706_10686873 3300025933 Unclassified 875
483 Ga0207686_10010151 3300025934 Bacteria 5121
484 Ga0207709_10361719 3300025935 Bacteria 1099
485 Ga0207670_10097732 3300025936 Bacteria 2091
486 Ga0207670_10593400 3300025936 Bacteria 909
487 Ga0207669_10013632 3300025937 Bacteria 4046
488 Ga0207669_10087672 3300025937 Bacteria 2016
489 Ga0207704_10010516 3300025938 Bacteria 4519
490 Ga0207704_10439583 3300025938 Unclassified 1039
491 Ga0207691_10006976 3300025940 Bacteria 10900
492 Ga0207691_10173265 3300025940 Bacteria 1888
493 Ga0207711_10000174 3300025941 Bacteria 69263
494 Ga0207711_10018631 3300025941 Bacteria 5772
495 Ga0207711_10031804 3300025941 Bacteria 4457
496 Ga0207711_10290151 3300025941 Bacteria 1508
497 Ga0207711_10403718 3300025941 Bacteria 1270
498 Ga0207661_10003230 3300025944 Bacteria 11293
499 Ga0207661_10007022 3300025944 Bacteria 7987
500 Ga0207661_10106979 3300025944 Bacteria 2358
501 Ga0207661_11010648 3300025944 Bacteria 766
502 Ga0207679_10043470 3300025945 Bacteria 3235
503 Ga0207679_10206801 3300025945 Bacteria 1643
504 Ga0207679_10355918 3300025945 Bacteria 1277
505 Ga0207679_10386280 3300025945 Bacteria 1228
506 Ga0207679_11510106 3300025945 Bacteria 616
507 Ga0207667_10005210 3300025949 Bacteria 15866
508 Ga0207667_10017856 3300025949 Bacteria 7975
509 Ga0207667_10074971 3300025949 Bacteria 3513
510 Ga0207667_10093913 3300025949 Bacteria 3097
511 Ga0207667_10100814 3300025949 Bacteria 2978
512 Ga0207667_10361394 3300025949 Bacteria 1480
513 Ga0207667_10441419 3300025949 Bacteria 1323
514 Ga0207667_10504644 3300025949 Bacteria 1227
515 Ga0207667_11082142 3300025949 Bacteria 786
516 Ga0207651_10003557 3300025960 Bacteria 7658
517 Ga0207651_10009850 3300025960 Bacteria 5259
518 Ga0207651_10241597 3300025960 Unclassified 1472
519 Ga0207668_10115809 3300025972 Bacteria 2020
520 Ga0207668_10737213 3300025972 Bacteria 868
521 Ga0207640_10046674 3300025981 Bacteria 2789
522 Ga0207640_10082893 3300025981 Bacteria 2197
523 Ga0207640_10086399 3300025981 Bacteria 2159
524 Ga0207640_10105898 3300025981 Bacteria 1983
525 Ga0207640_10135080 3300025981 Bacteria 1789
526 Ga0207640_10371505 3300025981 Bacteria 1156
527 Ga0207640_10481891 3300025981 Unclassified 1029
528 Ga0207640_10663488 3300025981 Bacteria 890
529 Ga0207658_10021543 3300025986 Bacteria 4477
530 Ga0207658_10107736 3300025986 Bacteria 2196
531 Ga0207677_10001901 3300026023 Bacteria 11024
532 Ga0207677_10005735 3300026023 Bacteria 6753
533 Ga0207677_10020356 3300026023 Bacteria 4027
534 Ga0207677_10119515 3300026023 Bacteria 1979
535 Ga0207677_11096866 3300026023 Bacteria 725
536 Ga0207703_10001865 3300026035 Bacteria 18737
537 Ga0207703_10304476 3300026035 Bacteria 1455
538 Ga0207639_10021423 3300026041 Bacteria 4642
539 Ga0207639_10023824 3300026041 Bacteria 4423
540 Ga0207639_10029388 3300026041 Bacteria 4023
541 Ga0207639_10083369 3300026041 Bacteria 2537
542 Ga0207639_10247814 3300026041 Bacteria 1552
543 Ga0207639_10427459 3300026041 Bacteria 1199
544 Ga0207639_11457193 3300026041 Unclassified 643
545 Ga0207639_11826999 3300026041 Bacteria 568
546 Ga0207678_10012520 3300026067 Bacteria 7449
547 Ga0207678_10017027 3300026067 Bacteria 6382
548 Ga0207678_10066659 3300026067 Bacteria 3091
549 Ga0207678_10072294 3300026067 Bacteria 2956
550 Ga0207678_10079589 3300026067 Bacteria 2806
551 Ga0207678_10283166 3300026067 Bacteria 1423
552 Ga0207702_10039942 3300026078 Bacteria 3933
553 Ga0207702_10046860 3300026078 Bacteria 3641
554 Ga0207702_10110457 3300026078 Bacteria 2443
555 Ga0207702_10117705 3300026078 Bacteria 2373
556 Ga0207702_10180386 3300026078 Bacteria 1944
557 Ga0207702_10226590 3300026078 Bacteria 1744
558 Ga0207702_10510008 3300026078 Bacteria 1173
559 Ga0207702_10599348 3300026078 Bacteria 1081
560 Ga0207702_12244226 3300026078 Bacteria 534
561 Ga0207641_10105719 3300026088 Bacteria 2486
562 Ga0207641_10547569 3300026088 Unclassified 1128
563 Ga0207648_10027416 3300026089 Bacteria 5056
564 Ga0207648_10155272 3300026089 Bacteria 2020
565 Ga0207676_10015835 3300026095 Bacteria 5452
566 Ga0207676_10819490 3300026095 Unclassified 909
567 Ga0207674_10038488 3300026116 Bacteria 4962
568 Ga0207674_10056826 3300026116 Bacteria 3970
569 Ga0207674_10057905 3300026116 Bacteria 3928
570 Ga0207674_10177137 3300026116 Bacteria 2085
571 Ga0207674_11902491 3300026116 Bacteria 561
572 Ga0207675_101178735 3300026118 Bacteria 786
573 Ga0207683_10014579 3300026121 Bacteria 6695
574 Ga0207683_10054756 3300026121 Bacteria 3498
575 Ga0207698_10000676 3300026142 Bacteria 19793
576 Ga0207698_10002291 3300026142 Bacteria 11337
577 Ga0207698_10010143 3300026142 Bacteria 6036
578 Ga0207698_10015069 3300026142 Bacteria 5166
579 Ga0207698_10020711 3300026142 Bacteria 4532
580 Ga0207698_10092160 3300026142 Bacteria 2483
581 Ga0207698_10115100 3300026142 Bacteria 2264
582 Ga0207698_10174136 3300026142 Bacteria 1898
583 Ga0207698_10350406 3300026142 Bacteria 1394
584 Ga0207698_11720683 3300026142 Bacteria 642
585 Ga0209971_1115372 3300027682 Unclassified 659
586 Ga0268266_10118868 3300028379 Bacteria 2350
587 Ga0268265_10400639 3300028380 Bacteria 1268
588 Ga0268264_10070009 3300028381 Bacteria 2969
589 Ga0268264_12102101 3300028381 Bacteria 573
590 Ga0373942_0337647 3300035207 Bacteria 530
591 Ga0373962_0025764 3300035242 Bacteria 1581
592 Ga0373931_0020691 3300035691 Bacteria 3294
593 Ga0395899_0008219 3300037312 Bacteria 8039
594 Ga0395899_0029113 3300037312 Bacteria 4153
595 Ga0395899_0098701 3300037312 Bacteria 2110
596 Ga0395899_0118004 3300037312 Bacteria 1903
597 Ga0395899_0134711 3300037312 Bacteria 1761
598 Ga0395899_0181666 3300037312 Bacteria 1476
599 Ga0395899_0187141 3300037312 Bacteria 1450
600 Ga0395899_0290412 3300037312 Unclassified 1109
601 Ga0395899_0551687 3300037312 Bacteria 740
602 Ga0395900_0002071 3300037418 Bacteria 22508
603 Ga0395900_0007204 3300037418 Bacteria 11524
604 Ga0395900_0026307 3300037418 Bacteria 5958
605 Ga0395900_0027017 3300037418 Bacteria 5876
606 Ga0395900_0051163 3300037418 Bacteria 4256
607 Ga0395900_0109806 3300037418 Bacteria 2833
608 Ga0395900_0117755 3300037418 Bacteria 2726
609 Ga0395900_0142302 3300037418 Bacteria 2455
610 Ga0395900_0167415 3300037418 Bacteria 2239
611 Ga0395900_0182254 3300037418 Bacteria 2133
612 Ga0395900_0226186 3300037418 Bacteria 1884
613 Ga0395900_0240478 3300037418 Bacteria 1816
614 Ga0395900_0289527 3300037418 Bacteria 1627
615 Ga0395900_0344670 3300037418 Unclassified 1464
616 Ga0395900_0502320 3300037418 Unclassified 1163
617 Ga0395900_0549705 3300037418 Bacteria 1099
618 Ga0395900_0586913 3300037418 Bacteria 1056
619 Ga0395898_0012316 3300037466 Bacteria 8843
620 Ga0395898_0036484 3300037466 Bacteria 4881
621 Ga0395898_0136702 3300037466 Bacteria 2347
622 Ga0395898_0156038 3300037466 Bacteria 2183
623 Ga0395898_0157678 3300037466 Bacteria 2171
624 Ga0395898_0240053 3300037466 Bacteria 1728
625 Ga0395898_0250641 3300037466 Bacteria 1688
626 Ga0395898_0328621 3300037466 Bacteria 1458
627 Ga0395898_1392963 3300037466 Unclassified 629
628 Ga0395905_0003231 3300037471 Bacteria 17523
629 Ga0395905_0007105 3300037471 Bacteria 11190
630 Ga0395905_0008817 3300037471 Bacteria 9910
631 Ga0395905_0021865 3300037471 Bacteria 6049
632 Ga0395905_0026027 3300037471 Bacteria 5517
633 Ga0395905_0032174 3300037471 Bacteria 4934
634 Ga0395905_0034161 3300037471 Bacteria 4774
635 Ga0395905_0038914 3300037471 Bacteria 4461
636 Ga0395905_0044434 3300037471 Bacteria 4170
637 Ga0395905_0047386 3300037471 Bacteria 4028
638 Ga0395905_0058045 3300037471 Bacteria 3619
639 Ga0395905_0084221 3300037471 Bacteria 2979
640 Ga0395905_0150010 3300037471 Bacteria 2193
641 Ga0395905_0218002 3300037471 Bacteria 1786
642 Ga0395905_0408563 3300037471 Bacteria 1253
643 Ga0395905_0570210 3300037471 Bacteria 1033
644 Ga0395905_0627963 3300037471 Bacteria 976
645 Ga0395905_0818913 3300037471 Bacteria 834
646 Ga0395905_1108711 3300037471 Unclassified 695
647 Ga0395905_1246978 3300037471 Bacteria 647
648 Ga0395905_1646509 3300037471 Unclassified 547
649 Ga0395901_0002697 3300038443 Bacteria 17888
650 Ga0395901_0004082 3300038443 Bacteria 14706
651 Ga0395901_0047206 3300038443 Bacteria 4471
652 Ga0395901_0056121 3300038443 Bacteria 4097
653 Ga0395901_0100043 3300038443 Bacteria 3041
654 Ga0395901_0107033 3300038443 Bacteria 2935
655 Ga0395901_0118994 3300038443 Bacteria 2775
656 Ga0395901_0126172 3300038443 Bacteria 2689
657 Ga0395901_0163777 3300038443 Bacteria 2335
658 Ga0395901_0425644 3300038443 Bacteria 1361
659 Ga0395901_0604389 3300038443 Bacteria 1105
660 Ga0395901_1089537 3300038443 Bacteria 770
661 Ga0436363_1482134 3300039450 Unclassified 504
662 Ga0439458_0045338 3300042157 Bacteria 1075
663 Ga0466969_0134476 3300044656 Unclassified 1145
664 Ga0466966_0013617 3300044684 Bacteria 5381
665 Ga0466966_0047118 3300044684 Bacteria 2750
666 Ga0466966_0076825 3300044684 Bacteria 2085
667 Ga0466966_0418366 3300044684 Bacteria 805
668 Ga0466961_0034709 3300044693 Bacteria 3238
669 Ga0466961_0057019 3300044693 Bacteria 2488
670 Ga0466961_0092019 3300044693 Bacteria 1915
671 Ga0466961_0367785 3300044693 Bacteria 874
672 Ga0466961_0826566 3300044693 Bacteria 553
673 Ga0466963_0001670 3300044694 Bacteria 12091
674 Ga0466963_0007311 3300044694 Bacteria 6585
675 Ga0466963_0112317 3300044694 Bacteria 1871
676 Ga0466963_0324091 3300044694 Bacteria 1084
677 Ga0466964_0139775 3300044706 Bacteria 1112
678 Ga0466971_0131479 3300044719 Bacteria 1162
679 Ga0466971_0448927 3300044719 Unclassified 632
680 Ga0466970_0299158 3300044765 Bacteria 907
681 Ga0466957_0006254 3300044842 Bacteria 6719
682 Ga0466957_0115019 3300044842 Bacteria 1710
683 Ga0466959_0039101 3300045049 Bacteria 3506
684 Ga0466959_0390287 3300045049 Bacteria 947
685 Ga0466959_0399000 3300045049 Bacteria 935
686 Ga0466959_0420149 3300045049 Unclassified 908
687 Ga0466959_0697851 3300045049 Bacteria 680
688 Ga0466958_0045162 3300045836 Bacteria 2657
689 Ga0466958_0151802 3300045836 Bacteria 1461
690 Ga0466967_0015138 3300045976 Bacteria 6037
691 Ga0466967_0015299 3300045976 Bacteria 6011
692 Ga0466967_0085706 3300045976 Bacteria 2852
693 Ga0466967_0121805 3300045976 Bacteria 2411
694 Ga0466967_0140098 3300045976 Bacteria 2252
695 Ga0466967_0155267 3300045976 Bacteria 2143
696 Ga0466967_0487424 3300045976 Bacteria 1208
697 Ga0466967_1042935 3300045976 Unclassified 814
698 Ga0466967_1689581 3300045976 Bacteria 630
699 Ga0466967_1878239 3300045976 Bacteria 596
700 Ga0466967_2199364 3300045976 Bacteria 547
701 Ga0495598_0001875 3300046537 Bacteria 4242
702 Ga0495598_0250895 3300046537 Bacteria 655
703 Ga0495621_0000079 3300046539 Bacteria 19438
704 Ga0495633_0091060 3300046558 Bacteria 1418
705 Ga0495669_0093129 3300046684 Bacteria 1393
706 Ga0495670_0001096 3300046691 Bacteria 13136
707 Ga0496100_0007068 3300048903 Bacteria 6160
708 Ga0496100_0158435 3300048903 Bacteria 1621
709 Ga0496101_0013088 3300048904 Bacteria 5549
710 Ga0496101_0058990 3300048904 Bacteria 2781
711 Ga0496101_0435222 3300048904 Bacteria 1034
712 Ga0496101_1385586 3300048904 Bacteria 549
713 Ga0496102_0234092 3300048905 Bacteria 1732
714 Ga0496102_1111030 3300048905 Bacteria 710
715 Ga0496103_0014763 3300048906 Bacteria 4643
716 Ga0496104_0043261 3300048907 Bacteria 4231
717 Ga0496104_0097442 3300048907 Bacteria 2815
718 Ga0496105_0512291 3300048908 Bacteria 941
719 Ga0496106_0336230 3300048909 Bacteria 1212
720 Ga0496107_0039520 3300048910 Bacteria 3384
721 Ga0496107_1330100 3300048910 Unclassified 513
722 Ga0496108_0026662 3300048911 Bacteria 4768
723 Ga0496108_0041963 3300048911 Bacteria 3818
724 Ga0496109_0147753 3300048912 Bacteria 2199
725 Ga0496109_0180465 3300048912 Bacteria 1982
726 Ga0496109_0440564 3300048912 Bacteria 1231
727 Ga0496109_0689212 3300048912 Bacteria 959
728 Ga0496110_0398044 3300048913 Bacteria 1255
729 Ga0496110_1090404 3300048913 Bacteria 706
730 Ga0496111_0214692 3300048914 Bacteria 1429
731 Ga0496111_0766219 3300048914 Bacteria 699
732 Ga0496112_0026228 3300048915 Bacteria 5604
733 Ga0496112_0097756 3300048915 Bacteria 2906
734 Ga0496112_0282283 3300048915 Bacteria 1607
735 Ga0496112_0456321 3300048915 Bacteria 1216
736 Ga0496112_0793590 3300048915 Bacteria 872
737 Ga0496113_0495759 3300048916 Bacteria 981
738 Ga0496113_0526759 3300048916 Bacteria 948
739 Ga0496114_0105518 3300048917 Bacteria 2410
740 Ga0496115_0000742 3300048918 Bacteria 24098
741 Ga0501074_0515445 3300049590 Unclassified 847
742 Ga0501080_0112122 3300049742 Bacteria 2528
743 Ga0501044_1465195 3300049823 Bacteria 548
744 Ga0587073_0297477 3300059492 Bacteria 524
745 Ga0587106_029932 3300059605 Bacteria 868
746 Ga0587128_161023 3300059630 Unclassified 518
747 Ga0587069_016548 3300059642 Unclassified 1055
748 Ga0466962_0008509 3300061719 Bacteria 4917
749 Ga0466962_0047290 3300061719 Bacteria 2056
750 Ga0105240_10014146
751 JGI24741J21665_1005189
752 JGI24740J21852_10010449
753 JGI24740J21852_10032047
754 JGI24739J22299_10031244
755 JGI24739J22299_10033337
756 JGI24739J22299_10103458
757 JGI24737J22298_10021302
758 JGI24737J22298_10024715
759 JGI24737J22298_10157563
760 JGI24737J22298_10165083
761 JGI24743J22301_10032040
762 JGI24735J21928_10002270
763 JGI24735J21928_10006779
764 JGI24735J21928_10008646
765 JGI24750J21931_1033160
766 JGI24738J21930_10019368
767 JGI24738J21930_10029412
768 rootH2_10167831
769 Ga0065712_10416170
770 Ga0070658_10005934
771 Ga0070658_10016041
772 Ga0070658_10029121
773 Ga0070658_10031607
774 Ga0070658_10049929
775 Ga0070658_10063659
776 Ga0070658_10137400
777 Ga0070658_11003293
778 Ga0070658_11338061
779 Ga0070658_11626763
780 Ga0070676_10048676
781 Ga0070676_10066865
782 Ga0070676_10177810
783 Ga0070676_11001396
784 Ga0070683_100002413
785 Ga0070683_100029324
786 Ga0070683_100035499
787 Ga0070683_100468468
788 Ga0070683_101210018
789 Ga0070683_101597113
790 Ga0070690_100007920
791 Ga0070690_100017039
792 Ga0070690_100334187
793 Ga0070670_100047157
794 Ga0070666_10010081
795 Ga0070666_10039338
796 Ga0070666_10047173
797 Ga0070666_10123150
798 Ga0070666_10446707
799 Ga0070680_100014984
800 Ga0070680_100027340
801 Ga0070680_100165132
802 Ga0070680_100182354
803 Ga0070680_100501245
804 Ga0070680_101170980
805 Ga0070682_100023515
806 Ga0070682_100025859
807 Ga0070682_100174281
808 Ga0070682_100230708
809 Ga0068868_100003382
810 Ga0068868_100006429
811 Ga0068868_100039161
812 Ga0068868_100382381
813 Ga0068868_101380463
814 Ga0068868_102349485
815 Ga0070660_100022352
816 Ga0070660_100048282
817 Ga0070660_100061566
818 Ga0070660_100138453
819 Ga0070660_100237307
820 Ga0070660_100559429
821 Ga0070660_100580004
822 Ga0070660_100760463
823 Ga0070660_101084733
824 Ga0070660_101129355
825 Ga0070660_101472825
826 Ga0070689_100101344
827 Ga0070689_100101498
828 Ga0070691_10000225
829 Ga0070687_100260224
830 Ga0070661_100021031
831 Ga0070661_100023382
832 Ga0070661_100057585
833 Ga0070661_100085182
834 Ga0070661_100087253
835 Ga0070661_100180586
836 Ga0070661_100232787
837 Ga0070661_100251981
838 Ga0070661_100260624
839 Ga0070661_100496968
840 Ga0070661_101718062
841 Ga0070692_10019568
842 Ga0070692_10039965
843 Ga0070692_10075260
844 Ga0070668_100137963
845 Ga0070668_100860269
846 Ga0070669_100345701
847 Ga0070675_100229726
848 Ga0070675_100300065
849 Ga0070671_100000541
850 Ga0070671_100000963
851 Ga0070671_100061919
852 Ga0070671_100067759
853 Ga0070671_100130028
854 Ga0070671_100146628
855 Ga0070671_100427213
856 Ga0070674_100005418
857 Ga0070674_100039907
858 Ga0070674_100124680
859 Ga0070673_100008296
860 Ga0070673_100017862
861 Ga0070673_100023106
862 Ga0070673_100879445
863 Ga0070688_100032694
864 Ga0070688_100456079
865 Ga0070659_100037494
866 Ga0070659_100130933
867 Ga0070659_100131344
868 Ga0070659_100136344
869 Ga0070659_100589490
870 Ga0070659_101064568
871 Ga0070659_101354424
872 Ga0070667_100000764
873 Ga0070667_100025017
874 Ga0070667_100037646
875 Ga0070667_100079063
876 Ga0070714_100059117
877 Ga0070714_100120792
878 Ga0070714_100395509
879 Ga0070714_100629260
880 Ga0070713_100147383
881 Ga0070713_100436287
882 Ga0070663_100036012
883 Ga0070663_100037038
884 Ga0070663_100055102
885 Ga0070663_100077781
886 Ga0070663_100127590
887 Ga0070663_100327472
888 Ga0070678_100016095
889 Ga0070678_100034768
890 Ga0070678_101895732
891 Ga0070678_102115689
892 Ga0070662_100043476
893 Ga0070662_100055181
894 Ga0070662_100093384
895 Ga0070662_100117665
896 Ga0070662_100123514
897 Ga0070662_100599725
898 Ga0070681_10009797
899 Ga0070681_10122707
900 Ga0070681_10244996
901 Ga0070681_10347204
902 Ga0070681_10625267
903 Ga0070681_10845034
904 Ga0070681_11688538
905 Ga0068867_100024750
906 Ga0068867_100193703
907 Ga0070685_10069399
908 Ga0070679_100111369
909 Ga0070679_100127930
910 Ga0070679_100271240
911 Ga0070679_100557531
912 Ga0070679_100897729
913 Ga0070679_101203315
914 Ga0070684_100003296
915 Ga0070684_100121257
916 Ga0070684_100186534
917 Ga0070684_100690611
918 Ga0070684_101285319
919 Ga0068853_100048021
920 Ga0068853_100061071
921 Ga0068853_100083512
922 Ga0068853_100224777
923 Ga0068853_100358373
924 Ga0068853_100492043
925 Ga0068853_100665763
926 Ga0070672_100004037
927 Ga0070672_100052922
928 Ga0070686_100030618
929 Ga0070696_101274551
930 Ga0070693_100174896
931 Ga0070693_100200947
932 Ga0070665_100082197
933 Ga0070665_100114961
934 Ga0070665_100430782
935 Ga0068855_100027178
936 Ga0068855_100046168
937 Ga0068855_100236900
938 Ga0068855_100407792
939 Ga0068855_100420607
940 Ga0068855_100656675
941 Ga0068855_100689663
942 Ga0068855_101138841
943 Ga0068855_101468772
944 Ga0070664_100004863
945 Ga0070664_100088421
946 Ga0070664_100149715
947 Ga0070664_100255395
948 Ga0070664_100321895
949 Ga0070664_100432573
950 Ga0070664_100654957
951 Ga0068857_100071138
952 Ga0068857_100182584
953 Ga0068857_100797586
954 Ga0068857_101160694
955 Ga0068854_100010831
956 Ga0068854_100057705
957 Ga0068854_100074410
958 Ga0068854_100076202
959 Ga0068854_100076777
960 Ga0068854_100165774
961 Ga0068854_100171405
962 Ga0068854_100320555
963 Ga0068854_100331132
964 Ga0068854_100572538
965 Ga0068854_101176576
966 Ga0068856_100025534
967 Ga0068856_100050193
968 Ga0068856_100073447
969 Ga0068856_100087301
970 Ga0068856_100103811
971 Ga0068856_100205080
972 Ga0068856_100208853
973 Ga0068856_100227552
974 Ga0068856_100248381
975 Ga0068856_100432533
976 Ga0068856_100470601
977 Ga0068856_100875039
978 Ga0068856_101122890
979 Ga0068856_101531958
980 Ga0068852_100001353
981 Ga0068852_100003815
982 Ga0068852_100024721
983 Ga0068852_100048902
984 Ga0068852_100057579
985 Ga0068852_100064099
986 Ga0068852_100105874
987 Ga0068852_100109724
988 Ga0068852_100134931
989 Ga0068852_100229903
990 Ga0068852_102772422
991 Ga0068859_100023097
992 Ga0068864_100068516
993 Ga0068864_100148260
994 Ga0068864_100432327
995 Ga0068866_10003739
996 Ga0068866_10039151
997 Ga0068861_101079155
998 Ga0068851_10008093
999 Ga0068851_10011457
1000 Ga0068851_10073412
1001 Ga0068851_10075083
1002 Ga0068851_10097236
1003 Ga0068851_10129208
1004 Ga0068851_10258194
1005 Ga0068870_10759262
1006 Ga0068863_100085105
1007 Ga0068863_101097977
1008 Ga0068858_100000640
1009 Ga0068858_100012514
1010 Ga0068858_100323512
1011 Ga0068860_100139424
1012 Ga0068860_102761883
1013 Ga0068862_100552375
1014 Ga0081539_10011851
1015 Ga0097621_100030726
1016 Ga0097621_101216402
1017 Ga0097621_101466149
1018 Ga0068871_100009938
1019 Ga0068871_100179672
1020 Ga0068871_100392877
1021 Ga0068865_100017772
1022 Ga0068865_100424975
1023 Ga0097620_100023097
1024 Ga0105240_10010272
1025 Ga0105240_10021159
1026 Ga0105240_10348949
1027 Ga0105240_11186738
1028 Ga0105245_10030094
1029 Ga0105245_10057890
1030 Ga0105247_10266929
1031 Ga0105243_10018559
1032 Ga0105241_10107402
1033 Ga0105241_10230097
1034 Ga0105241_10270455
1035 Ga0105241_10297932
1036 Ga0105241_10615309
1037 Ga0105241_10615476
1038 Ga0105241_11149714
1039 Ga0105242_10020178
1040 Ga0105248_10002046
1041 Ga0105248_10067210
1042 Ga0105248_10116877
1043 Ga0105248_10451558
1044 Ga0105248_10700973
1045 Ga0105237_10037933
1046 Ga0105237_10057841
1047 Ga0105238_10003335
1048 Ga0105238_10019845
1049 Ga0105238_10025038
1050 Ga0105238_10293971
1051 Ga0105238_11431319
1052 Ga0105239_10718887
1053 Ga0105239_10933446
1054 Ga0105239_11298797
1055 Ga0105239_11719097
1056 Ga0105239_11723203
1057 Ga0105246_10556582
1058 Ga0105246_11090848
1059 Ga0157373_10030009
1060 Ga0157373_10046290
1061 Ga0157373_10046475
1062 Ga0157373_10047279
1063 Ga0157373_10049373
1064 Ga0157373_10051218
1065 Ga0157373_10143111
1066 Ga0157373_10154424
1067 Ga0157373_10326335
1068 Ga0157373_10362499
1069 Ga0157373_10897967
1070 Ga0157373_11552555
1071 Ga0157371_10016795
1072 Ga0157371_10024128
1073 Ga0157371_10030855
1074 Ga0157371_10042876
1075 Ga0157371_10097561
1076 Ga0157371_10131219
1077 Ga0157371_10193330
1078 Ga0157371_11179812
1079 Ga0157370_10005375
1080 Ga0157370_10014208
1081 Ga0157370_10043843
1082 Ga0157370_10069701
1083 Ga0157370_10081596
1084 Ga0157370_10124117
1085 Ga0157370_10462354
1086 Ga0157370_10481963
1087 Ga0157369_10073109
1088 Ga0157369_10142024
1089 Ga0157369_10142796
1090 Ga0157369_10144719
1091 Ga0157369_10163505
1092 Ga0157369_10207620
1093 Ga0157369_10930254
1094 Ga0157369_12546049
1095 Ga0157369_12670682
1096 Ga0157374_10053258
1097 Ga0157374_10078091
1098 Ga0157374_10109105
1099 Ga0157374_10213583
1100 Ga0157374_10273743
1101 Ga0157374_10978926
1102 Ga0157374_11199292
1103 Ga0157378_10040383
1104 Ga0157378_10499256
1105 Ga0163162_10035301
1106 Ga0163162_10055886
1107 Ga0157372_10039580
1108 Ga0157372_10051802
1109 Ga0157372_10133418
1110 Ga0157372_10272826
1111 Ga0157372_10414471
1112 Ga0157372_10895627
1113 Ga0157372_11022347
1114 Ga0157372_11629175
1115 Ga0157375_10037522
1116 Ga0157375_10317026
1117 Ga0157375_10489934
1118 Ga0157375_10519038
1119 Ga0157375_11288820
1120 Ga0157379_10034838
1121 Ga0157379_10041644
1122 Ga0157376_10012404
1123 Ga0157376_10432284
1124 Ga0163161_11271022
1125 Ga0197907_10832370
1126 Ga0206355_1597635
1127 Ga0207697_10057339
1128 Ga0207697_10102755
1129 Ga0207656_10010108
1130 Ga0207656_10041974
1131 Ga0207656_10121976
1132 Ga0207656_10396210
1133 Ga0207642_10017239
1134 Ga0207710_10282979
1135 Ga0207680_10002423
1136 Ga0207680_10066844
1137 Ga0207680_10190739
1138 Ga0207647_10001869
1139 Ga0207647_10008618
1140 Ga0207647_10023155
1141 Ga0207647_10038714
1142 Ga0207647_10078390
1143 Ga0207647_10107418
1144 Ga0207647_10186214
1145 Ga0207647_10201749
1146 Ga0207647_10260416
1147 Ga0207645_10050245
1148 Ga0207645_10071608
1149 Ga0207645_10232366
1150 Ga0207645_11076465
1151 Ga0207705_10006944
1152 Ga0207705_10007205
1153 Ga0207705_10009509
1154 Ga0207705_10022470
1155 Ga0207705_10042975
1156 Ga0207705_10104146
1157 Ga0207705_10148650
1158 Ga0207705_10158287
1159 Ga0207705_10397882
1160 Ga0207705_10531687
1161 Ga0207654_10039701
1162 Ga0207654_10188770
1163 Ga0207707_10104523
1164 Ga0207707_10163924
1165 Ga0207707_10198858
1166 Ga0207695_10015342
1167 Ga0207695_10044807
1168 Ga0207695_10288162
1169 Ga0207671_10307134
1170 Ga0207671_10613721
1171 Ga0207660_10001957
1172 Ga0207660_10003177
1173 Ga0207660_10013429
1174 Ga0207660_10019708
1175 Ga0207660_10101126
1176 Ga0207660_11141730
1177 Ga0207662_10639096
1178 Ga0207657_10000857
1179 Ga0207657_10030378
1180 Ga0207657_10032621
1181 Ga0207657_10033313
1182 Ga0207657_10034671
1183 Ga0207657_10045673
1184 Ga0207657_10080385
1185 Ga0207657_10109602
1186 Ga0207649_10016374
1187 Ga0207649_10052847
1188 Ga0207649_10368618
1189 Ga0207649_10459217
1190 Ga0207649_10535865
1191 Ga0207649_10630944
1192 Ga0207649_10732023
1193 Ga0207652_10011380
1194 Ga0207652_10034753
1195 Ga0207652_10230204
1196 Ga0207652_10928517
1197 Ga0207652_11237349
1198 Ga0207681_10223471
1199 Ga0207681_11445831
1200 Ga0207694_10001409
1201 Ga0207694_10045358
1202 Ga0207694_10058218
1203 Ga0207694_10076073
1204 Ga0207694_10117552
1205 Ga0207650_10165519
1206 Ga0207650_10242660
1207 Ga0207650_10434552
1208 Ga0207659_10271701
1209 Ga0207700_10176533
1210 Ga0207700_10366786
1211 Ga0207700_11224764
1212 Ga0207664_10203717
1213 Ga0207664_10559003
1214 Ga0207664_10645360
1215 Ga0207644_10000452
1216 Ga0207644_10028517
1217 Ga0207644_10152900
1218 Ga0207690_10007460
1219 Ga0207690_10016021
1220 Ga0207690_10022929
1221 Ga0207690_10040621
1222 Ga0207690_10070961
1223 Ga0207690_10076697
1224 Ga0207690_11103357
1225 Ga0207706_10000967
1226 Ga0207706_10064263
1227 Ga0207706_10078329
1228 Ga0207706_10128357
1229 Ga0207706_10143800
1230 Ga0207706_10584385
1231 Ga0207706_10686873
1232 Ga0207686_10010151
1233 Ga0207709_10361719
1234 Ga0207670_10097732
1235 Ga0207670_10593400
1236 Ga0207669_10013632
1237 Ga0207669_10087672
1238 Ga0207704_10010516
1239 Ga0207704_10439583
1240 Ga0207691_10006976
1241 Ga0207691_10173265
1242 Ga0207711_10000174
1243 Ga0207711_10018631
1244 Ga0207711_10031804
1245 Ga0207711_10290151
1246 Ga0207711_10403718
1247 Ga0207661_10003230
1248 Ga0207661_10007022
1249 Ga0207661_10106979
1250 Ga0207661_11010648
1251 Ga0207679_10043470
1252 Ga0207679_10206801
1253 Ga0207679_10355918
1254 Ga0207679_10386280
1255 Ga0207679_11510106
1256 Ga0207667_10005210
1257 Ga0207667_10017856
1258 Ga0207667_10074971
1259 Ga0207667_10093913
1260 Ga0207667_10100814
1261 Ga0207667_10361394
1262 Ga0207667_10441419
1263 Ga0207667_10504644
1264 Ga0207667_11082142
1265 Ga0207651_10003557
1266 Ga0207651_10009850
1267 Ga0207651_10241597
1268 Ga0207668_10115809
1269 Ga0207668_10737213
1270 Ga0207640_10046674
1271 Ga0207640_10082893
1272 Ga0207640_10086399
1273 Ga0207640_10105898
1274 Ga0207640_10135080
1275 Ga0207640_10371505
1276 Ga0207640_10481891
1277 Ga0207640_10663488
1278 Ga0207658_10021543
1279 Ga0207658_10107736
1280 Ga0207677_10001901
1281 Ga0207677_10005735
1282 Ga0207677_10020356
1283 Ga0207677_10119515
1284 Ga0207677_11096866
1285 Ga0207703_10001865
1286 Ga0207703_10304476
1287 Ga0207639_10021423
1288 Ga0207639_10023824
1289 Ga0207639_10029388
1290 Ga0207639_10083369
1291 Ga0207639_10247814
1292 Ga0207639_10427459
1293 Ga0207639_11457193
1294 Ga0207639_11826999
1295 Ga0207678_10012520
1296 Ga0207678_10017027
1297 Ga0207678_10066659
1298 Ga0207678_10072294
1299 Ga0207678_10079589
1300 Ga0207678_10283166
1301 Ga0207702_10039942
1302 Ga0207702_10046860
1303 Ga0207702_10110457
1304 Ga0207702_10117705
1305 Ga0207702_10180386
1306 Ga0207702_10226590
1307 Ga0207702_10510008
1308 Ga0207702_10599348
1309 Ga0207702_12244226
1310 Ga0207641_10105719
1311 Ga0207641_10547569
1312 Ga0207648_10027416
1313 Ga0207648_10155272
1314 Ga0207676_10015835
1315 Ga0207676_10819490
1316 Ga0207674_10038488
1317 Ga0207674_10056826
1318 Ga0207674_10057905
1319 Ga0207674_10177137
1320 Ga0207674_11902491
1321 Ga0207675_101178735
1322 Ga0207683_10014579
1323 Ga0207683_10054756
1324 Ga0207698_10000676
1325 Ga0207698_10002291
1326 Ga0207698_10010143
1327 Ga0207698_10015069
1328 Ga0207698_10020711
1329 Ga0207698_10092160
1330 Ga0207698_10115100
1331 Ga0207698_10174136
1332 Ga0207698_10350406
1333 Ga0207698_11720683
1334 Ga0209971_1115372
1335 Ga0268266_10118868
1336 Ga0268265_10400639
1337 Ga0268264_10070009
1338 Ga0268264_12102101
1339 Ga0373942_0337647
1340 Ga0373962_0025764
1341 Ga0373931_0020691
1342 Ga0395899_0008219
1343 Ga0395899_0029113
1344 Ga0395899_0098701
1345 Ga0395899_0118004
1346 Ga0395899_0134711
1347 Ga0395899_0181666
1348 Ga0395899_0187141
1349 Ga0395899_0290412
1350 Ga0395899_0551687
1351 Ga0395900_0002071
1352 Ga0395900_0007204
1353 Ga0395900_0026307
1354 Ga0395900_0027017
1355 Ga0395900_0051163
1356 Ga0395900_0109806
1357 Ga0395900_0117755
1358 Ga0395900_0142302
1359 Ga0395900_0167415
1360 Ga0395900_0182254
1361 Ga0395900_0226186
1362 Ga0395900_0240478
1363 Ga0395900_0289527
1364 Ga0395900_0344670
1365 Ga0395900_0502320
1366 Ga0395900_0549705
1367 Ga0395900_0586913
1368 Ga0395898_0012316
1369 Ga0395898_0036484
1370 Ga0395898_0136702
1371 Ga0395898_0156038
1372 Ga0395898_0157678
1373 Ga0395898_0240053
1374 Ga0395898_0250641
1375 Ga0395898_0328621
1376 Ga0395898_1392963
1377 Ga0395905_0003231
1378 Ga0395905_0007105
1379 Ga0395905_0008817
1380 Ga0395905_0021865
1381 Ga0395905_0026027
1382 Ga0395905_0032174
1383 Ga0395905_0034161
1384 Ga0395905_0038914
1385 Ga0395905_0044434
1386 Ga0395905_0047386
1387 Ga0395905_0058045
1388 Ga0395905_0084221
1389 Ga0395905_0150010
1390 Ga0395905_0218002
1391 Ga0395905_0408563
1392 Ga0395905_0570210
1393 Ga0395905_0627963
1394 Ga0395905_0818913
1395 Ga0395905_1108711
1396 Ga0395905_1246978
1397 Ga0395905_1646509
1398 Ga0395901_0002697
1399 Ga0395901_0004082
1400 Ga0395901_0047206
1401 Ga0395901_0056121
1402 Ga0395901_0100043
1403 Ga0395901_0107033
1404 Ga0395901_0118994
1405 Ga0395901_0126172
1406 Ga0395901_0163777
1407 Ga0395901_0425644
1408 Ga0395901_0604389
1409 Ga0395901_1089537
1410 Ga0436363_1482134
1411 Ga0439458_0045338
1412 Ga0466969_0134476
1413 Ga0466966_0013617
1414 Ga0466966_0047118
1415 Ga0466966_0076825
1416 Ga0466966_0418366
1417 Ga0466961_0034709
1418 Ga0466961_0057019
1419 Ga0466961_0092019
1420 Ga0466961_0367785
1421 Ga0466961_0826566
1422 Ga0466963_0001670
1423 Ga0466963_0007311
1424 Ga0466963_0112317
1425 Ga0466963_0324091
1426 Ga0466964_0139775
1427 Ga0466971_0131479
1428 Ga0466971_0448927
1429 Ga0466970_0299158
1430 Ga0466957_0006254
1431 Ga0466957_0115019
1432 Ga0466959_0039101
1433 Ga0466959_0390287
1434 Ga0466959_0399000
1435 Ga0466959_0420149
1436 Ga0466959_0697851
1437 Ga0466958_0045162
1438 Ga0466958_0151802
1439 Ga0466967_0015138
1440 Ga0466967_0015299
1441 Ga0466967_0085706
1442 Ga0466967_0121805
1443 Ga0466967_0140098
1444 Ga0466967_0155267
1445 Ga0466967_0487424
1446 Ga0466967_1042935
1447 Ga0466967_1689581
1448 Ga0466967_1878239
1449 Ga0466967_2199364
1450 Ga0495598_0001875
1451 Ga0495598_0250895
1452 Ga0495621_0000079
1453 Ga0495633_0091060
1454 Ga0495669_0093129
1455 Ga0495670_0001096
1456 Ga0496100_0007068
1457 Ga0496100_0158435
1458 Ga0496101_0013088
1459 Ga0496101_0058990
1460 Ga0496101_0435222
1461 Ga0496101_1385586
1462 Ga0496102_0234092
1463 Ga0496102_1111030
1464 Ga0496103_0014763
1465 Ga0496104_0043261
1466 Ga0496104_0097442
1467 Ga0496105_0512291
1468 Ga0496106_0336230
1469 Ga0496107_0039520
1470 Ga0496107_1330100
1471 Ga0496108_0026662
1472 Ga0496108_0041963
1473 Ga0496109_0147753
1474 Ga0496109_0180465
1475 Ga0496109_0440564
1476 Ga0496109_0689212
1477 Ga0496110_0398044
1478 Ga0496110_1090404
1479 Ga0496111_0214692
1480 Ga0496111_0766219
1481 Ga0496112_0026228
1482 Ga0496112_0097756
1483 Ga0496112_0282283
1484 Ga0496112_0456321
1485 Ga0496112_0793590
1486 Ga0496113_0495759
1487 Ga0496113_0526759
1488 Ga0496114_0105518
1489 Ga0496115_0000742
1490 Ga0501074_0515445
1491 Ga0501080_0112122
1492 Ga0501044_1465195
1493 Ga0587073_0297477
1494 Ga0587106_029932
1495 Ga0587128_161023
1496 Ga0587069_016548
1497 Ga0466962_0008509
1498 Ga0466962_0047290

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map