F478903

General Info

Members Datasets Scaffolds Average Seq Length
747 277 666 123

Family's Representative Sequence

Representative Sequence 3300003781|Ga0055536_1000005|Ga0055536_1000005236
Length 129
Sequence MSLSPSLQPIESGFAEQPGVQWQAVCSRQDLVSHSGVVVWHDGAQVALIYLPDATQQTLYAIDNHDPQSGANVIGRGLVGCIKDELVIASPLYKQHFRLADGTCLEYPEQRLRTWPARLRGDVVEIGVR

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
4 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
5 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
6 2511231004 Pseudomonas sp. GM102 Isolate Nodule
7 2511231006 Pseudomonas sp. GM17 Isolate Nodule
8 2511231007 Pseudomonas sp. GM18 Isolate Nodule
9 2511231015 Pseudomonas sp. GM49 Isolate Nodule
10 2511231016 Pseudomonas sp. GM50 Isolate Nodule
11 2511231019 Pseudomonas sp. GM67 Isolate Nodule
12 2511231020 Pseudomonas sp. GM74 Isolate Nodule
13 2511231021 Pseudomonas sp. GM78 Isolate Nodule
14 2511231022 Pseudomonas sp. GM79 Isolate Nodule
15 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
16 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
17 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
18 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
19 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
20 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
21 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
22 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
23 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
24 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
25 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
26 2643221569 Achromobacter sp. Root565 Isolate Unclassified
27 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
28 2643221594 Achromobacter sp. Root170 Isolate Unclassified
29 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
30 2643221621 Achromobacter sp. Root83 Isolate Unclassified
31 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
32 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
33 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
34 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
35 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
36 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
37 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
38 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
39 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
40 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
41 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
42 2773857670 Pseudomonas sp. 478 Isolate Unclassified
43 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
44 2784132072 Pseudomonas sp. 460 Isolate Unclassified
45 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
46 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
47 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
48 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
49 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
50 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
51 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
52 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
53 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
54 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
55 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
56 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
57 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
58 2858950400 Achromobacter sp. K91 Isolate Unclassified
59 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
60 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
61 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
62 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
63 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
64 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
65 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
66 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
67 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
68 2941479691
69 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
70 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
71 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
72 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
73 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
74 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
75 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
76 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
77 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
78 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
79 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
80 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
81 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
82 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
83 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
87 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
88 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
89 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
90 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
91 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
102 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
103 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
106 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
115 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
123 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
124 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
125 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
126 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
127 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
128 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
129 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
130 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
131 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
132 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
133 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
134 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
135 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
136 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
137 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
138 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
139 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
140 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
141 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
142 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
143 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
144 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
145 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
146 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
147 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
148 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
149 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
150 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
151 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
152 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
153 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
154 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
155 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
156 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
157 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
158 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
159 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
160 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
161 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
162 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
169 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
170 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
171 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
172 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
173 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
174 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
175 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
176 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
177 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
178 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
179 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
180 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
181 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
184 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
185 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
186 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
187 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
188 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
189 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
190 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
191 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
192 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
193 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
194 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
195 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
196 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
197 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
198 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
199 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
200 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
201 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
202 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
203 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
204 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
205 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
206 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
207 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
208 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
212 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
213 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
214 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
215 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
216 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
217 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
220 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
221 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
222 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
223 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
224 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
225 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
226 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
227 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
228 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
229 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
230 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
231 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
232 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
233 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
234 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
235 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
236 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
241 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
247 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
248 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
249 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
250 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
251 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
252 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
253 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
254 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
255 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
256 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
257 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
258 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
259 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
264 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
265 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
268 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
269 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
270 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
271 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
272 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
273 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
274 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
275 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
276 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
277 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.16
Metatranscriptomes 0
Isolates 10.84

Biome Distribution

Category Percentage (%)
Aerial Root 0.27
Bulb 0
Endosphere 3.61
Nodule 1.61
Rhizoplane 2.54
Rhizosphere 81.26
Stem 0
Stem Tuber 0
Unclassified 10.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_1657 2124908027 Bacteria 29944
2 SwRhRL2b_contig_851711 2162886007 Bacteria 1132
3 Ga0055536_1000005 3300003781 Bacteria 383598
4 Ga0055536_1062540 3300003781 Bacteria 765
5 Ga0055530_10000001 3300003791 Bacteria 383067
6 Ga0055540_1001172 3300003792 Bacteria 16262
7 Ga0065714_10000620 3300005288 Bacteria 3365
8 Ga0065714_10015310 3300005288 Bacteria 2044
9 Ga0065714_10064677 3300005288 Bacteria 24165
10 Ga0065704_10014791 3300005289 Bacteria 2620
11 Ga0065704_10021946 3300005289 Bacteria 1222
12 Ga0065704_10121824 3300005289 Bacteria 1753
13 Ga0065704_10126369 3300005289 Bacteria 1690
14 Ga0065712_10008802 3300005290 Bacteria 2389
15 Ga0065712_10106776 3300005290 Bacteria 1910
16 Ga0065712_10763496 3300005290 Bacteria 524
17 Ga0065715_10030401 3300005293 Bacteria 1217
18 Ga0070670_100000278 3300005331 Bacteria 44999
19 Ga0070665_100371598 3300005548 Bacteria 1437
20 Ga0075363_100444973 3300006048 Bacteria 765
21 Ga0075364_10032605 3300006051 Bacteria 3350
22 Ga0075364_10109152 3300006051 Bacteria 1846
23 Ga0075364_10527136 3300006051 Bacteria 807
24 Ga0075364_10529504 3300006051 Bacteria 806
25 Ga0075432_10001221 3300006058 Bacteria 8267
26 Ga0075432_10025526 3300006058 Bacteria 2027
27 Ga0075432_10065681 3300006058 Bacteria 1297
28 Ga0075432_10157034 3300006058 Bacteria 877
29 Ga0075432_10197982 3300006058 Bacteria 794
30 Ga0075362_10007673 3300006177 Bacteria 4098
31 Ga0075362_10358669 3300006177 Bacteria 730
32 Ga0079104_1001171 3300006946 Bacteria 18943
33 Ga0105251_10001187 3300009011 Bacteria 22561
34 Ga0105251_10002196 3300009011 Bacteria 15597
35 Ga0105251_10009881 3300009011 Bacteria 5589
36 Ga0105251_10051294 3300009011 Bacteria 1968
37 Ga0105251_10064025 3300009011 Bacteria 1724
38 Ga0105244_10002217 3300009036 Bacteria 14804
39 Ga0105244_10021228 3300009036 Bacteria 3596
40 Ga0105244_10051985 3300009036 Bacteria 2087
41 Ga0105244_10123987 3300009036 Bacteria 1250
42 Ga0105244_10206944 3300009036 Bacteria 924
43 Ga0105250_10000088 3300009092 Bacteria 80904
44 Ga0105250_10181237 3300009092 Bacteria 884
45 Ga0105245_11572225 3300009098 Bacteria 709
46 Ga0105246_10130639 3300011119 Bacteria 1876
47 Ga0105246_12159075 3300011119 Bacteria 541
48 Ga0157373_10001981 3300013100 Bacteria 15527
49 Ga0157373_10002994 3300013100 Bacteria 12778
50 Ga0157373_10141568 3300013100 Bacteria 1692
51 Ga0157373_10283447 3300013100 Bacteria 1174
52 Ga0157373_10291923 3300013100 Bacteria 1156
53 Ga0157371_10001627 3300013102 Bacteria 22983
54 Ga0157371_10002182 3300013102 Bacteria 19005
55 Ga0157371_10442782 3300013102 Bacteria 954
56 Ga0157371_10868483 3300013102 Bacteria 683
57 Ga0157370_10058014 3300013104 Bacteria 3679
58 Ga0157370_10064419 3300013104 Bacteria 3470
59 Ga0157370_10494467 3300013104 Bacteria 1123
60 Ga0157370_11121626 3300013104 Bacteria 710
61 Ga0157369_10300835 3300013105 Bacteria 1669
62 Ga0163162_10109103 3300013306 Bacteria 2864
63 Ga0157372_10294322 3300013307 Bacteria 1888
64 Ga0157372_11023992 3300013307 Bacteria 956
65 Ga0182008_10015899 3300014497 Bacteria 3918
66 Ga0182008_10022033 3300014497 Bacteria 3265
67 Ga0182008_10060648 3300014497 Bacteria 1865
68 Ga0182008_10193068 3300014497 Bacteria 1034
69 Ga0182006_1000073 3300015261 Bacteria 131224
70 Ga0182006_1078275 3300015261 Bacteria 1211
71 Ga0182006_1079455 3300015261 Bacteria 1199
72 Ga0182006_1104135 3300015261 Bacteria 1004
73 Ga0182007_10000031 3300015262 Bacteria 152299
74 Ga0182007_10001269 3300015262 Bacteria 13700
75 Ga0182007_10123341 3300015262 Bacteria 868
76 Ga0182007_10341485 3300015262 Bacteria 560
77 Ga0182005_1001430 3300015265 Bacteria 9604
78 Ga0182005_1001441 3300015265 Bacteria 9585
79 Ga0163161_10008080 3300017792 Bacteria 7275
80 Ga0163161_10013117 3300017792 Bacteria 5760
81 Ga0163161_10089224 3300017792 Bacteria 2280
82 Ga0163161_11651548 3300017792 Bacteria 566
83 Ga0209759_1008003 3300025256 Bacteria 3338
84 Ga0209130_1027444 3300025284 Bacteria 1209
85 Ga0209676_1000003 3300025292 Bacteria 1454178
86 Ga0209676_1015230 3300025292 Bacteria 2840
87 Ga0209050_1000004 3300025298 Bacteria 1600040
88 Ga0209050_1024606 3300025298 Bacteria 2077
89 Ga0209051_1000006 3300025303 Bacteria 1015785
90 Ga0209051_1016324 3300025303 Bacteria 3367
91 Ga0207696_1000091 3300025711 Bacteria 187999
92 Ga0207696_1051065 3300025711 Bacteria 1182
93 Ga0207655_1000125 3300025728 Bacteria 152896
94 Ga0207655_1024157 3300025728 Bacteria 2987
95 Ga0207655_1063672 3300025728 Bacteria 1411
96 Ga0207655_1070544 3300025728 Bacteria 1301
97 Ga0207655_1166382 3300025728 Bacteria 685
98 Ga0207713_1000432 3300025735 Bacteria 44225
99 Ga0207713_1027333 3300025735 Bacteria 2593
100 Ga0207713_1033996 3300025735 Bacteria 2219
101 Ga0207713_1063250 3300025735 Bacteria 1398
102 Ga0207713_1083462 3300025735 Bacteria 1142
103 Ga0207650_10001831 3300025925 Bacteria 15028
104 Ga0209281_1000055 3300027111 Bacteria 308297
105 Ga0209371_1025273 3300027312 Bacteria 1367
106 Ga0209371_1047411 3300027312 Bacteria 840
107 Ga0207428_10013492 3300027907 Bacteria 7136
108 Ga0207428_10037770 3300027907 Bacteria 3928
109 Ga0207428_10100291 3300027907 Bacteria 2238
110 Ga0207428_10112499 3300027907 Bacteria 2094
111 Ga0207428_10138096 3300027907 Bacteria 1863
112 Ga0207428_10222404 3300027907 Bacteria 1415
113 Ga0207428_10351369 3300027907 Bacteria 1085
114 Ga0268256_1030478 3300030500 Bacteria 1306
115 Ga0268256_1053454 3300030500 Bacteria 840
116 Ga0307405_10000054 3300031731 Bacteria 58365
117 Ga0307413_10925653 3300031824 Bacteria 742
118 Ga0307412_10008940 3300031911 Bacteria 5736
119 Ga0307412_10307160 3300031911 Bacteria 1256
120 Ga0307414_10060065 3300032004 Bacteria 2687
121 Ga0307414_10433090 3300032004 Bacteria 1149
122 Ga0307414_10880053 3300032004 Bacteria 820
123 Ga0439438_001379 3300041405 Bacteria 10714
124 Ga0439438_002332 3300041405 Bacteria 8103
125 Ga0439438_010094 3300041405 Bacteria 3012
126 Ga0439438_016886 3300041405 Bacteria 2113
127 Ga0439438_042108 3300041405 Bacteria 1182
128 Ga0439438_044515 3300041405 Bacteria 1143
129 Ga0439447_002390 3300041407 Bacteria 6857
130 Ga0439447_010927 3300041407 Bacteria 2673
131 Ga0439447_014917 3300041407 Bacteria 2167
132 Ga0439447_031406 3300041407 Bacteria 1332
133 Ga0439447_051296 3300041407 Bacteria 985
134 Ga0439466_0000337 3300041411 Bacteria 18092
135 Ga0439466_0003576 3300041411 Bacteria 6008
136 Ga0439466_0004912 3300041411 Bacteria 5136
137 Ga0439466_0006151 3300041411 Bacteria 4572
138 Ga0439466_0008368 3300041411 Bacteria 3898
139 Ga0439466_0014863 3300041411 Bacteria 2830
140 Ga0439465_0169942 3300041413 Bacteria 785
141 Ga0439431_0027622 3300041997 Bacteria 1395
142 Ga0439437_000576 3300042000 Bacteria 3657
143 Ga0439432_000485 3300042006 Bacteria 14844
144 Ga0439432_062442 3300042006 Bacteria 1146
145 Ga0439432_068510 3300042006 Bacteria 1084
146 Ga0439451_054775 3300042009 Bacteria 798
147 Ga0439452_000312 3300042010 Bacteria 31041
148 Ga0439452_002749 3300042010 Bacteria 6364
149 Ga0439452_015093 3300042010 Bacteria 2128
150 Ga0439452_137099 3300042010 Bacteria 517
151 Ga0439456_000086 3300042013 Bacteria 32013
152 Ga0439456_144951 3300042013 Bacteria 552
153 Ga0439456_164921 3300042013 Bacteria 519
154 Ga0439463_000044 3300042016 Bacteria 26483
155 Ga0439463_010162 3300042016 Bacteria 2313
156 Ga0439463_160675 3300042016 Bacteria 582
157 Ga0450911_000043 3300042115 Bacteria 54055
158 Ga0450911_004017 3300042115 Bacteria 2477
159 Ga0450911_015820 3300042115 Bacteria 997
160 Ga0450911_031866 3300042115 Bacteria 684
161 Ga0450919_013179 3300042121 Bacteria 936
162 Ga0450919_019237 3300042121 Bacteria 771
163 Ga0450920_002331 3300042122 Bacteria 3219
164 Ga0450922_000263 3300042124 Bacteria 5571
165 Ga0450923_001492 3300042125 Bacteria 3121
166 Ga0450890_000773 3300042127 Bacteria 4613
167 Ga0450898_099939 3300042134 Bacteria 605
168 Ga0450900_028972 3300042136 Bacteria 799
169 Ga0450902_001251 3300042137 Bacteria 3421
170 Ga0450902_005795 3300042137 Bacteria 1879
171 Ga0450902_054241 3300042137 Bacteria 689
172 Ga0450902_081317 3300042137 Bacteria 569
173 Ga0450903_011597 3300042138 Bacteria 1417
174 Ga0450903_024453 3300042138 Bacteria 926
175 Ga0450903_037316 3300042138 Bacteria 723
176 Ga0450903_058382 3300042138 Bacteria 560
177 Ga0450904_000914 3300042139 Bacteria 4767
178 Ga0450904_005500 3300042139 Bacteria 1280
179 Ga0450905_004669 3300042142 Bacteria 1819
180 Ga0450905_100246 3300042142 Bacteria 519
181 Ga0450906_002759 3300042145 Bacteria 3823
182 Ga0450906_006176 3300042145 Bacteria 2427
183 Ga0450907_000305 3300042146 Bacteria 16483
184 Ga0450907_004317 3300042146 Bacteria 2457
185 Ga0450907_008056 3300042146 Bacteria 1754
186 Ga0450907_079659 3300042146 Bacteria 568
187 Ga0439446_0055343 3300042156 Bacteria 1191
188 Ga0439446_0349778 3300042156 Bacteria 526
189 Ga0450908_000765 3300042184 Bacteria 6152
190 Ga0450908_002712 3300042184 Bacteria 3456
191 Ga0450909_001652 3300042185 Bacteria 3119
192 Ga0439434_0016770 3300042435 Bacteria 2189
193 Ga0439434_0312792 3300042435 Bacteria 544
194 Ga0439459_0003870 3300042438 Bacteria 2393
195 Ga0439460_0011025 3300042461 Bacteria 2325
196 Ga0439460_0054477 3300042461 Bacteria 1206
197 Ga0439460_0096119 3300042461 Bacteria 947
198 Ga0450916_005221 3300042530 Bacteria 1495
199 Ga0450918_008214 3300042531 Bacteria 1837
200 Ga0450893_0083011 3300042532 Bacteria 635
201 Ga0450901_000625 3300042533 Bacteria 4155
202 Ga0450901_023089 3300042533 Bacteria 672
203 Ga0439440_0001132 3300042993 Bacteria 4769
204 Ga0439440_0058125 3300042993 Bacteria 981
205 Ga0495617_000074 3300046452 Bacteria 80489
206 Ga0495617_000853 3300046452 Bacteria 14465
207 Ga0495617_006831 3300046452 Bacteria 3987
208 Ga0495617_008946 3300046452 Bacteria 3444
209 Ga0495617_020213 3300046452 Bacteria 2250
210 Ga0495617_021372 3300046452 Bacteria 2185
211 Ga0495617_224828 3300046452 Bacteria 583
212 Ga0495617_225029 3300046452 Bacteria 582
213 Ga0495627_000736 3300046453 Bacteria 24631
214 Ga0495627_008855 3300046453 Bacteria 3732
215 Ga0495627_018373 3300046453 Bacteria 2359
216 Ga0495627_021266 3300046453 Bacteria 2153
217 Ga0495627_031380 3300046453 Bacteria 1678
218 Ga0495627_084677 3300046453 Bacteria 916
219 Ga0495627_195694 3300046453 Bacteria 557
220 Ga0495603_0011361 3300046455 Bacteria 5392
221 Ga0495603_0059747 3300046455 Bacteria 2253
222 Ga0495603_0070372 3300046455 Bacteria 2057
223 Ga0495603_0075143 3300046455 Bacteria 1984
224 Ga0495603_0528422 3300046455 Bacteria 675
225 Ga0495590_0000260 3300046457 Bacteria 28843
226 Ga0495590_0002081 3300046457 Bacteria 8383
227 Ga0495590_0006286 3300046457 Bacteria 4649
228 Ga0495590_0060216 3300046457 Bacteria 1329
229 Ga0495591_000021 3300046458 Bacteria 203554
230 Ga0495591_001668 3300046458 Bacteria 13384
231 Ga0495591_001809 3300046458 Bacteria 12666
232 Ga0495591_005739 3300046458 Bacteria 5660
233 Ga0495591_013862 3300046458 Bacteria 2926
234 Ga0495591_039014 3300046458 Bacteria 1363
235 Ga0495591_046742 3300046458 Bacteria 1201
236 Ga0495591_154922 3300046458 Bacteria 549
237 Ga0495629_0885749 3300046459 Bacteria 586
238 Ga0495638_0008684 3300046460 Bacteria 7185
239 Ga0495638_0012961 3300046460 Bacteria 5692
240 Ga0495638_0013040 3300046460 Bacteria 5675
241 Ga0495638_0013111 3300046460 Bacteria 5658
242 Ga0495638_0024127 3300046460 Bacteria 3969
243 Ga0495638_0024582 3300046460 Bacteria 3926
244 Ga0495638_0030329 3300046460 Bacteria 3482
245 Ga0495638_0113247 3300046460 Bacteria 1609
246 Ga0495638_0246437 3300046460 Bacteria 987
247 Ga0495653_0025832 3300046463 Bacteria 4712
248 Ga0495653_0071421 3300046463 Bacteria 2595
249 Ga0495650_0000522 3300046471 Bacteria 56293
250 Ga0495650_0003857 3300046471 Bacteria 10631
251 Ga0495650_0005962 3300046471 Bacteria 7727
252 Ga0495650_0009498 3300046471 Bacteria 5524
253 Ga0495650_0012925 3300046471 Bacteria 4454
254 Ga0495650_0060103 3300046471 Bacteria 1527
255 Ga0495650_0120673 3300046471 Bacteria 965
256 Ga0495580_0364450 3300046472 Bacteria 978
257 Ga0495605_0000013 3300046474 Bacteria 308178
258 Ga0495605_0000274 3300046474 Bacteria 58499
259 Ga0495605_0000350 3300046474 Bacteria 45096
260 Ga0495605_0001555 3300046474 Bacteria 14911
261 Ga0495605_0008937 3300046474 Bacteria 5647
262 Ga0495605_0031436 3300046474 Bacteria 2712
263 Ga0495605_0060711 3300046474 Bacteria 1811
264 Ga0495605_0074505 3300046474 Bacteria 1597
265 Ga0495605_0172319 3300046474 Bacteria 955
266 Ga0495605_0435498 3300046474 Bacteria 541
267 Ga0495639_0000002 3300046475 Bacteria 192403
268 Ga0495639_0080090 3300046475 Bacteria 1520
269 Ga0495664_0835448 3300046477 Bacteria 540
270 Ga0495584_0000019 3300046491 Bacteria 140608
271 Ga0495584_0000084 3300046491 Bacteria 65138
272 Ga0495584_0000094 3300046491 Bacteria 60342
273 Ga0495584_0005360 3300046491 Bacteria 6797
274 Ga0495584_0013440 3300046491 Bacteria 4180
275 Ga0495584_0015342 3300046491 Bacteria 3903
276 Ga0495584_0050923 3300046491 Bacteria 2085
277 Ga0495584_0063424 3300046491 Bacteria 1858
278 Ga0495584_0601674 3300046491 Bacteria 560
279 Ga0495585_0000523 3300046492 Bacteria 36267
280 Ga0495585_0005919 3300046492 Bacteria 7652
281 Ga0495585_0023445 3300046492 Bacteria 3541
282 Ga0495585_0038627 3300046492 Bacteria 2686
283 Ga0495585_0043720 3300046492 Bacteria 2504
284 Ga0495585_0102914 3300046492 Bacteria 1526
285 Ga0495585_0389744 3300046492 Bacteria 672
286 Ga0495594_0003335 3300046499 Bacteria 8303
287 Ga0495594_0006359 3300046499 Bacteria 6072
288 Ga0495594_0050618 3300046499 Bacteria 2285
289 Ga0495596_0000012 3300046500 Bacteria 125996
290 Ga0495607_0000092 3300046501 Bacteria 93857
291 Ga0495607_0005609 3300046501 Bacteria 8952
292 Ga0495607_0011700 3300046501 Bacteria 5824
293 Ga0495607_0019576 3300046501 Bacteria 4297
294 Ga0495607_0022453 3300046501 Bacteria 3962
295 Ga0495607_0170408 3300046501 Bacteria 1100
296 Ga0495607_0325135 3300046501 Bacteria 716
297 Ga0495583_0000042 3300046506 Bacteria 234630
298 Ga0495583_0000916 3300046506 Bacteria 34892
299 Ga0495583_0003022 3300046506 Bacteria 13408
300 Ga0495583_0011012 3300046506 Bacteria 5216
301 Ga0495583_0049265 3300046506 Bacteria 1930
302 Ga0495606_0004827 3300046507 Bacteria 13237
303 Ga0495606_0067429 3300046507 Bacteria 2265
304 Ga0495610_0002962 3300046512 Bacteria 13691
305 Ga0495610_0008070 3300046512 Bacteria 6887
306 Ga0495610_0011561 3300046512 Bacteria 5386
307 Ga0495610_0019399 3300046512 Bacteria 3806
308 Ga0495610_0058655 3300046512 Bacteria 1840
309 Ga0495610_0071758 3300046512 Bacteria 1613
310 Ga0495610_0112003 3300046512 Bacteria 1207
311 Ga0495610_0120817 3300046512 Bacteria 1148
312 Ga0495616_0027295 3300046513 Bacteria 3030
313 Ga0495616_0036981 3300046513 Bacteria 2515
314 Ga0495616_0061841 3300046513 Bacteria 1835
315 Ga0495616_0092400 3300046513 Bacteria 1430
316 Ga0495616_0100219 3300046513 Bacteria 1359
317 Ga0495616_0158909 3300046513 Bacteria 1018
318 Ga0495620_0000072 3300046515 Bacteria 83803
319 Ga0495620_0002118 3300046515 Bacteria 11537
320 Ga0495620_0100079 3300046515 Bacteria 1156
321 Ga0495628_0571123 3300046516 Bacteria 810
322 Ga0495630_0340132 3300046517 Bacteria 1148
323 Ga0495631_0004935 3300046518 Bacteria 7030
324 Ga0495631_0011468 3300046518 Bacteria 4356
325 Ga0495631_0060011 3300046518 Bacteria 1651
326 Ga0495631_0066629 3300046518 Bacteria 1558
327 Ga0495631_0075050 3300046518 Bacteria 1459
328 Ga0495631_0102336 3300046518 Bacteria 1232
329 Ga0495631_0187587 3300046518 Bacteria 885
330 Ga0495631_0453359 3300046518 Bacteria 546
331 Ga0495632_0000200 3300046519 Bacteria 60951
332 Ga0495632_0000626 3300046519 Bacteria 32670
333 Ga0495632_0004655 3300046519 Bacteria 9266
334 Ga0495632_0005740 3300046519 Bacteria 8148
335 Ga0495632_0009057 3300046519 Bacteria 6031
336 Ga0495632_0014259 3300046519 Bacteria 4502
337 Ga0495632_0049489 3300046519 Bacteria 2077
338 Ga0495632_0059949 3300046519 Bacteria 1850
339 Ga0495632_0113693 3300046519 Bacteria 1269
340 Ga0495632_0129975 3300046519 Bacteria 1172
341 Ga0495637_0000246 3300046520 Bacteria 42500
342 Ga0495637_0001150 3300046520 Bacteria 16217
343 Ga0495637_0005041 3300046520 Bacteria 6788
344 Ga0495637_0013469 3300046520 Bacteria 3878
345 Ga0495637_0019963 3300046520 Bacteria 3089
346 Ga0495637_0038372 3300046520 Bacteria 2074
347 Ga0495637_0099313 3300046520 Bacteria 1139
348 Ga0495637_0202657 3300046520 Bacteria 728
349 Ga0495637_0364208 3300046520 Bacteria 505
350 Ga0495643_0008180 3300046522 Bacteria 6651
351 Ga0495643_0029961 3300046522 Bacteria 3042
352 Ga0495643_0103230 3300046522 Bacteria 1458
353 Ga0495643_0179055 3300046522 Bacteria 1031
354 Ga0495644_0003033 3300046523 Bacteria 6648
355 Ga0495644_0003236 3300046523 Bacteria 6434
356 Ga0495644_0045277 3300046523 Bacteria 1654
357 Ga0495644_0064282 3300046523 Bacteria 1379
358 Ga0495644_0092902 3300046523 Bacteria 1139
359 Ga0495644_0354957 3300046523 Bacteria 577
360 Ga0495648_0007494 3300046524 Bacteria 8728
361 Ga0495648_0088033 3300046524 Bacteria 1746
362 Ga0495648_0096671 3300046524 Bacteria 1640
363 Ga0495648_0128660 3300046524 Bacteria 1349
364 Ga0495648_0150692 3300046524 Bacteria 1213
365 Ga0495648_0191884 3300046524 Bacteria 1030
366 Ga0495648_0245376 3300046524 Bacteria 867
367 Ga0495648_0252056 3300046524 Bacteria 851
368 Ga0495648_0479620 3300046524 Bacteria 538
369 Ga0495666_0015946 3300046526 Bacteria 3742
370 Ga0495666_0016453 3300046526 Bacteria 3683
371 Ga0495666_0042528 3300046526 Bacteria 2196
372 Ga0495666_0286387 3300046526 Bacteria 746
373 Ga0495642_0000008 3300046528 Bacteria 162190
374 Ga0495642_0000220 3300046528 Bacteria 32909
375 Ga0495642_0001436 3300046528 Bacteria 10677
376 Ga0495642_0440469 3300046528 Bacteria 575
377 Ga0495654_0000382 3300046530 Bacteria 38175
378 Ga0495654_0001014 3300046530 Bacteria 20561
379 Ga0495654_0001909 3300046530 Bacteria 13840
380 Ga0495654_0002718 3300046530 Bacteria 11172
381 Ga0495654_0012316 3300046530 Bacteria 4596
382 Ga0495654_0067260 3300046530 Bacteria 1706
383 Ga0495654_0081906 3300046530 Bacteria 1511
384 Ga0495654_0104485 3300046530 Bacteria 1299
385 Ga0495654_0137908 3300046530 Bacteria 1089
386 Ga0495654_0175446 3300046530 Bacteria 931
387 Ga0495654_0188060 3300046530 Bacteria 890
388 Ga0495654_0220789 3300046530 Bacteria 801
389 Ga0495654_0269200 3300046530 Bacteria 704
390 Ga0495587_0004751 3300046536 Bacteria 8919
391 Ga0495609_0000139 3300046538 Bacteria 76273
392 Ga0495609_0005717 3300046538 Bacteria 6475
393 Ga0495609_0015771 3300046538 Bacteria 3531
394 Ga0495609_0078150 3300046538 Bacteria 1448
395 Ga0495597_0002429 3300046542 Bacteria 11820
396 Ga0495597_0002445 3300046542 Bacteria 11780
397 Ga0495597_0004619 3300046542 Bacteria 7509
398 Ga0495597_0018509 3300046542 Bacteria 3269
399 Ga0495597_0038510 3300046542 Bacteria 2142
400 Ga0495597_0055421 3300046542 Bacteria 1738
401 Ga0495597_0080563 3300046542 Bacteria 1392
402 Ga0495597_0121295 3300046542 Bacteria 1089
403 Ga0495597_0136393 3300046542 Bacteria 1014
404 Ga0495597_0253825 3300046542 Bacteria 690
405 Ga0495597_0324070 3300046542 Bacteria 594
406 Ga0495622_0003749 3300046557 Bacteria 7111
407 Ga0495622_0012966 3300046557 Bacteria 3867
408 Ga0495622_0084547 3300046557 Bacteria 1459
409 Ga0495622_0132096 3300046557 Bacteria 1136
410 Ga0495622_0247102 3300046557 Bacteria 785
411 Ga0495622_0301368 3300046557 Bacteria 698
412 Ga0495633_0000194 3300046558 Bacteria 77718
413 Ga0495633_0054011 3300046558 Bacteria 1890
414 Ga0495633_0266920 3300046558 Bacteria 779
415 Ga0495656_0023727 3300046615 Bacteria 2416
416 Ga0495656_0035823 3300046615 Bacteria 2040
417 Ga0495668_0008218 3300046616 Bacteria 6547
418 Ga0495668_0170276 3300046616 Bacteria 1193
419 Ga0495634_0000551 3300046642 Bacteria 36662
420 Ga0495611_0002248 3300046648 Bacteria 8962
421 Ga0495611_0018225 3300046648 Bacteria 3009
422 Ga0495611_0041665 3300046648 Bacteria 2048
423 Ga0495625_0005762 3300046660 Bacteria 11202
424 Ga0495625_0012208 3300046660 Bacteria 6966
425 Ga0495625_0095756 3300046660 Bacteria 2045
426 Ga0495625_0100574 3300046660 Bacteria 1987
427 Ga0495625_0392580 3300046660 Bacteria 868
428 Ga0495625_0764091 3300046660 Bacteria 565
429 Ga0495625_0788529 3300046660 Bacteria 553
430 Ga0495635_0161167 3300046663 Bacteria 1526
431 Ga0495659_0000035 3300046664 Bacteria 64001
432 Ga0495659_0019346 3300046664 Bacteria 2278
433 Ga0495659_0025564 3300046664 Bacteria 2022
434 Ga0495659_0061942 3300046664 Bacteria 1383
435 Ga0495661_0000056 3300046665 Bacteria 138115
436 Ga0495661_0001990 3300046665 Bacteria 16147
437 Ga0495661_0002752 3300046665 Bacteria 13365
438 Ga0495661_0010111 3300046665 Bacteria 6450
439 Ga0495661_0016118 3300046665 Bacteria 4965
440 Ga0495588_0035786 3300046674 Bacteria 2517
441 Ga0495588_0052446 3300046674 Bacteria 2102
442 Ga0495588_0106523 3300046674 Bacteria 1475
443 Ga0495588_0207746 3300046674 Bacteria 1034
444 Ga0495588_0220812 3300046674 Bacteria 1000
445 Ga0495657_0044821 3300046675 Bacteria 3005
446 Ga0495623_0029124 3300046679 Bacteria 3554
447 Ga0495623_0125201 3300046679 Bacteria 1543
448 Ga0495646_0000188 3300046680 Bacteria 30724
449 Ga0495646_0008812 3300046680 Bacteria 6406
450 Ga0495669_0003562 3300046684 Bacteria 6420
451 Ga0495613_0220562 3300046689 Bacteria 1331
452 Ga0495670_0000280 3300046691 Bacteria 24045
453 Ga0495670_0022098 3300046691 Bacteria 3141
454 Ga0495670_0027037 3300046691 Bacteria 2840
455 Ga0495670_0083672 3300046691 Bacteria 1627
456 Ga0495670_0092573 3300046691 Bacteria 1548
457 Ga0495670_0093066 3300046691 Bacteria 1544
458 Ga0495670_0209161 3300046691 Bacteria 1034
459 Ga0495671_0000136 3300046692 Bacteria 65148
460 Ga0495671_0001271 3300046692 Bacteria 17213
461 Ga0495671_0003445 3300046692 Bacteria 9712
462 Ga0495671_0013552 3300046692 Bacteria 4407
463 Ga0495671_0018288 3300046692 Bacteria 3720
464 Ga0495671_0024428 3300046692 Bacteria 3147
465 Ga0495671_0053875 3300046692 Bacteria 1995
466 Ga0495671_0133849 3300046692 Bacteria 1208
467 Ga0495671_0135276 3300046692 Bacteria 1201
468 Ga0495671_0195153 3300046692 Bacteria 982
469 Ga0495671_0354525 3300046692 Bacteria 703
470 Ga0495671_0435302 3300046692 Bacteria 627
471 Ga0495649_0000289 3300046694 Bacteria 44254
472 Ga0495649_0001225 3300046694 Bacteria 19753
473 Ga0495649_0002684 3300046694 Bacteria 12402
474 Ga0495649_0040480 3300046694 Bacteria 2552
475 Ga0495649_0111503 3300046694 Bacteria 1450
476 Ga0495649_0132989 3300046694 Bacteria 1312
477 Ga0495649_0486431 3300046694 Bacteria 614
478 Ga0495589_0000075 3300046794 Bacteria 92974
479 Ga0495589_0004183 3300046794 Bacteria 7722
480 Ga0495589_0004579 3300046794 Bacteria 7351
481 Ga0495589_0019957 3300046794 Bacteria 3427
482 Ga0495589_0039791 3300046794 Bacteria 2349
483 Ga0495589_0140516 3300046794 Bacteria 1156
484 Ga0495589_0432871 3300046794 Bacteria 602
485 Ga0495600_0027040 3300046809 Bacteria 3706
486 Ga0495600_0136526 3300046809 Bacteria 1593
487 Ga0495660_0001165 3300046810 Bacteria 18689
488 Ga0495660_0004284 3300046810 Bacteria 8651
489 Ga0495660_0027277 3300046810 Bacteria 3232
490 Ga0495660_0038794 3300046810 Bacteria 2647
491 Ga0495660_0047225 3300046810 Bacteria 2359
492 Ga0495660_0051636 3300046810 Bacteria 2236
493 Ga0495660_0054626 3300046810 Bacteria 2163
494 Ga0495660_0058591 3300046810 Bacteria 2073
495 Ga0495660_0068446 3300046810 Bacteria 1889
496 Ga0495660_0360947 3300046810 Bacteria 644
497 Ga0495660_0414168 3300046810 Bacteria 588
498 Ga0495581_0001262 3300047315 Bacteria 13921
499 Ga0495604_0041164 3300047317 Bacteria 3624
500 Ga0495604_0163080 3300047317 Bacteria 1573
501 Ga0495636_0001517 3300047318 Bacteria 8809
502 Ga0495674_0250491 3300047319 Bacteria 1458
503 Ga0495672_0000185 3300047320 Bacteria 90160
504 Ga0495672_0000433 3300047320 Bacteria 50107
505 Ga0495672_0001129 3300047320 Bacteria 27029
506 Ga0495672_0003508 3300047320 Bacteria 13369
507 Ga0495672_0004874 3300047320 Bacteria 10792
508 Ga0495672_0008343 3300047320 Bacteria 7663
509 Ga0495672_0011134 3300047320 Bacteria 6363
510 Ga0495672_0011424 3300047320 Bacteria 6268
511 Ga0495672_0086845 3300047320 Bacteria 1728
512 Ga0495672_0099498 3300047320 Bacteria 1580
513 Ga0495672_0116520 3300047320 Bacteria 1426
514 Ga0495672_0119888 3300047320 Bacteria 1400
515 Ga0495672_0317663 3300047320 Bacteria 732
516 Ga0495680_0058791 3300047322 Bacteria 2969
517 Ga0495680_0126535 3300047322 Bacteria 1881
518 Ga0495680_0196154 3300047322 Bacteria 1450
519 Ga0495680_0362199 3300047322 Bacteria 1007
520 Ga0495683_0000002 3300047323 Bacteria 638279
521 Ga0495683_0005744 3300047323 Bacteria 6838
522 Ga0495683_0020071 3300047323 Bacteria 3448
523 Ga0495683_0044541 3300047323 Bacteria 2231
524 Ga0495683_0051082 3300047323 Bacteria 2068
525 Ga0495683_0054187 3300047323 Bacteria 1999
526 Ga0495683_0079842 3300047323 Bacteria 1597
527 Ga0495683_0109986 3300047323 Bacteria 1316
528 Ga0495683_0150967 3300047323 Bacteria 1081
529 Ga0495683_0172534 3300047323 Bacteria 993
530 Ga0495687_000260 3300047443 Bacteria 71197
531 Ga0495687_098152 3300047443 Bacteria 1105
532 Ga0495687_107390 3300047443 Bacteria 1034
533 Ga0495675_0173648 3300047444 Bacteria 1322
534 Ga0495675_0232724 3300047444 Bacteria 1111
535 Ga0495677_0001065 3300047445 Bacteria 11007
536 Ga0495679_000120 3300047446 Bacteria 69112
537 Ga0495679_000830 3300047446 Bacteria 19679
538 Ga0495679_002365 3300047446 Bacteria 9664
539 Ga0495679_003005 3300047446 Bacteria 8301
540 Ga0495679_028207 3300047446 Bacteria 1843
541 Ga0495685_208062 3300047447 Bacteria 626
542 Ga0495673_0001462 3300047469 Bacteria 18726
543 Ga0495673_0002369 3300047469 Bacteria 13372
544 Ga0495673_0004634 3300047469 Bacteria 8555
545 Ga0495673_0007542 3300047469 Bacteria 6231
546 Ga0495673_0008384 3300047469 Bacteria 5824
547 Ga0495673_0010277 3300047469 Bacteria 5105
548 Ga0495673_0014768 3300047469 Bacteria 4050
549 Ga0495673_0018542 3300047469 Bacteria 3504
550 Ga0495673_0034553 3300047469 Bacteria 2336
551 Ga0495673_0131399 3300047469 Bacteria 983
552 Ga0495681_0000009 3300047470 Bacteria 205224
553 Ga0495681_0000031 3300047470 Bacteria 128177
554 Ga0495681_0005002 3300047470 Bacteria 8938
555 Ga0495681_0007056 3300047470 Bacteria 7252
556 Ga0495681_0007175 3300047470 Bacteria 7167
557 Ga0495681_0010838 3300047470 Bacteria 5486
558 Ga0495681_0085040 3300047470 Bacteria 1405
559 Ga0495681_0102595 3300047470 Bacteria 1248
560 Ga0495681_0241110 3300047470 Bacteria 717
561 Ga0495681_0302572 3300047470 Bacteria 618
562 Ga0495681_0403390 3300047470 Bacteria 510
563 Ga0495684_0134274 3300047471 Bacteria 1857
564 Ga0495686_0021109 3300047472 Bacteria 4331
565 Ga0495686_0071059 3300047472 Bacteria 2143
566 Ga0495686_0186726 3300047472 Bacteria 1197
567 Ga0495593_0022018 3300047673 Bacteria 3556
568 Ga0495593_0082015 3300047673 Bacteria 1667
569 Ga0495593_0127587 3300047673 Bacteria 1292
570 Ga0495593_0217454 3300047673 Bacteria 959
571 Ga0495593_0454374 3300047673 Bacteria 641
572 Ga0495602_0273094 3300048088 Bacteria 1249
573 Ga0495614_0465562 3300048089 Bacteria 599
574 Ga0495626_0000112 3300048091 Bacteria 105221
575 Ga0495626_0000212 3300048091 Bacteria 69276
576 Ga0495626_0000525 3300048091 Bacteria 38289
577 Ga0495626_0000544 3300048091 Bacteria 37459
578 Ga0495626_0002984 3300048091 Bacteria 11213
579 Ga0495626_0016693 3300048091 Bacteria 3724
580 Ga0495626_0089741 3300048091 Bacteria 1353
581 Ga0495626_0266833 3300048091 Bacteria 683
582 Ga0495626_0354977 3300048091 Bacteria 571
583 Ga0496102_0001578 3300048905 Bacteria 20111
584 Ga0496103_0057821 3300048906 Bacteria 2408
585 Ga0496104_0330838 3300048907 Bacteria 1437
586 Ga0496105_0140359 3300048908 Bacteria 1989
587 Ga0496105_0436029 3300048908 Bacteria 1036
588 Ga0496107_0229967 3300048910 Bacteria 1380
589 Ga0496110_0076497 3300048913 Bacteria 2976
590 Ga0496110_0270701 3300048913 Bacteria 1546
591 Ga0496110_0291912 3300048913 Bacteria 1485
592 Ga0496111_0497671 3300048914 Bacteria 897
593 Ga0496114_0820588 3300048917 Bacteria 809
594 Ga0496115_0684902 3300048918 Bacteria 807
595 Ga0496116_0000454 3300048919 Bacteria 56678
596 Ga0496116_0002424 3300048919 Bacteria 19655
597 Ga0496116_0060542 3300048919 Bacteria 2455
598 Ga0496116_0379438 3300048919 Bacteria 634
599 Ga0496117_0004231 3300048920 Bacteria 16023
600 Ga0496117_0143858 3300048920 Bacteria 1423
601 Ga0496117_0353854 3300048920 Bacteria 757
602 Ga0496118_0005165 3300048921 Bacteria 14954
603 Ga0496118_0046491 3300048921 Bacteria 3376
604 Ga0496118_0055760 3300048921 Bacteria 2978
605 Ga0496118_0162057 3300048921 Bacteria 1381
606 Ga0496118_0252740 3300048921 Bacteria 1000
607 Ga0496119_0084721 3300048922 Bacteria 1817
608 Ga0496119_0515759 3300048922 Bacteria 554
609 Ga0496120_0014296 3300048923 Bacteria 5298
610 Ga0496121_0002269 3300048924 Bacteria 29925
611 Ga0496121_0005464 3300048924 Bacteria 16279
612 Ga0496121_0016694 3300048924 Bacteria 7555
613 Ga0496121_0220565 3300048924 Bacteria 1336
614 Ga0496122_0016424 3300048925 Bacteria 7004
615 Ga0496122_0032966 3300048925 Bacteria 4269
616 Ga0496122_0097765 3300048925 Bacteria 1974
617 Ga0496122_0455142 3300048925 Bacteria 634
618 Ga0496123_0034681 3300048926 Bacteria 3609
619 Ga0496123_0054853 3300048926 Bacteria 2619
620 Ga0496123_0085777 3300048926 Bacteria 1892
621 Ga0496124_0000013 3300048927 Bacteria 484884
622 Ga0496124_0005370 3300048927 Bacteria 14471
623 Ga0496124_0014938 3300048927 Bacteria 7476
624 Ga0496124_0019587 3300048927 Bacteria 6289
625 Ga0496124_0033423 3300048927 Bacteria 4524
626 Ga0496124_0101136 3300048927 Bacteria 2336
627 Ga0496124_0194096 3300048927 Bacteria 1550
628 Ga0496124_0211705 3300048927 Bacteria 1466
629 Ga0496124_0292552 3300048927 Bacteria 1181
630 Ga0496125_0000146 3300048928 Bacteria 154919
631 Ga0496125_0172921 3300048928 Bacteria 1449
632 Ga0496125_0284763 3300048928 Bacteria 1021
633 Ga0496125_0433880 3300048928 Bacteria 757
634 Ga0496126_0033868 3300048929 Bacteria 4805
635 Ga0496126_0052316 3300048929 Bacteria 3712
636 Ga0496126_0381324 3300048929 Bacteria 1147
637 Ga0496126_0510387 3300048929 Bacteria 959
638 Ga0495678_000005 3300049459 Bacteria 522958
639 Ga0495678_000255 3300049459 Bacteria 59619
640 Ga0495678_001291 3300049459 Bacteria 20231
641 Ga0495678_011905 3300049459 Bacteria 4145
642 Ga0495678_019133 3300049459 Bacteria 3063
643 Ga0495678_034424 3300049459 Bacteria 2084
644 Ga0495678_039480 3300049459 Bacteria 1903
645 Ga0495678_072225 3300049459 Bacteria 1261
646 Ga0495678_089199 3300049459 Bacteria 1089
647 Ga0495682_0039894 3300049460 Bacteria 1722
648 Ga0495682_0040362 3300049460 Bacteria 1711
649 Ga0495682_0072793 3300049460 Bacteria 1236
650 Ga0495682_0208568 3300049460 Bacteria 692
651 Ga0501032_0006468 3300049569 Bacteria 8615
652 Ga0501034_0275747 3300049571 Bacteria 1622
653 Ga0501034_0640066 3300049571 Bacteria 966
654 Ga0501037_0222041 3300049573 Bacteria 1329
655 Ga0501039_0495111 3300049575 Bacteria 960
656 Ga0501226_000006 3300049853 Bacteria 259153
657 nmdc:mga03683_10369_c1 3300050489 Bacteria 3340
658 nmdc:mga00v17_137745_c1 3300050491 Bacteria 1563
659 nmdc:mga00v17_251442_c1 3300050491 Bacteria 1146
660 nmdc:mga00v17_412133_c1 3300050491 Bacteria 878
661 nmdc:mga00v17_554882_c1 3300050491 Bacteria 743
662 nmdc:mga00v17_99955_c1 3300050491 Bacteria 1830
663 nmdc:mga08x19_329867_c1 3300050514 Bacteria 1063
664 nmdc:mga0sz30_113208_c1 3300050516 Bacteria 1190
665 Ga0500618_157093 3300053125 Bacteria 520
666 Ga0500634_0069949 3300053161 Bacteria 1839

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042016 Ga0439463_160675 Ga0439463_160675_254_571 105
2 3300046455 Ga0495603_0528422 Ga0495603_0528422_15_332 105
3 3300046557 Ga0495622_0301368 Ga0495622_0301368_371_688 105
4 3300047322 Ga0495680_0126535 Ga0495680_0126535_22_339 105
5 3300048927 Ga0496124_0005370 Ga0496124_0005370_10_327 105
6 3300048919 Ga0496116_0002424 Ga0496116_0002424_16315_16728 112
7 iso_pu_bacteria 2599185292 2599905057 112
8 iso_pu_bacteria 2643221569 2643860297 112
9 iso_pu_bacteria 2643221594 2643979481 112
10 iso_pu_bacteria 2643221621 2644119971 112
11 iso_pu_bacteria 2808606395 2809035752 112
12 iso_pu_bacteria 2857537821 2857538984 112
13 iso_pu_bacteria 2858950400 2858950848 112
14 3300046512 Ga0495610_0071758 Ga0495610_0071758_425_766 113
15 3300046512 Ga0495610_0120817 Ga0495610_0120817_424_765 113
16 3300046518 Ga0495631_0066629 Ga0495631_0066629_255_596 113
17 3300046530 Ga0495654_0175446 Ga0495654_0175446_355_696 113
18 3300047446 Ga0495679_000830 Ga0495679_000830_18885_19226 113
19 iso_pu_bacteria 2808606373 2808907354 113
20 iso_pu_bacteria 2857542790 2857543268 113
21 iso_pu_bacteria 2941479691 2941485483 113
22 3300009011 Ga0105251_10051294 Ga0105251_100512942 114
23 3300025735 Ga0207713_1083462 Ga0207713_10834621 114
24 3300046453 Ga0495627_031380 Ga0495627_031380_117_461 114
25 3300046453 Ga0495627_195694 Ga0495627_195694_97_441 114
26 3300046458 Ga0495591_001809 Ga0495591_001809_11894_12238 114
27 3300046458 Ga0495591_154922 Ga0495591_154922_94_438 114
28 3300046471 Ga0495650_0009498 Ga0495650_0009498_1177_1521 114
29 3300046474 Ga0495605_0000013 Ga0495605_0000013_281920_282264 114
30 3300046499 Ga0495594_0003335 Ga0495594_0003335_888_1232 114
31 3300046506 Ga0495583_0000042 Ga0495583_0000042_209464_209808 114
32 3300046512 Ga0495610_0019399 Ga0495610_0019399_1274_1618 114
33 3300046515 Ga0495620_0000072 Ga0495620_0000072_25358_25702 114
34 3300046518 Ga0495631_0060011 Ga0495631_0060011_924_1268 114
35 3300046520 Ga0495637_0364208 Ga0495637_0364208_129_473 114
36 3300046524 Ga0495648_0007494 Ga0495648_0007494_1551_1895 114
37 3300046530 Ga0495654_0002718 Ga0495654_0002718_10773_11117 114
38 3300046538 Ga0495609_0000139 Ga0495609_0000139_67797_68141 114
39 3300046542 Ga0495597_0002429 Ga0495597_0002429_11399_11743 114
40 3300046558 Ga0495633_0000194 Ga0495633_0000194_25496_25840 114
41 3300046648 Ga0495611_0002248 Ga0495611_0002248_2086_2430 114
42 3300046665 Ga0495661_0000056 Ga0495661_0000056_14684_15028 114
43 3300046692 Ga0495671_0013552 Ga0495671_0013552_14_358 114
44 3300046810 Ga0495660_0054626 Ga0495660_0054626_1457_1801 114
45 3300047323 Ga0495683_0000002 Ga0495683_0000002_25498_25842 114
46 3300047446 Ga0495679_000120 Ga0495679_000120_16292_16636 114
47 3300047469 Ga0495673_0008384 Ga0495673_0008384_1097_1441 114
48 3300047470 Ga0495681_0241110 Ga0495681_0241110_96_440 114
49 3300048089 Ga0495614_0465562 Ga0495614_0465562_38_382 114
50 3300048925 Ga0496122_0097765 Ga0496122_0097765_417_761 114
51 3300048926 Ga0496123_0054853 Ga0496123_0054853_45_389 114
52 3300049459 Ga0495678_000005 Ga0495678_000005_497790_498134 114
53 3300053125 Ga0500618_157093 Ga0500618_157093_112_456 114
54 iso_pu_bacteria 2510065053 2510283366 114
55 iso_pu_bacteria 2510065055 2510292806 114
56 iso_pu_bacteria 2510065058 2510313276 114
57 iso_pu_bacteria 2773857672 2774128864 114
58 iso_pu_bacteria 2917832318 2917833003 114
59 iso_pu_bacteria 2919125081 2919126602 114
60 iso_pu_bacteria 2974298342 2974299013 114
61 iso_pu_bacteria 2984499530 2984501325 114
62 iso_pu_bacteria 2984504281 2984505201 114
63 iso_pu_bacteria 8016728285 8016732925 114
64 3300031911 Ga0307412_10008940 Ga0307412_100089404 115
65 3300003781 Ga0055536_1062540 Ga0055536_10625401 116
66 3300006051 Ga0075364_10032605 Ga0075364_100326052 116
67 3300006051 Ga0075364_10529504 Ga0075364_105295042 116
68 3300025292 Ga0209676_1015230 Ga0209676_10152302 116
69 3300025298 Ga0209050_1024606 Ga0209050_10246062 116
70 3300025303 Ga0209051_1016324 Ga0209051_10163242 116
71 3300027312 Ga0209371_1047411 Ga0209371_10474112 116
72 3300030500 Ga0268256_1053454 Ga0268256_10534542 116
73 3300031824 Ga0307413_10925653 Ga0307413_109256532 116
74 3300032004 Ga0307414_10060065 Ga0307414_100600653 116
75 3300032004 Ga0307414_10433090 Ga0307414_104330902 116
76 3300032004 Ga0307414_10880053 Ga0307414_108800532 116
77 3300041997 Ga0439431_0027622 Ga0439431_0027622_980_1330 116
78 3300042000 Ga0439437_000576 Ga0439437_000576_511_861 116
79 3300042115 Ga0450911_000043 Ga0450911_000043_45578_45928 116
80 3300042121 Ga0450919_013179 Ga0450919_013179_350_700 116
81 3300042136 Ga0450900_028972 Ga0450900_028972_246_596 116
82 3300042139 Ga0450904_005500 Ga0450904_005500_628_978 116
83 3300042156 Ga0439446_0349778 Ga0439446_0349778_144_494 116
84 3300042435 Ga0439434_0312792 Ga0439434_0312792_55_405 116
85 3300042438 Ga0439459_0003870 Ga0439459_0003870_1185_1535 116
86 3300042533 Ga0450901_023089 Ga0450901_023089_286_636 116
87 3300048919 Ga0496116_0060542 Ga0496116_0060542_22_375 116
88 3300048921 Ga0496118_0055760 Ga0496118_0055760_1670_2023 116
89 3300048922 Ga0496119_0084721 Ga0496119_0084721_1189_1542 116
90 3300048923 Ga0496120_0014296 Ga0496120_0014296_971_1324 116
91 3300048924 Ga0496121_0016694 Ga0496121_0016694_5528_5881 116
92 3300048925 Ga0496122_0032966 Ga0496122_0032966_3623_3976 116
93 3300048926 Ga0496123_0034681 Ga0496123_0034681_1347_1700 116
94 3300048927 Ga0496124_0000013 Ga0496124_0000013_345061_345414 116
95 3300048927 Ga0496124_0194096 Ga0496124_0194096_671_1024 116
96 3300048927 Ga0496124_0211705 Ga0496124_0211705_308_658 116
97 3300048928 Ga0496125_0000146 Ga0496125_0000146_71653_72006 116
98 3300048929 Ga0496126_0033868 Ga0496126_0033868_4236_4589 116
99 3300050491 nmdc:mga00v17_137745_c1 nmdc:mga00v17_137745_c1_857_1210 116
100 iso_pu_bacteria 2599185288 2599880334 116
101 iso_pu_bacteria 2599185303 2599946973 116
102 iso_pu_bacteria 2619619299 2621300061 116
103 iso_pu_bacteria 2738541265 2738670063 116
104 iso_pu_bacteria 2738541282 2738748456 116
105 iso_pu_bacteria 2738541294 2738806558 116
106 iso_pu_bacteria 2738541303 2738857498 116
107 iso_pu_bacteria 2738541309 2738893918 116
108 iso_pu_bacteria 2808606385 2808978867 116
109 iso_pu_bacteria 2808606388 2808994599 116
110 iso_pu_bacteria 2816332298 2817491401 116
111 iso_pu_bacteria 2834028612 2834033572 116
112 iso_pu_bacteria 2852612431 2852614253 116
113 iso_pu_bacteria 2852667396 2852668009 116
114 iso_pu_bacteria 3007803356 3007806452 116
115 iso_pu_bacteria 8054285046 8054288340 116
116 iso_pu_bacteria 8054503363 8054506554 116
117 iso_pu_bacteria 2912963787 2912967714 117
118 iso_pu_bacteria 2939651529 2939655830 117
119 3300009011 Ga0105251_10009881 Ga0105251_100098816 118
120 3300009036 Ga0105244_10021228 Ga0105244_100212282 118
121 3300011119 Ga0105246_12159075 Ga0105246_121590751 118
122 3300013100 Ga0157373_10291923 Ga0157373_102919231 118
123 3300013102 Ga0157371_10001627 Ga0157371_1000162722 118
124 3300013102 Ga0157371_10868483 Ga0157371_108684831 118
125 3300013104 Ga0157370_11121626 Ga0157370_111216262 118
126 3300013307 Ga0157372_10294322 Ga0157372_102943222 118
127 3300013307 Ga0157372_11023992 Ga0157372_110239921 118
128 3300025735 Ga0207713_1027333 Ga0207713_10273333 118
129 3300027312 Ga0209371_1025273 Ga0209371_10252731 118
130 3300030500 Ga0268256_1030478 Ga0268256_10304781 118
131 3300049569 Ga0501032_0006468 Ga0501032_0006468_179_547 118
132 3300049571 Ga0501034_0275747 Ga0501034_0275747_83_451 118
133 3300049573 Ga0501037_0222041 Ga0501037_0222041_276_644 118
134 3300049575 Ga0501039_0495111 Ga0501039_0495111_247_615 118
135 iso_pu_bacteria 2687453129 2687579651 118
136 3300042530 Ga0450916_005221 Ga0450916_005221_333_692 119
137 3300042532 Ga0450893_0083011 Ga0450893_0083011_256_615 119
138 3300046665 Ga0495661_0001990 Ga0495661_0001990_15039_15398 119
139 3300046810 Ga0495660_0004284 Ga0495660_0004284_8265_8624 119
140 3300049853 Ga0501226_000006 Ga0501226_000006_211920_212279 119
141 3300053161 Ga0500634_0069949 Ga0500634_0069949_780_1139 119
142 3300005288 Ga0065714_10064677 Ga0065714_100646774 120
143 3300005289 Ga0065704_10121824 Ga0065704_101218241 120
144 3300005290 Ga0065712_10106776 Ga0065712_101067761 120
145 3300005331 Ga0070670_100000278 Ga0070670_10000027826 120
146 3300005548 Ga0070665_100371598 Ga0070665_1003715982 120
147 3300009011 Ga0105251_10001187 Ga0105251_1000118722 120
148 3300009092 Ga0105250_10000088 Ga0105250_1000008819 120
149 3300013100 Ga0157373_10001981 Ga0157373_100019814 120
150 3300013100 Ga0157373_10002994 Ga0157373_100029944 120
151 3300014497 Ga0182008_10060648 Ga0182008_100606482 120
152 3300014497 Ga0182008_10193068 Ga0182008_101930682 120
153 3300015261 Ga0182006_1079455 Ga0182006_10794552 120
154 3300015262 Ga0182007_10001269 Ga0182007_100012693 120
155 3300017792 Ga0163161_10013117 Ga0163161_100131172 120
156 3300025711 Ga0207696_1000091 Ga0207696_1000091139 120
157 3300025735 Ga0207713_1000432 Ga0207713_100043214 120
158 3300025925 Ga0207650_10001831 Ga0207650_1000183113 120
159 3300031731 Ga0307405_10000054 Ga0307405_1000005424 120
160 3300031911 Ga0307412_10307160 Ga0307412_103071603 120
161 3300041407 Ga0439447_051296 Ga0439447_051296_147_515 120
162 3300042006 Ga0439432_068510 Ga0439432_068510_331_699 120
163 3300042134 Ga0450898_099939 Ga0450898_099939_43_405 120
164 3300046458 Ga0495591_013862 Ga0495591_013862_14_376 120
165 3300046694 Ga0495649_0002684 Ga0495649_0002684_11727_12089 120
166 3300048920 Ga0496117_0004231 Ga0496117_0004231_67_429 120
167 3300048921 Ga0496118_0005165 Ga0496118_0005165_96_458 120
168 3300048921 Ga0496118_0252740 Ga0496118_0252740_580_942 120
169 3300048924 Ga0496121_0005464 Ga0496121_0005464_88_450 120
170 3300048927 Ga0496124_0019587 Ga0496124_0019587_88_450 120
171 3300048927 Ga0496124_0033423 Ga0496124_0033423_3888_4253 120
172 3300048928 Ga0496125_0433880 Ga0496125_0433880_250_612 120
173 3300048929 Ga0496126_0052316 Ga0496126_0052316_894_1256 120
174 3300048929 Ga0496126_0381324 Ga0496126_0381324_698_1060 120
175 3300049571 Ga0501034_0640066 Ga0501034_0640066_331_693 120
176 iso_pu_bacteria 2511231021 2511357465 120
177 iso_pu_bacteria 3007395558 3007396188 120
178 iso_pu_bacteria 8015687852 8015691008 120
179 3300009011 Ga0105251_10064025 Ga0105251_100640252 121
180 3300025735 Ga0207713_1063250 Ga0207713_10632501 121
181 3300042013 Ga0439456_000086 Ga0439456_000086_11153_11518 121
182 iso_pu_bacteria 2511231004 2511255530 121
183 iso_pu_bacteria 2511231007 2511270461 121
184 iso_pu_bacteria 2511231015 2511323350 121
185 iso_pu_bacteria 2511231016 2511328537 121
186 iso_pu_bacteria 2511231019 2511342439 121
187 iso_pu_bacteria 2511231020 2511350800 121
188 iso_pu_bacteria 2511231022 2511362770 121
189 iso_pu_bacteria 2623620446 2624492078 121
190 iso_pu_bacteria 2643221589 2643954603 121
191 iso_pu_bacteria 2643221602 2644022876 121
192 iso_pu_bacteria 2643221633 2644188519 121
193 iso_pu_bacteria 2738543004 2739197467 121
194 iso_pu_bacteria 2738543015 2739257011 121
195 iso_pu_bacteria 2738543015 2739258073 121
196 iso_pu_bacteria 2773857670 2774123696 121
197 iso_pu_bacteria 2784132072 2784312274 121
198 iso_pu_bacteria 2808606377 2808929016 121
199 iso_pu_bacteria 2808606381 2808951137 121
200 iso_pu_bacteria 2808606445 2809215234 121
201 iso_pu_bacteria 2860339153 2860342708 121
202 iso_pu_bacteria 2919697872 2919698250 121
203 iso_pu_bacteria 2931396565 2931401761 121
204 iso_pu_bacteria 2939636861 2939639869 121
205 iso_pu_bacteria 8019775933 8019779863 121
206 iso_pu_bacteria 8056155041 8056158915 121
207 iso_pu_bacteria 8056177738 8056178702 121
208 3300006051 Ga0075364_10109152 Ga0075364_101091522 122
209 3300013104 Ga0157370_10058014 Ga0157370_100580144 122
210 3300015265 Ga0182005_1001441 Ga0182005_10014417 122
211 3300025256 Ga0209759_1008003 Ga0209759_10080032 122
212 3300046453 Ga0495627_000736 Ga0495627_000736_17555_17935 122
213 3300046518 Ga0495631_0004935 Ga0495631_0004935_255_635 122
214 3300046519 Ga0495632_0009057 Ga0495632_0009057_1192_1572 122
215 3300046519 Ga0495632_0014259 Ga0495632_0014259_2931_3311 122
216 3300046530 Ga0495654_0001014 Ga0495654_0001014_6452_6832 122
217 3300046530 Ga0495654_0269200 Ga0495654_0269200_236_616 122
218 3300046692 Ga0495671_0003445 Ga0495671_0003445_5956_6336 122
219 3300047320 Ga0495672_0008343 Ga0495672_0008343_703_1083 122
220 3300047470 Ga0495681_0007056 Ga0495681_0007056_176_553 122
221 3300048919 Ga0496116_0379438 Ga0496116_0379438_121_498 122
222 3300050491 nmdc:mga00v17_251442_c1 nmdc:mga00v17_251442_c1_410_790 122
223 iso_pu_bacteria 2511231006 2511265361 122
224 iso_pu_bacteria 2512047018 2512326173 122
225 iso_pu_bacteria 2582580891 2583792602 122
226 iso_pu_bacteria 2597489887 2597858245 122
227 iso_pu_bacteria 2599185185 2599486225 122
228 iso_pu_bacteria 2599185257 2599802850 122
229 iso_pu_bacteria 2600254931 2600362881 122
230 iso_pu_bacteria 2671180172 2671769528 122
231 iso_pu_bacteria 2740892503 2743737738 122
232 iso_pu_bacteria 2923153595 2923156783 122
233 iso_pu_bacteria 2984286254 2984289308 122
234 iso_pu_bacteria 8055770955 8055774149 122
235 3300005290 Ga0065712_10763496 Ga0065712_107634961 124
236 3300006058 Ga0075432_10065681 Ga0075432_100656812 124
237 3300006058 Ga0075432_10197982 Ga0075432_101979822 124
238 3300009011 Ga0105251_10002196 Ga0105251_100021963 124
239 3300017792 Ga0163161_10008080 Ga0163161_100080802 124
240 3300027907 Ga0207428_10013492 Ga0207428_100134928 124
241 3300041405 Ga0439438_042108 Ga0439438_042108_672_1046 124
242 3300041405 Ga0439438_044515 Ga0439438_044515_501_875 124
243 3300041411 Ga0439466_0003576 Ga0439466_0003576_503_877 124
244 3300042013 Ga0439456_164921 Ga0439456_164921_128_502 124
245 3300042138 Ga0450903_058382 Ga0450903_058382_120_494 124
246 3300046452 Ga0495617_008946 Ga0495617_008946_1368_1742 124
247 3300046452 Ga0495617_020213 Ga0495617_020213_1208_1582 124
248 3300046452 Ga0495617_021372 Ga0495617_021372_480_854 124
249 3300046453 Ga0495627_008855 Ga0495627_008855_621_995 124
250 3300046453 Ga0495627_018373 Ga0495627_018373_1878_2252 124
251 3300046457 Ga0495590_0006286 Ga0495590_0006286_3239_3613 124
252 3300046458 Ga0495591_000021 Ga0495591_000021_103538_103912 124
253 3300046458 Ga0495591_046742 Ga0495591_046742_323_697 124
254 3300046460 Ga0495638_0008684 Ga0495638_0008684_439_813 124
255 3300046460 Ga0495638_0012961 Ga0495638_0012961_4289_4663 124
256 3300046460 Ga0495638_0013111 Ga0495638_0013111_1841_2215 124
257 3300046460 Ga0495638_0024127 Ga0495638_0024127_196_570 124
258 3300046460 Ga0495638_0113247 Ga0495638_0113247_660_1034 124
259 3300046463 Ga0495653_0025832 Ga0495653_0025832_914_1291 124
260 3300046471 Ga0495650_0003857 Ga0495650_0003857_4138_4512 124
261 3300046471 Ga0495650_0005962 Ga0495650_0005962_5858_6232 124
262 3300046471 Ga0495650_0012925 Ga0495650_0012925_3736_4110 124
263 3300046474 Ga0495605_0008937 Ga0495605_0008937_2455_2829 124
264 3300046474 Ga0495605_0031436 Ga0495605_0031436_110_484 124
265 3300046491 Ga0495584_0005360 Ga0495584_0005360_1938_2312 124
266 3300046491 Ga0495584_0063424 Ga0495584_0063424_1378_1752 124
267 3300046491 Ga0495584_0601674 Ga0495584_0601674_103_477 124
268 3300046492 Ga0495585_0038627 Ga0495585_0038627_1771_2145 124
269 3300046492 Ga0495585_0043720 Ga0495585_0043720_128_502 124
270 3300046492 Ga0495585_0102914 Ga0495585_0102914_196_570 124
271 3300046492 Ga0495585_0389744 Ga0495585_0389744_277_651 124
272 3300046500 Ga0495596_0000012 Ga0495596_0000012_107357_107731 124
273 3300046501 Ga0495607_0011700 Ga0495607_0011700_104_478 124
274 3300046501 Ga0495607_0019576 Ga0495607_0019576_3040_3414 124
275 3300046507 Ga0495606_0004827 Ga0495606_0004827_4402_4776 124
276 3300046507 Ga0495606_0067429 Ga0495606_0067429_752_1126 124
277 3300046512 Ga0495610_0008070 Ga0495610_0008070_2090_2464 124
278 3300046512 Ga0495610_0058655 Ga0495610_0058655_580_954 124
279 3300046513 Ga0495616_0036981 Ga0495616_0036981_1997_2371 124
280 3300046513 Ga0495616_0061841 Ga0495616_0061841_568_942 124
281 3300046513 Ga0495616_0092400 Ga0495616_0092400_675_1049 124
282 3300046515 Ga0495620_0002118 Ga0495620_0002118_10511_10885 124
283 3300046515 Ga0495620_0100079 Ga0495620_0100079_101_475 124
284 3300046518 Ga0495631_0011468 Ga0495631_0011468_855_1229 124
285 3300046518 Ga0495631_0187587 Ga0495631_0187587_336_710 124
286 3300046519 Ga0495632_0004655 Ga0495632_0004655_4138_4512 124
287 3300046519 Ga0495632_0005740 Ga0495632_0005740_5850_6224 124
288 3300046519 Ga0495632_0059949 Ga0495632_0059949_128_502 124
289 3300046519 Ga0495632_0129975 Ga0495632_0129975_318_692 124
290 3300046520 Ga0495637_0000246 Ga0495637_0000246_41097_41471 124
291 3300046520 Ga0495637_0001150 Ga0495637_0001150_6748_7122 124
292 3300046520 Ga0495637_0013469 Ga0495637_0013469_909_1283 124
293 3300046522 Ga0495643_0103230 Ga0495643_0103230_917_1291 124
294 3300046522 Ga0495643_0179055 Ga0495643_0179055_411_785 124
295 3300046523 Ga0495644_0003033 Ga0495644_0003033_275_649 124
296 3300046523 Ga0495644_0003236 Ga0495644_0003236_5513_5887 124
297 3300046523 Ga0495644_0045277 Ga0495644_0045277_589_963 124
298 3300046524 Ga0495648_0088033 Ga0495648_0088033_681_1055 124
299 3300046524 Ga0495648_0128660 Ga0495648_0128660_340_714 124
300 3300046524 Ga0495648_0150692 Ga0495648_0150692_780_1154 124
301 3300046526 Ga0495666_0015946 Ga0495666_0015946_2932_3309 124
302 3300046530 Ga0495654_0104485 Ga0495654_0104485_48_422 124
303 3300046530 Ga0495654_0188060 Ga0495654_0188060_148_522 124
304 3300046530 Ga0495654_0220789 Ga0495654_0220789_327_701 124
305 3300046542 Ga0495597_0018509 Ga0495597_0018509_134_508 124
306 3300046542 Ga0495597_0038510 Ga0495597_0038510_1119_1493 124
307 3300046542 Ga0495597_0055421 Ga0495597_0055421_231_605 124
308 3300046542 Ga0495597_0080563 Ga0495597_0080563_236_610 124
309 3300046542 Ga0495597_0136393 Ga0495597_0136393_256_630 124
310 3300046558 Ga0495633_0054011 Ga0495633_0054011_337_711 124
311 3300046615 Ga0495656_0023727 Ga0495656_0023727_1829_2203 124
312 3300046616 Ga0495668_0008218 Ga0495668_0008218_5501_5875 124
313 3300046648 Ga0495611_0018225 Ga0495611_0018225_219_593 124
314 3300046660 Ga0495625_0005762 Ga0495625_0005762_10163_10537 124
315 3300046660 Ga0495625_0012208 Ga0495625_0012208_708_1082 124
316 3300046660 Ga0495625_0095756 Ga0495625_0095756_1019_1393 124
317 3300046665 Ga0495661_0010111 Ga0495661_0010111_4509_4883 124
318 3300046665 Ga0495661_0016118 Ga0495661_0016118_325_699 124
319 3300046675 Ga0495657_0044821 Ga0495657_0044821_2266_2643 124
320 3300046679 Ga0495623_0029124 Ga0495623_0029124_120_497 124
321 3300046691 Ga0495670_0092573 Ga0495670_0092573_921_1295 124
322 3300046692 Ga0495671_0018288 Ga0495671_0018288_2745_3119 124
323 3300046692 Ga0495671_0024428 Ga0495671_0024428_2714_3088 124
324 3300046692 Ga0495671_0133849 Ga0495671_0133849_256_630 124
325 3300046692 Ga0495671_0135276 Ga0495671_0135276_680_1054 124
326 3300046694 Ga0495649_0040480 Ga0495649_0040480_1422_1796 124
327 3300046794 Ga0495589_0004579 Ga0495589_0004579_6346_6720 124
328 3300046794 Ga0495589_0039791 Ga0495589_0039791_1327_1701 124
329 3300046809 Ga0495600_0027040 Ga0495600_0027040_2845_3222 124
330 3300046809 Ga0495600_0136526 Ga0495600_0136526_1070_1444 124
331 3300046810 Ga0495660_0027277 Ga0495660_0027277_1342_1716 124
332 3300046810 Ga0495660_0038794 Ga0495660_0038794_157_531 124
333 3300046810 Ga0495660_0047225 Ga0495660_0047225_1664_2038 124
334 3300046810 Ga0495660_0051636 Ga0495660_0051636_660_1034 124
335 3300047317 Ga0495604_0041164 Ga0495604_0041164_363_740 124
336 3300047320 Ga0495672_0000185 Ga0495672_0000185_5402_5776 124
337 3300047320 Ga0495672_0004874 Ga0495672_0004874_423_797 124
338 3300047320 Ga0495672_0011134 Ga0495672_0011134_1025_1399 124
339 3300047320 Ga0495672_0119888 Ga0495672_0119888_675_1052 124
340 3300047322 Ga0495680_0058791 Ga0495680_0058791_2509_2883 124
341 3300047322 Ga0495680_0362199 Ga0495680_0362199_71_448 124
342 3300047323 Ga0495683_0020071 Ga0495683_0020071_2975_3349 124
343 3300047323 Ga0495683_0044541 Ga0495683_0044541_123_497 124
344 3300047323 Ga0495683_0079842 Ga0495683_0079842_1197_1571 124
345 3300047323 Ga0495683_0109986 Ga0495683_0109986_459_833 124
346 3300047444 Ga0495675_0173648 Ga0495675_0173648_814_1191 124
347 3300047446 Ga0495679_028207 Ga0495679_028207_56_430 124
348 3300047469 Ga0495673_0004634 Ga0495673_0004634_3292_3666 124
349 3300047469 Ga0495673_0007542 Ga0495673_0007542_263_637 124
350 3300047469 Ga0495673_0010277 Ga0495673_0010277_4470_4844 124
351 3300047469 Ga0495673_0014768 Ga0495673_0014768_3001_3375 124
352 3300047469 Ga0495673_0018542 Ga0495673_0018542_579_953 124
353 3300047470 Ga0495681_0005002 Ga0495681_0005002_7542_7916 124
354 3300047470 Ga0495681_0007175 Ga0495681_0007175_6186_6560 124
355 3300047470 Ga0495681_0010838 Ga0495681_0010838_396_770 124
356 3300047470 Ga0495681_0102595 Ga0495681_0102595_50_424 124
357 3300047470 Ga0495681_0403390 Ga0495681_0403390_50_424 124
358 3300047471 Ga0495684_0134274 Ga0495684_0134274_857_1234 124
359 3300047472 Ga0495686_0071059 Ga0495686_0071059_570_944 124
360 3300047673 Ga0495593_0022018 Ga0495593_0022018_2966_3343 124
361 3300048091 Ga0495626_0000112 Ga0495626_0000112_81547_81921 124
362 3300048091 Ga0495626_0000525 Ga0495626_0000525_6694_7068 124
363 3300048091 Ga0495626_0266833 Ga0495626_0266833_143_517 124
364 3300048913 Ga0496110_0076497 Ga0496110_0076497_2416_2790 124
365 3300048913 Ga0496110_0291912 Ga0496110_0291912_1100_1474 124
366 3300048927 Ga0496124_0014938 Ga0496124_0014938_6926_7300 124
367 3300049459 Ga0495678_019133 Ga0495678_019133_168_542 124
368 3300049459 Ga0495678_034424 Ga0495678_034424_1510_1884 124
369 2124908027 MRS2a_Contig_1657 MRS2a_00518400 125
370 2162886007 SwRhRL2b_contig_851711 SwRhRL2b_0044.00007500 125
371 3300003781 Ga0055536_1000005 Ga0055536_1000005236 125
372 3300003791 Ga0055530_10000001 Ga0055530_1000000195 125
373 3300003792 Ga0055540_1001172 Ga0055540_100117218 125
374 3300005288 Ga0065714_10000620 Ga0065714_100006203 125
375 3300005288 Ga0065714_10015310 Ga0065714_100153102 125
376 3300005289 Ga0065704_10014791 Ga0065704_100147912 125
377 3300005289 Ga0065704_10021946 Ga0065704_100219462 125
378 3300005289 Ga0065704_10126369 Ga0065704_101263692 125
379 3300005290 Ga0065712_10008802 Ga0065712_100088022 125
380 3300005293 Ga0065715_10030401 Ga0065715_100304012 125
381 3300006048 Ga0075363_100444973 Ga0075363_1004449731 125
382 3300006051 Ga0075364_10527136 Ga0075364_105271361 125
383 3300006058 Ga0075432_10001221 Ga0075432_100012212 125
384 3300006058 Ga0075432_10025526 Ga0075432_100255262 125
385 3300006058 Ga0075432_10157034 Ga0075432_101570342 125
386 3300006177 Ga0075362_10007673 Ga0075362_100076735 125
387 3300006177 Ga0075362_10358669 Ga0075362_103586691 125
388 3300006946 Ga0079104_1001171 Ga0079104_100117114 125
389 3300009036 Ga0105244_10002217 Ga0105244_100022177 125
390 3300009036 Ga0105244_10051985 Ga0105244_100519852 125
391 3300009036 Ga0105244_10123987 Ga0105244_101239872 125
392 3300009036 Ga0105244_10206944 Ga0105244_102069442 125
393 3300009092 Ga0105250_10181237 Ga0105250_101812372 125
394 3300009098 Ga0105245_11572225 Ga0105245_115722252 125
395 3300011119 Ga0105246_10130639 Ga0105246_101306392 125
396 3300013100 Ga0157373_10141568 Ga0157373_101415682 125
397 3300013100 Ga0157373_10283447 Ga0157373_102834472 125
398 3300013102 Ga0157371_10002182 Ga0157371_100021823 125
399 3300013102 Ga0157371_10442782 Ga0157371_104427822 125
400 3300013104 Ga0157370_10064419 Ga0157370_100644191 125
401 3300013104 Ga0157370_10494467 Ga0157370_104944672 125
402 3300013105 Ga0157369_10300835 Ga0157369_103008352 125
403 3300013306 Ga0163162_10109103 Ga0163162_101091036 125
404 3300014497 Ga0182008_10015899 Ga0182008_100158994 125
405 3300014497 Ga0182008_10022033 Ga0182008_100220334 125
406 3300015261 Ga0182006_1000073 Ga0182006_1000073102 125
407 3300015261 Ga0182006_1078275 Ga0182006_10782752 125
408 3300015261 Ga0182006_1104135 Ga0182006_11041352 125
409 3300015262 Ga0182007_10000031 Ga0182007_100000317 125
410 3300015262 Ga0182007_10123341 Ga0182007_101233412 125
411 3300015262 Ga0182007_10341485 Ga0182007_103414851 125
412 3300015265 Ga0182005_1001430 Ga0182005_10014302 125
413 3300017792 Ga0163161_10089224 Ga0163161_100892242 125
414 3300017792 Ga0163161_11651548 Ga0163161_116515481 125
415 3300025284 Ga0209130_1027444 Ga0209130_10274442 125
416 3300025292 Ga0209676_1000003 Ga0209676_1000003448 125
417 3300025298 Ga0209050_1000004 Ga0209050_1000004430 125
418 3300025303 Ga0209051_1000006 Ga0209051_1000006545 125
419 3300025711 Ga0207696_1051065 Ga0207696_10510652 125
420 3300025728 Ga0207655_1000125 Ga0207655_1000125127 125
421 3300025728 Ga0207655_1024157 Ga0207655_10241572 125
422 3300025728 Ga0207655_1063672 Ga0207655_10636722 125
423 3300025728 Ga0207655_1070544 Ga0207655_10705442 125
424 3300025728 Ga0207655_1166382 Ga0207655_11663821 125
425 3300025735 Ga0207713_1033996 Ga0207713_10339964 125
426 3300027111 Ga0209281_1000055 Ga0209281_100005595 125
427 3300027907 Ga0207428_10037770 Ga0207428_100377704 125
428 3300027907 Ga0207428_10100291 Ga0207428_101002912 125
429 3300027907 Ga0207428_10112499 Ga0207428_101124992 125
430 3300027907 Ga0207428_10138096 Ga0207428_101380962 125
431 3300027907 Ga0207428_10222404 Ga0207428_102224043 125
432 3300027907 Ga0207428_10351369 Ga0207428_103513692 125
433 3300041405 Ga0439438_001379 Ga0439438_001379_5921_6307 125
434 3300041405 Ga0439438_002332 Ga0439438_002332_6511_6888 125
435 3300041405 Ga0439438_010094 Ga0439438_010094_766_1143 125
436 3300041405 Ga0439438_016886 Ga0439438_016886_810_1196 125
437 3300041407 Ga0439447_002390 Ga0439447_002390_5714_6091 125
438 3300041407 Ga0439447_010927 Ga0439447_010927_1851_2237 125
439 3300041407 Ga0439447_014917 Ga0439447_014917_924_1310 125
440 3300041407 Ga0439447_031406 Ga0439447_031406_205_582 125
441 3300041411 Ga0439466_0000337 Ga0439466_0000337_472_861 125
442 3300041411 Ga0439466_0004912 Ga0439466_0004912_337_714 125
443 3300041411 Ga0439466_0006151 Ga0439466_0006151_427_804 125
444 3300041411 Ga0439466_0008368 Ga0439466_0008368_1101_1487 125
445 3300041411 Ga0439466_0014863 Ga0439466_0014863_1930_2316 125
446 3300041413 Ga0439465_0169942 Ga0439465_0169942_184_570 125
447 3300042006 Ga0439432_000485 Ga0439432_000485_183_569 125
448 3300042006 Ga0439432_062442 Ga0439432_062442_722_1099 125
449 3300042009 Ga0439451_054775 Ga0439451_054775_25_402 125
450 3300042010 Ga0439452_000312 Ga0439452_000312_11666_12043 125
451 3300042010 Ga0439452_002749 Ga0439452_002749_1424_1801 125
452 3300042010 Ga0439452_015093 Ga0439452_015093_166_552 125
453 3300042010 Ga0439452_137099 Ga0439452_137099_30_416 125
454 3300042013 Ga0439456_144951 Ga0439456_144951_113_502 125
455 3300042016 Ga0439463_000044 Ga0439463_000044_25510_25899 125
456 3300042016 Ga0439463_010162 Ga0439463_010162_363_740 125
457 3300042115 Ga0450911_004017 Ga0450911_004017_387_773 125
458 3300042115 Ga0450911_015820 Ga0450911_015820_76_462 125
459 3300042115 Ga0450911_031866 Ga0450911_031866_169_546 125
460 3300042121 Ga0450919_019237 Ga0450919_019237_268_654 125
461 3300042122 Ga0450920_002331 Ga0450920_002331_433_819 125
462 3300042124 Ga0450922_000263 Ga0450922_000263_4763_5149 125
463 3300042125 Ga0450923_001492 Ga0450923_001492_2385_2771 125
464 3300042127 Ga0450890_000773 Ga0450890_000773_3807_4193 125
465 3300042137 Ga0450902_001251 Ga0450902_001251_2868_3245 125
466 3300042137 Ga0450902_005795 Ga0450902_005795_556_933 125
467 3300042137 Ga0450902_054241 Ga0450902_054241_293_670 125
468 3300042137 Ga0450902_081317 Ga0450902_081317_67_444 125
469 3300042138 Ga0450903_011597 Ga0450903_011597_895_1272 125
470 3300042138 Ga0450903_024453 Ga0450903_024453_358_744 125
471 3300042138 Ga0450903_037316 Ga0450903_037316_268_645 125
472 3300042139 Ga0450904_000914 Ga0450904_000914_879_1262 125
473 3300042142 Ga0450905_004669 Ga0450905_004669_354_731 125
474 3300042142 Ga0450905_100246 Ga0450905_100246_10_387 125
475 3300042145 Ga0450906_002759 Ga0450906_002759_3046_3432 125
476 3300042145 Ga0450906_006176 Ga0450906_006176_1131_1517 125
477 3300042146 Ga0450907_000305 Ga0450907_000305_5774_6151 125
478 3300042146 Ga0450907_004317 Ga0450907_004317_798_1184 125
479 3300042146 Ga0450907_008056 Ga0450907_008056_224_610 125
480 3300042146 Ga0450907_079659 Ga0450907_079659_15_392 125
481 3300042156 Ga0439446_0055343 Ga0439446_0055343_213_590 125
482 3300042184 Ga0450908_000765 Ga0450908_000765_2049_2435 125
483 3300042184 Ga0450908_002712 Ga0450908_002712_2712_3098 125
484 3300042185 Ga0450909_001652 Ga0450909_001652_20_397 125
485 3300042435 Ga0439434_0016770 Ga0439434_0016770_717_1094 125
486 3300042461 Ga0439460_0011025 Ga0439460_0011025_491_877 125
487 3300042461 Ga0439460_0054477 Ga0439460_0054477_645_1022 125
488 3300042461 Ga0439460_0096119 Ga0439460_0096119_348_734 125
489 3300042531 Ga0450918_008214 Ga0450918_008214_382_768 125
490 3300042533 Ga0450901_000625 Ga0450901_000625_3449_3826 125
491 3300042993 Ga0439440_0001132 Ga0439440_0001132_486_863 125
492 3300042993 Ga0439440_0058125 Ga0439440_0058125_104_490 125
493 3300046452 Ga0495617_000074 Ga0495617_000074_26159_26545 125
494 3300046452 Ga0495617_000853 Ga0495617_000853_758_1135 125
495 3300046452 Ga0495617_006831 Ga0495617_006831_876_1253 125
496 3300046452 Ga0495617_224828 Ga0495617_224828_178_564 125
497 3300046452 Ga0495617_225029 Ga0495617_225029_70_447 125
498 3300046453 Ga0495627_021266 Ga0495627_021266_1337_1714 125
499 3300046453 Ga0495627_084677 Ga0495627_084677_327_707 125
500 3300046455 Ga0495603_0011361 Ga0495603_0011361_2657_3034 125
501 3300046455 Ga0495603_0059747 Ga0495603_0059747_1728_2108 125
502 3300046455 Ga0495603_0070372 Ga0495603_0070372_1585_1971 125
503 3300046455 Ga0495603_0075143 Ga0495603_0075143_1476_1862 125
504 3300046457 Ga0495590_0000260 Ga0495590_0000260_564_950 125
505 3300046457 Ga0495590_0002081 Ga0495590_0002081_6950_7336 125
506 3300046457 Ga0495590_0060216 Ga0495590_0060216_298_675 125
507 3300046458 Ga0495591_001668 Ga0495591_001668_12593_12979 125
508 3300046458 Ga0495591_005739 Ga0495591_005739_568_945 125
509 3300046458 Ga0495591_039014 Ga0495591_039014_920_1306 125
510 3300046459 Ga0495629_0885749 Ga0495629_0885749_84_461 125
511 3300046460 Ga0495638_0013040 Ga0495638_0013040_4801_5178 125
512 3300046460 Ga0495638_0024582 Ga0495638_0024582_947_1324 125
513 3300046460 Ga0495638_0030329 Ga0495638_0030329_22_399 125
514 3300046460 Ga0495638_0246437 Ga0495638_0246437_563_949 125
515 3300046463 Ga0495653_0071421 Ga0495653_0071421_1704_2081 125
516 3300046471 Ga0495650_0000522 Ga0495650_0000522_36989_37375 125
517 3300046471 Ga0495650_0060103 Ga0495650_0060103_791_1168 125
518 3300046471 Ga0495650_0120673 Ga0495650_0120673_396_782 125
519 3300046472 Ga0495580_0364450 Ga0495580_0364450_420_806 125
520 3300046474 Ga0495605_0000274 Ga0495605_0000274_47827_48213 125
521 3300046474 Ga0495605_0000350 Ga0495605_0000350_26213_26599 125
522 3300046474 Ga0495605_0001555 Ga0495605_0001555_14258_14644 125
523 3300046474 Ga0495605_0060711 Ga0495605_0060711_1290_1667 125
524 3300046474 Ga0495605_0074505 Ga0495605_0074505_552_929 125
525 3300046474 Ga0495605_0172319 Ga0495605_0172319_125_511 125
526 3300046474 Ga0495605_0435498 Ga0495605_0435498_14_400 125
527 3300046475 Ga0495639_0000002 Ga0495639_0000002_98033_98419 125
528 3300046475 Ga0495639_0080090 Ga0495639_0080090_783_1163 125
529 3300046477 Ga0495664_0835448 Ga0495664_0835448_123_500 125
530 3300046491 Ga0495584_0000019 Ga0495584_0000019_115838_116215 125
531 3300046491 Ga0495584_0000084 Ga0495584_0000084_44725_45111 125
532 3300046491 Ga0495584_0000094 Ga0495584_0000094_36323_36709 125
533 3300046491 Ga0495584_0013440 Ga0495584_0013440_3232_3609 125
534 3300046491 Ga0495584_0015342 Ga0495584_0015342_322_708 125
535 3300046491 Ga0495584_0050923 Ga0495584_0050923_952_1329 125
536 3300046492 Ga0495585_0000523 Ga0495585_0000523_16081_16458 125
537 3300046492 Ga0495585_0005919 Ga0495585_0005919_6902_7279 125
538 3300046492 Ga0495585_0023445 Ga0495585_0023445_2399_2776 125
539 3300046499 Ga0495594_0006359 Ga0495594_0006359_301_687 125
540 3300046499 Ga0495594_0050618 Ga0495594_0050618_916_1296 125
541 3300046501 Ga0495607_0000092 Ga0495607_0000092_45578_45964 125
542 3300046501 Ga0495607_0005609 Ga0495607_0005609_6228_6614 125
543 3300046501 Ga0495607_0022453 Ga0495607_0022453_764_1141 125
544 3300046501 Ga0495607_0170408 Ga0495607_0170408_579_965 125
545 3300046501 Ga0495607_0325135 Ga0495607_0325135_166_552 125
546 3300046506 Ga0495583_0000916 Ga0495583_0000916_6213_6590 125
547 3300046506 Ga0495583_0003022 Ga0495583_0003022_12607_12993 125
548 3300046506 Ga0495583_0011012 Ga0495583_0011012_4416_4802 125
549 3300046506 Ga0495583_0049265 Ga0495583_0049265_152_538 125
550 3300046512 Ga0495610_0002962 Ga0495610_0002962_700_1086 125
551 3300046512 Ga0495610_0011561 Ga0495610_0011561_36_413 125
552 3300046512 Ga0495610_0112003 Ga0495610_0112003_277_663 125
553 3300046513 Ga0495616_0027295 Ga0495616_0027295_2024_2410 125
554 3300046513 Ga0495616_0100219 Ga0495616_0100219_47_424 125
555 3300046513 Ga0495616_0158909 Ga0495616_0158909_183_560 125
556 3300046516 Ga0495628_0571123 Ga0495628_0571123_254_631 125
557 3300046517 Ga0495630_0340132 Ga0495630_0340132_54_431 125
558 3300046518 Ga0495631_0075050 Ga0495631_0075050_765_1142 125
559 3300046518 Ga0495631_0102336 Ga0495631_0102336_339_725 125
560 3300046518 Ga0495631_0453359 Ga0495631_0453359_127_507 125
561 3300046519 Ga0495632_0000200 Ga0495632_0000200_34650_35036 125
562 3300046519 Ga0495632_0000626 Ga0495632_0000626_18610_18987 125
563 3300046519 Ga0495632_0049489 Ga0495632_0049489_1646_2023 125
564 3300046519 Ga0495632_0113693 Ga0495632_0113693_279_656 125
565 3300046520 Ga0495637_0005041 Ga0495637_0005041_905_1291 125
566 3300046520 Ga0495637_0019963 Ga0495637_0019963_2138_2515 125
567 3300046520 Ga0495637_0038372 Ga0495637_0038372_960_1337 125
568 3300046520 Ga0495637_0099313 Ga0495637_0099313_263_649 125
569 3300046520 Ga0495637_0202657 Ga0495637_0202657_120_506 125
570 3300046522 Ga0495643_0008180 Ga0495643_0008180_2838_3224 125
571 3300046522 Ga0495643_0029961 Ga0495643_0029961_2597_2974 125
572 3300046523 Ga0495644_0064282 Ga0495644_0064282_821_1207 125
573 3300046523 Ga0495644_0092902 Ga0495644_0092902_357_734 125
574 3300046523 Ga0495644_0354957 Ga0495644_0354957_72_458 125
575 3300046524 Ga0495648_0096671 Ga0495648_0096671_769_1155 125
576 3300046524 Ga0495648_0191884 Ga0495648_0191884_352_729 125
577 3300046524 Ga0495648_0245376 Ga0495648_0245376_403_780 125
578 3300046524 Ga0495648_0252056 Ga0495648_0252056_298_684 125
579 3300046524 Ga0495648_0479620 Ga0495648_0479620_24_401 125
580 3300046526 Ga0495666_0016453 Ga0495666_0016453_2968_3354 125
581 3300046526 Ga0495666_0042528 Ga0495666_0042528_1260_1637 125
582 3300046526 Ga0495666_0286387 Ga0495666_0286387_211_588 125
583 3300046528 Ga0495642_0000008 Ga0495642_0000008_121324_121710 125
584 3300046528 Ga0495642_0000220 Ga0495642_0000220_13980_14357 125
585 3300046528 Ga0495642_0001436 Ga0495642_0001436_7224_7610 125
586 3300046528 Ga0495642_0440469 Ga0495642_0440469_139_525 125
587 3300046530 Ga0495654_0000382 Ga0495654_0000382_34483_34869 125
588 3300046530 Ga0495654_0001909 Ga0495654_0001909_685_1071 125
589 3300046530 Ga0495654_0012316 Ga0495654_0012316_1688_2074 125
590 3300046530 Ga0495654_0067260 Ga0495654_0067260_975_1361 125
591 3300046530 Ga0495654_0081906 Ga0495654_0081906_38_418 125
592 3300046530 Ga0495654_0137908 Ga0495654_0137908_697_1074 125
593 3300046536 Ga0495587_0004751 Ga0495587_0004751_3066_3443 125
594 3300046538 Ga0495609_0005717 Ga0495609_0005717_1713_2099 125
595 3300046538 Ga0495609_0015771 Ga0495609_0015771_1185_1562 125
596 3300046538 Ga0495609_0078150 Ga0495609_0078150_332_712 125
597 3300046542 Ga0495597_0002445 Ga0495597_0002445_553_930 125
598 3300046542 Ga0495597_0004619 Ga0495597_0004619_4318_4704 125
599 3300046542 Ga0495597_0121295 Ga0495597_0121295_196_573 125
600 3300046542 Ga0495597_0253825 Ga0495597_0253825_208_585 125
601 3300046542 Ga0495597_0324070 Ga0495597_0324070_99_476 125
602 3300046557 Ga0495622_0003749 Ga0495622_0003749_3371_3757 125
603 3300046557 Ga0495622_0012966 Ga0495622_0012966_3197_3574 125
604 3300046557 Ga0495622_0084547 Ga0495622_0084547_432_818 125
605 3300046557 Ga0495622_0132096 Ga0495622_0132096_99_479 125
606 3300046557 Ga0495622_0247102 Ga0495622_0247102_223_609 125
607 3300046558 Ga0495633_0266920 Ga0495633_0266920_383_769 125
608 3300046615 Ga0495656_0035823 Ga0495656_0035823_715_1092 125
609 3300046616 Ga0495668_0170276 Ga0495668_0170276_713_1090 125
610 3300046642 Ga0495634_0000551 Ga0495634_0000551_35440_35817 125
611 3300046648 Ga0495611_0041665 Ga0495611_0041665_1491_1877 125
612 3300046660 Ga0495625_0100574 Ga0495625_0100574_88_465 125
613 3300046660 Ga0495625_0392580 Ga0495625_0392580_448_834 125
614 3300046660 Ga0495625_0764091 Ga0495625_0764091_153_539 125
615 3300046660 Ga0495625_0788529 Ga0495625_0788529_88_465 125
616 3300046663 Ga0495635_0161167 Ga0495635_0161167_687_1064 125
617 3300046664 Ga0495659_0000035 Ga0495659_0000035_63218_63604 125
618 3300046664 Ga0495659_0019346 Ga0495659_0019346_1518_1904 125
619 3300046664 Ga0495659_0025564 Ga0495659_0025564_1571_1957 125
620 3300046664 Ga0495659_0061942 Ga0495659_0061942_198_575 125
621 3300046665 Ga0495661_0002752 Ga0495661_0002752_12237_12623 125
622 3300046674 Ga0495588_0035786 Ga0495588_0035786_1870_2256 125
623 3300046674 Ga0495588_0052446 Ga0495588_0052446_884_1261 125
624 3300046674 Ga0495588_0106523 Ga0495588_0106523_417_794 125
625 3300046674 Ga0495588_0207746 Ga0495588_0207746_169_555 125
626 3300046674 Ga0495588_0220812 Ga0495588_0220812_362_748 125
627 3300046679 Ga0495623_0125201 Ga0495623_0125201_679_1056 125
628 3300046680 Ga0495646_0000188 Ga0495646_0000188_20811_21188 125
629 3300046680 Ga0495646_0008812 Ga0495646_0008812_3238_3615 125
630 3300046684 Ga0495669_0003562 Ga0495669_0003562_766_1143 125
631 3300046689 Ga0495613_0220562 Ga0495613_0220562_744_1121 125
632 3300046691 Ga0495670_0000280 Ga0495670_0000280_20093_20479 125
633 3300046691 Ga0495670_0022098 Ga0495670_0022098_2423_2809 125
634 3300046691 Ga0495670_0027037 Ga0495670_0027037_163_549 125
635 3300046691 Ga0495670_0083672 Ga0495670_0083672_211_591 125
636 3300046691 Ga0495670_0093066 Ga0495670_0093066_790_1167 125
637 3300046691 Ga0495670_0209161 Ga0495670_0209161_536_913 125
638 3300046692 Ga0495671_0000136 Ga0495671_0000136_20028_20414 125
639 3300046692 Ga0495671_0001271 Ga0495671_0001271_11228_11605 125
640 3300046692 Ga0495671_0053875 Ga0495671_0053875_1305_1691 125
641 3300046692 Ga0495671_0195153 Ga0495671_0195153_115_492 125
642 3300046692 Ga0495671_0354525 Ga0495671_0354525_135_521 125
643 3300046692 Ga0495671_0435302 Ga0495671_0435302_189_575 125
644 3300046694 Ga0495649_0000289 Ga0495649_0000289_33555_33941 125
645 3300046694 Ga0495649_0001225 Ga0495649_0001225_538_924 125
646 3300046694 Ga0495649_0111503 Ga0495649_0111503_499_885 125
647 3300046694 Ga0495649_0132989 Ga0495649_0132989_223_600 125
648 3300046694 Ga0495649_0486431 Ga0495649_0486431_221_598 125
649 3300046794 Ga0495589_0000075 Ga0495589_0000075_25560_25946 125
650 3300046794 Ga0495589_0004183 Ga0495589_0004183_285_671 125
651 3300046794 Ga0495589_0019957 Ga0495589_0019957_2711_3097 125
652 3300046794 Ga0495589_0140516 Ga0495589_0140516_16_393 125
653 3300046794 Ga0495589_0432871 Ga0495589_0432871_199_585 125
654 3300046810 Ga0495660_0001165 Ga0495660_0001165_18089_18466 125
655 3300046810 Ga0495660_0058591 Ga0495660_0058591_921_1298 125
656 3300046810 Ga0495660_0068446 Ga0495660_0068446_1168_1554 125
657 3300046810 Ga0495660_0360947 Ga0495660_0360947_248_634 125
658 3300046810 Ga0495660_0414168 Ga0495660_0414168_97_477 125
659 3300047315 Ga0495581_0001262 Ga0495581_0001262_12493_12879 125
660 3300047317 Ga0495604_0163080 Ga0495604_0163080_555_932 125
661 3300047318 Ga0495636_0001517 Ga0495636_0001517_1769_2155 125
662 3300047319 Ga0495674_0250491 Ga0495674_0250491_583_960 125
663 3300047320 Ga0495672_0000433 Ga0495672_0000433_45273_45659 125
664 3300047320 Ga0495672_0001129 Ga0495672_0001129_481_867 125
665 3300047320 Ga0495672_0003508 Ga0495672_0003508_12318_12704 125
666 3300047320 Ga0495672_0011424 Ga0495672_0011424_239_625 125
667 3300047320 Ga0495672_0086845 Ga0495672_0086845_374_751 125
668 3300047320 Ga0495672_0099498 Ga0495672_0099498_980_1366 125
669 3300047320 Ga0495672_0116520 Ga0495672_0116520_802_1188 125
670 3300047320 Ga0495672_0317663 Ga0495672_0317663_203_589 125
671 3300047322 Ga0495680_0196154 Ga0495680_0196154_374_751 125
672 3300047323 Ga0495683_0005744 Ga0495683_0005744_6234_6620 125
673 3300047323 Ga0495683_0051082 Ga0495683_0051082_1361_1738 125
674 3300047323 Ga0495683_0054187 Ga0495683_0054187_702_1079 125
675 3300047323 Ga0495683_0150967 Ga0495683_0150967_348_734 125
676 3300047323 Ga0495683_0172534 Ga0495683_0172534_371_757 125
677 3300047443 Ga0495687_000260 Ga0495687_000260_54515_54901 125
678 3300047443 Ga0495687_098152 Ga0495687_098152_220_606 125
679 3300047443 Ga0495687_107390 Ga0495687_107390_41_418 125
680 3300047444 Ga0495675_0232724 Ga0495675_0232724_485_862 125
681 3300047445 Ga0495677_0001065 Ga0495677_0001065_766_1143 125
682 3300047446 Ga0495679_002365 Ga0495679_002365_50_427 125
683 3300047446 Ga0495679_003005 Ga0495679_003005_7565_7942 125
684 3300047447 Ga0495685_208062 Ga0495685_208062_185_562 125
685 3300047469 Ga0495673_0001462 Ga0495673_0001462_14233_14619 125
686 3300047469 Ga0495673_0002369 Ga0495673_0002369_416_802 125
687 3300047469 Ga0495673_0034553 Ga0495673_0034553_1669_2055 125
688 3300047469 Ga0495673_0131399 Ga0495673_0131399_373_750 125
689 3300047470 Ga0495681_0000009 Ga0495681_0000009_2249_2635 125
690 3300047470 Ga0495681_0000031 Ga0495681_0000031_57905_58282 125
691 3300047470 Ga0495681_0085040 Ga0495681_0085040_648_1025 125
692 3300047470 Ga0495681_0302572 Ga0495681_0302572_162_539 125
693 3300047472 Ga0495686_0021109 Ga0495686_0021109_695_1072 125
694 3300047472 Ga0495686_0186726 Ga0495686_0186726_159_536 125
695 3300047673 Ga0495593_0082015 Ga0495593_0082015_885_1271 125
696 3300047673 Ga0495593_0127587 Ga0495593_0127587_445_822 125
697 3300047673 Ga0495593_0217454 Ga0495593_0217454_227_607 125
698 3300047673 Ga0495593_0454374 Ga0495593_0454374_229_609 125
699 3300048088 Ga0495602_0273094 Ga0495602_0273094_444_821 125
700 3300048091 Ga0495626_0000212 Ga0495626_0000212_8294_8680 125
701 3300048091 Ga0495626_0000544 Ga0495626_0000544_23098_23484 125
702 3300048091 Ga0495626_0002984 Ga0495626_0002984_423_809 125
703 3300048091 Ga0495626_0016693 Ga0495626_0016693_339_725 125
704 3300048091 Ga0495626_0089741 Ga0495626_0089741_627_1013 125
705 3300048091 Ga0495626_0354977 Ga0495626_0354977_16_393 125
706 3300048905 Ga0496102_0001578 Ga0496102_0001578_731_1108 125
707 3300048906 Ga0496103_0057821 Ga0496103_0057821_1311_1688 125
708 3300048907 Ga0496104_0330838 Ga0496104_0330838_221_607 125
709 3300048908 Ga0496105_0140359 Ga0496105_0140359_152_538 125
710 3300048908 Ga0496105_0436029 Ga0496105_0436029_563_940 125
711 3300048910 Ga0496107_0229967 Ga0496107_0229967_669_1055 125
712 3300048913 Ga0496110_0270701 Ga0496110_0270701_50_427 125
713 3300048914 Ga0496111_0497671 Ga0496111_0497671_256_633 125
714 3300048917 Ga0496114_0820588 Ga0496114_0820588_142_519 125
715 3300048918 Ga0496115_0684902 Ga0496115_0684902_238_615 125
716 3300048919 Ga0496116_0000454 Ga0496116_0000454_35476_35862 125
717 3300048920 Ga0496117_0143858 Ga0496117_0143858_707_1084 125
718 3300048920 Ga0496117_0353854 Ga0496117_0353854_160_546 125
719 3300048921 Ga0496118_0046491 Ga0496118_0046491_2597_2983 125
720 3300048921 Ga0496118_0162057 Ga0496118_0162057_339_716 125
721 3300048922 Ga0496119_0515759 Ga0496119_0515759_125_502 125
722 3300048924 Ga0496121_0002269 Ga0496121_0002269_22935_23321 125
723 3300048924 Ga0496121_0220565 Ga0496121_0220565_685_1062 125
724 3300048925 Ga0496122_0016424 Ga0496122_0016424_378_764 125
725 3300048925 Ga0496122_0455142 Ga0496122_0455142_184_561 125
726 3300048926 Ga0496123_0085777 Ga0496123_0085777_156_542 125
727 3300048927 Ga0496124_0101136 Ga0496124_0101136_348_734 125
728 3300048927 Ga0496124_0292552 Ga0496124_0292552_774_1151 125
729 3300048928 Ga0496125_0172921 Ga0496125_0172921_747_1124 125
730 3300048928 Ga0496125_0284763 Ga0496125_0284763_626_1006 125
731 3300048929 Ga0496126_0510387 Ga0496126_0510387_83_460 125
732 3300049459 Ga0495678_000255 Ga0495678_000255_23625_24011 125
733 3300049459 Ga0495678_001291 Ga0495678_001291_19316_19702 125
734 3300049459 Ga0495678_011905 Ga0495678_011905_2782_3168 125
735 3300049459 Ga0495678_039480 Ga0495678_039480_961_1338 125
736 3300049459 Ga0495678_072225 Ga0495678_072225_247_624 125
737 3300049459 Ga0495678_089199 Ga0495678_089199_697_1074 125
738 3300049460 Ga0495682_0039894 Ga0495682_0039894_717_1094 125
739 3300049460 Ga0495682_0040362 Ga0495682_0040362_975_1361 125
740 3300049460 Ga0495682_0072793 Ga0495682_0072793_131_508 125
741 3300049460 Ga0495682_0208568 Ga0495682_0208568_10_387 125
742 3300050489 nmdc:mga03683_10369_c1 nmdc:mga03683_10369_c1_320_706 125
743 3300050491 nmdc:mga00v17_412133_c1 nmdc:mga00v17_412133_c1_130_516 125
744 3300050491 nmdc:mga00v17_554882_c1 nmdc:mga00v17_554882_c1_197_583 125
745 3300050491 nmdc:mga00v17_99955_c1 nmdc:mga00v17_99955_c1_333_719 125
746 3300050514 nmdc:mga08x19_329867_c1 nmdc:mga08x19_329867_c1_275_661 125
747 3300050516 nmdc:mga0sz30_113208_c1 nmdc:mga0sz30_113208_c1_23_409 125

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13806

Rieske_2

Rieske-like [2Fe-2S] domain

21

127

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c0d-assembly3.cif.gz_C crystal structure of the putative nitrite reductase nadph (small subunit) oxidoreductase protein q87hb1. northeast structural genomics consortium target vpr162 0.9558 18 121
4aiv-assembly1.cif.gz_A crystal structure of putative nadh-dependent nitrite reductase small subunit from mycobacterium tuberculosis 0.9392 18 122
3c0d-assembly3.cif.gz_C crystal structure of the putative nitrite reductase nadph (small subunit) oxidoreductase protein q87hb1. northeast structural genomics consortium target vpr162 0.9299 18 121
2jo6-assembly1.cif.gz_A nmr structure of the e.coli protein nird, northeast structural genomics target et100 0.8953 18 119
2qpz-assembly1.cif.gz_A naphthalene 1,2-dioxygenase rieske ferredoxin 0.8793 18 122
ID Description Score Start End Superfamily
3c0dC00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9539 18 121 2.102.10.10
af_P0A9I8_1_108_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9471 18 121 2.102.10.10
4aivA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9392 18 122 2.102.10.10
3c0dC00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9273 18 121 2.102.10.10
3gkqC02 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.9204 18 122 2.20.25.680
ID Description Score Start End GO Terms
AF-A0A7X1AP51-F1-model_v4 Nitrite reductase small subunit NirD 0.9943 18 121 GO:0042128
GO:0046872
GO:0051537
AF-A0A0H5AJC9-F1-model_v4 Nitrite reductase 0.9912 18 122 GO:0042128
GO:0046872
GO:0051537
AF-A0A2N1YS48-F1-model_v4 deleted 0.9902 18 122
AF-A0A239HX82-F1-model_v4 Nitrite reductase (NADH) small subunit 0.9877 18 122 GO:0042128
GO:0046872
GO:0051537
AF-A0A4Z0AHV6-F1-model_v4 Nitrite reductase (NAD(P)H) small subunit 0.9876 18 122 GO:0042128
GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
87.92 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map