F478734
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 744 | 294 | 1488 | 203 |
Family's Representative Sequence
| Representative Sequence | 3300006881|Ga0068865_100318422|Ga0068865_1003184222 |
| Length | 234 |
| Sequence | LAANECGLRLGGRDPELGNITGTGTTLPTLTDRSTGQEDKRRLILDAAVRVFARKGYHTCRVGDIAEEAGVAHGLLYHYFRSKEELLETIFRETWRDVLDAVRAVEETDESARDQLAGITKILLRAWRRDPDLVRVLVREVTRSSHLQERIEEIDAAFAGLERIIARGQQEGEFRSDLDPRMASYVFYGALEEILTGWVLGQLEDGDEVIARAEQTVVEVICGGLAADREVAKV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 8 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 46 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 47 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 48 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 50 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 54 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 55 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 56 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 57 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 58 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 59 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 60 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 61 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 125 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 127 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 128 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 129 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 130 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 131 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 132 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 133 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 134 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 135 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 136 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 137 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 138 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 139 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 140 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 141 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 142 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 143 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 144 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 145 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 146 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 147 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 148 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 149 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 150 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 151 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 152 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 153 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 154 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 155 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 156 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 157 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 158 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 159 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 160 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 161 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 162 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 163 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 164 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 165 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 166 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 167 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 168 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 169 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 170 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 171 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 172 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 173 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 174 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 175 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 176 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 177 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 178 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 179 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 180 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 181 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 231 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 232 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 233 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 234 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 235 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 236 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 239 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 240 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 241 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 242 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 243 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 244 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 278 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 279 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 292 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 293 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.87 |
| Metatranscriptomes | 0.13 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.54 |
| Nodule | 0 |
| Rhizoplane | 13.17 |
| Rhizosphere | 85.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068865_100318422 | 3300006881 | Bacteria | 1250 |
| 2 | JGI25407J50210_10001359 | 3300003373 | Bacteria | 5530 |
| 3 | Ga0068869_100549747 | 3300005334 | Unclassified | 970 |
| 4 | Ga0070680_100027894 | 3300005336 | Bacteria | 4525 |
| 5 | Ga0070682_100088246 | 3300005337 | Bacteria | 2024 |
| 6 | Ga0068868_100147955 | 3300005338 | Bacteria | 1932 |
| 7 | Ga0070692_10372736 | 3300005345 | Bacteria | 893 |
| 8 | Ga0070692_10410583 | 3300005345 | Bacteria | 857 |
| 9 | Ga0070668_100207419 | 3300005347 | Bacteria | 1611 |
| 10 | Ga0070671_100093071 | 3300005355 | Bacteria | 2526 |
| 11 | Ga0070671_100332722 | 3300005355 | Bacteria | 1295 |
| 12 | Ga0070674_100065328 | 3300005356 | Unclassified | 2553 |
| 13 | Ga0070673_100092341 | 3300005364 | Bacteria | 2476 |
| 14 | Ga0070673_100172073 | 3300005364 | Bacteria | 1849 |
| 15 | Ga0070659_100347994 | 3300005366 | Bacteria | 1243 |
| 16 | Ga0070667_100061744 | 3300005367 | Bacteria | 3173 |
| 17 | Ga0070703_10001626 | 3300005406 | Bacteria | 6682 |
| 18 | Ga0070709_10046599 | 3300005434 | Bacteria | 2696 |
| 19 | Ga0070709_10046683 | 3300005434 | Bacteria | 2694 |
| 20 | Ga0070714_100068582 | 3300005435 | Bacteria | 3060 |
| 21 | Ga0070713_100067930 | 3300005436 | Bacteria | 3003 |
| 22 | Ga0070710_10023408 | 3300005437 | Bacteria | 3247 |
| 23 | Ga0070710_10024938 | 3300005437 | Bacteria | 3160 |
| 24 | Ga0070710_10035004 | 3300005437 | Unclassified | 2735 |
| 25 | Ga0070711_100226956 | 3300005439 | Unclassified | 1454 |
| 26 | Ga0070705_100016464 | 3300005440 | Bacteria | 3842 |
| 27 | Ga0070705_100179430 | 3300005440 | Bacteria | 1433 |
| 28 | Ga0070705_100270778 | 3300005440 | Bacteria | 1203 |
| 29 | Ga0070700_100173972 | 3300005441 | Bacteria | 1493 |
| 30 | Ga0070694_100054704 | 3300005444 | Bacteria | 2704 |
| 31 | Ga0070708_100060847 | 3300005445 | Bacteria | 3372 |
| 32 | Ga0070708_100062644 | 3300005445 | Bacteria | 3327 |
| 33 | Ga0070708_100076236 | 3300005445 | Unclassified | 3028 |
| 34 | Ga0070708_100183403 | 3300005445 | Bacteria | 1957 |
| 35 | Ga0070708_100704289 | 3300005445 | Bacteria | 950 |
| 36 | Ga0070678_100424800 | 3300005456 | Bacteria | 1159 |
| 37 | Ga0070662_100293717 | 3300005457 | Bacteria | 1318 |
| 38 | Ga0070681_10002438 | 3300005458 | Bacteria | 17023 |
| 39 | Ga0070681_10751172 | 3300005458 | Bacteria | 892 |
| 40 | Ga0070685_10217194 | 3300005466 | Bacteria | 1251 |
| 41 | Ga0070706_100005941 | 3300005467 | Bacteria | 11541 |
| 42 | Ga0070706_100009560 | 3300005467 | Bacteria | 9017 |
| 43 | Ga0070706_100094643 | 3300005467 | Bacteria | 2772 |
| 44 | Ga0070706_100364819 | 3300005467 | Bacteria | 1346 |
| 45 | Ga0070707_100001334 | 3300005468 | Bacteria | 24304 |
| 46 | Ga0070707_100002726 | 3300005468 | Bacteria | 16796 |
| 47 | Ga0070707_100043625 | 3300005468 | Bacteria | 4292 |
| 48 | Ga0070707_100057163 | 3300005468 | Bacteria | 3743 |
| 49 | Ga0070698_100010130 | 3300005471 | Bacteria | 10068 |
| 50 | Ga0070698_100032297 | 3300005471 | Bacteria | 5424 |
| 51 | Ga0070698_100043922 | 3300005471 | Bacteria | 4579 |
| 52 | Ga0070698_100107819 | 3300005471 | Unclassified | 2753 |
| 53 | Ga0070699_100047689 | 3300005518 | Bacteria | 3707 |
| 54 | Ga0070699_100090373 | 3300005518 | Bacteria | 2676 |
| 55 | Ga0070699_100128307 | 3300005518 | Bacteria | 2235 |
| 56 | Ga0070699_100538361 | 3300005518 | Unclassified | 1062 |
| 57 | Ga0070699_100601127 | 3300005518 | Unclassified | 1003 |
| 58 | Ga0070679_100035588 | 3300005530 | Bacteria | 4940 |
| 59 | Ga0070684_100000999 | 3300005535 | Bacteria | 20140 |
| 60 | Ga0070697_100031410 | 3300005536 | Bacteria | 4273 |
| 61 | Ga0070697_100053435 | 3300005536 | Unclassified | 3283 |
| 62 | Ga0070697_100372039 | 3300005536 | Unclassified | 1236 |
| 63 | Ga0070697_100426680 | 3300005536 | Bacteria | 1152 |
| 64 | Ga0070686_100088858 | 3300005544 | Bacteria | 2063 |
| 65 | Ga0070695_100019044 | 3300005545 | Bacteria | 4174 |
| 66 | Ga0070695_100091435 | 3300005545 | Bacteria | 2033 |
| 67 | Ga0070695_100328745 | 3300005545 | Bacteria | 1139 |
| 68 | Ga0070696_100091837 | 3300005546 | Bacteria | 2162 |
| 69 | Ga0070693_100194067 | 3300005547 | Bacteria | 1315 |
| 70 | Ga0070704_100026128 | 3300005549 | Bacteria | 3853 |
| 71 | Ga0070704_100088723 | 3300005549 | Unclassified | 2298 |
| 72 | Ga0068855_100485342 | 3300005563 | Unclassified | 1344 |
| 73 | Ga0070702_100014234 | 3300005615 | Bacteria | 4033 |
| 74 | Ga0068864_100521808 | 3300005618 | Unclassified | 1145 |
| 75 | Ga0068866_10208062 | 3300005718 | Bacteria | 1173 |
| 76 | Ga0068861_100753961 | 3300005719 | Unclassified | 909 |
| 77 | Ga0081455_10076753 | 3300005937 | Bacteria | 2751 |
| 78 | Ga0081455_10348696 | 3300005937 | Bacteria | 1045 |
| 79 | Ga0081538_10000108 | 3300005981 | Bacteria | 82426 |
| 80 | Ga0081538_10005692 | 3300005981 | Bacteria | 11148 |
| 81 | Ga0081539_10001930 | 3300005985 | Bacteria | 31892 |
| 82 | Ga0081539_10002329 | 3300005985 | Bacteria | 27351 |
| 83 | Ga0081539_10007217 | 3300005985 | Bacteria | 10223 |
| 84 | Ga0070717_10031572 | 3300006028 | Bacteria | 4262 |
| 85 | Ga0075432_10049443 | 3300006058 | Bacteria | 1481 |
| 86 | Ga0070715_10020292 | 3300006163 | Unclassified | 2561 |
| 87 | Ga0070715_10034625 | 3300006163 | Bacteria | 2071 |
| 88 | Ga0070716_100062590 | 3300006173 | Unclassified | 2158 |
| 89 | Ga0070716_100094648 | 3300006173 | Bacteria | 1816 |
| 90 | Ga0070716_100300928 | 3300006173 | Bacteria | 1116 |
| 91 | Ga0070712_100001584 | 3300006175 | Bacteria | 13901 |
| 92 | Ga0070712_100010323 | 3300006175 | Bacteria | 5888 |
| 93 | Ga0070712_100415287 | 3300006175 | Bacteria | 1114 |
| 94 | Ga0075367_10279676 | 3300006178 | Bacteria | 1049 |
| 95 | Ga0068871_100040544 | 3300006358 | Bacteria | 3730 |
| 96 | Ga0075428_100191176 | 3300006844 | Bacteria | 2214 |
| 97 | Ga0075431_100040366 | 3300006847 | Bacteria | 4810 |
| 98 | Ga0075433_10012724 | 3300006852 | Bacteria | 6809 |
| 99 | Ga0075433_10022462 | 3300006852 | Bacteria | 5295 |
| 100 | Ga0075433_10027727 | 3300006852 | Bacteria | 4807 |
| 101 | Ga0075433_10045735 | 3300006852 | Bacteria | 3806 |
| 102 | Ga0075434_100015007 | 3300006871 | Bacteria | 7418 |
| 103 | Ga0075434_100101742 | 3300006871 | Bacteria | 2880 |
| 104 | Ga0075434_100116801 | 3300006871 | Bacteria | 2681 |
| 105 | Ga0075434_101466802 | 3300006871 | Unclassified | 692 |
| 106 | Ga0068865_100178702 | 3300006881 | Bacteria | 1633 |
| 107 | Ga0075436_100009506 | 3300006914 | Bacteria | 6650 |
| 108 | Ga0075436_100014894 | 3300006914 | Bacteria | 5328 |
| 109 | Ga0075436_100106096 | 3300006914 | Bacteria | 1959 |
| 110 | Ga0075436_100230056 | 3300006914 | Unclassified | 1317 |
| 111 | Ga0075435_100018555 | 3300007076 | Bacteria | 5295 |
| 112 | Ga0075435_100068139 | 3300007076 | Bacteria | 2898 |
| 113 | Ga0075435_100273561 | 3300007076 | Bacteria | 1441 |
| 114 | Ga0105240_11096606 | 3300009093 | Bacteria | 847 |
| 115 | Ga0111539_10025172 | 3300009094 | Bacteria | 7295 |
| 116 | Ga0111539_10046599 | 3300009094 | Bacteria | 5185 |
| 117 | Ga0111539_10046900 | 3300009094 | Bacteria | 5167 |
| 118 | Ga0111539_10159063 | 3300009094 | Bacteria | 2642 |
| 119 | Ga0111539_10249907 | 3300009094 | Unclassified | 2065 |
| 120 | Ga0111539_10345196 | 3300009094 | Bacteria | 1733 |
| 121 | Ga0111539_10882667 | 3300009094 | Bacteria | 1040 |
| 122 | Ga0111539_11196939 | 3300009094 | Bacteria | 882 |
| 123 | Ga0105245_10015305 | 3300009098 | Bacteria | 6684 |
| 124 | Ga0105245_10023866 | 3300009098 | Bacteria | 5367 |
| 125 | Ga0105245_10075383 | 3300009098 | Bacteria | 3071 |
| 126 | Ga0105245_10229710 | 3300009098 | Unclassified | 1794 |
| 127 | Ga0105245_10261762 | 3300009098 | Bacteria | 1683 |
| 128 | Ga0105245_10424012 | 3300009098 | Bacteria | 1334 |
| 129 | Ga0105247_10155882 | 3300009101 | Bacteria | 1508 |
| 130 | Ga0114129_10014214 | 3300009147 | Bacteria | 11342 |
| 131 | Ga0114129_10043890 | 3300009147 | Bacteria | 6290 |
| 132 | Ga0114129_10052066 | 3300009147 | Bacteria | 5746 |
| 133 | Ga0114129_10082099 | 3300009147 | Bacteria | 4479 |
| 134 | Ga0114129_10208334 | 3300009147 | Bacteria | 2644 |
| 135 | Ga0114129_10443153 | 3300009147 | Unclassified | 1705 |
| 136 | Ga0114129_10540901 | 3300009147 | Bacteria | 1516 |
| 137 | Ga0105243_10012521 | 3300009148 | Bacteria | 6415 |
| 138 | Ga0105243_10032390 | 3300009148 | Bacteria | 4039 |
| 139 | Ga0105243_10134757 | 3300009148 | Bacteria | 2100 |
| 140 | Ga0105243_10521530 | 3300009148 | Unclassified | 1130 |
| 141 | Ga0105241_10049511 | 3300009174 | Bacteria | 3200 |
| 142 | Ga0105241_10072313 | 3300009174 | Bacteria | 2680 |
| 143 | Ga0105242_10094388 | 3300009176 | Bacteria | 2523 |
| 144 | Ga0105242_10406407 | 3300009176 | Bacteria | 1272 |
| 145 | Ga0105242_10658165 | 3300009176 | Bacteria | 1019 |
| 146 | Ga0105242_10737529 | 3300009176 | Bacteria | 968 |
| 147 | Ga0105248_10037171 | 3300009177 | Bacteria | 5446 |
| 148 | Ga0105248_10403846 | 3300009177 | Bacteria | 1538 |
| 149 | Ga0105237_10623815 | 3300009545 | Bacteria | 1085 |
| 150 | Ga0105238_10159235 | 3300009551 | Unclassified | 2233 |
| 151 | Ga0105238_10459722 | 3300009551 | Bacteria | 1270 |
| 152 | Ga0105249_10008550 | 3300009553 | Bacteria | 8926 |
| 153 | Ga0105249_10526487 | 3300009553 | Unclassified | 1230 |
| 154 | Ga0105239_10032166 | 3300010375 | Bacteria | 5765 |
| 155 | Ga0105239_10123880 | 3300010375 | Bacteria | 2872 |
| 156 | Ga0105246_10263965 | 3300011119 | Bacteria | 1373 |
| 157 | Ga0157373_10464043 | 3300013100 | Bacteria | 912 |
| 158 | Ga0157374_10228958 | 3300013296 | Bacteria | 1825 |
| 159 | Ga0157374_11121941 | 3300013296 | Bacteria | 807 |
| 160 | Ga0157378_10007435 | 3300013297 | Bacteria | 9569 |
| 161 | Ga0157378_10075204 | 3300013297 | Bacteria | 3040 |
| 162 | Ga0163162_10004079 | 3300013306 | Bacteria | 14016 |
| 163 | Ga0163162_10748857 | 3300013306 | Unclassified | 1096 |
| 164 | Ga0163162_10785427 | 3300013306 | Bacteria | 1070 |
| 165 | Ga0157372_10523582 | 3300013307 | Bacteria | 1382 |
| 166 | Ga0157372_11889507 | 3300013307 | Bacteria | 686 |
| 167 | Ga0157375_10021031 | 3300013308 | Bacteria | 5976 |
| 168 | Ga0157375_10392474 | 3300013308 | Bacteria | 1555 |
| 169 | Ga0157380_10013152 | 3300014326 | Bacteria | 6026 |
| 170 | Ga0157380_10149391 | 3300014326 | Bacteria | 2018 |
| 171 | Ga0157380_10873862 | 3300014326 | Bacteria | 923 |
| 172 | Ga0157377_10000547 | 3300014745 | Bacteria | 15851 |
| 173 | Ga0157377_10044489 | 3300014745 | Bacteria | 2476 |
| 174 | Ga0157379_10077823 | 3300014968 | Bacteria | 2970 |
| 175 | Ga0157376_10091996 | 3300014969 | Bacteria | 2629 |
| 176 | Ga0157376_10092560 | 3300014969 | Bacteria | 2621 |
| 177 | Ga0157376_10613597 | 3300014969 | Bacteria | 1084 |
| 178 | Ga0163161_10460549 | 3300017792 | Unclassified | 1029 |
| 179 | Ga0206352_10068228 | 3300020078 | Bacteria | 866 |
| 180 | Ga0207653_10000490 | 3300025885 | Bacteria | 15471 |
| 181 | Ga0207692_10006369 | 3300025898 | Bacteria | 4785 |
| 182 | Ga0207692_10421873 | 3300025898 | Bacteria | 835 |
| 183 | Ga0207688_10022234 | 3300025901 | Unclassified | 3468 |
| 184 | Ga0207685_10005258 | 3300025905 | Bacteria | 3397 |
| 185 | Ga0207699_10011479 | 3300025906 | Bacteria | 4476 |
| 186 | Ga0207699_10080045 | 3300025906 | Bacteria | 2023 |
| 187 | Ga0207643_10402908 | 3300025908 | Unclassified | 865 |
| 188 | Ga0207684_10046295 | 3300025910 | Bacteria | 3690 |
| 189 | Ga0207684_10064119 | 3300025910 | Bacteria | 3119 |
| 190 | Ga0207684_10194921 | 3300025910 | Bacteria | 1747 |
| 191 | Ga0207684_10235131 | 3300025910 | Bacteria | 1581 |
| 192 | Ga0207684_10320056 | 3300025910 | Bacteria | 1337 |
| 193 | Ga0207654_10324926 | 3300025911 | Bacteria | 1053 |
| 194 | Ga0207707_10001682 | 3300025912 | Bacteria | 20367 |
| 195 | Ga0207707_10641581 | 3300025912 | Bacteria | 896 |
| 196 | Ga0207693_10001093 | 3300025915 | Bacteria | 24388 |
| 197 | Ga0207693_10018089 | 3300025915 | Bacteria | 5615 |
| 198 | Ga0207693_10104597 | 3300025915 | Bacteria | 2220 |
| 199 | Ga0207663_10163256 | 3300025916 | Bacteria | 1575 |
| 200 | Ga0207663_10207937 | 3300025916 | Unclassified | 1416 |
| 201 | Ga0207657_10292117 | 3300025919 | Bacteria | 1292 |
| 202 | Ga0207657_10677980 | 3300025919 | Unclassified | 801 |
| 203 | Ga0207652_10023045 | 3300025921 | Bacteria | 5157 |
| 204 | Ga0207652_10570240 | 3300025921 | Bacteria | 1016 |
| 205 | Ga0207646_10004284 | 3300025922 | Bacteria | 15571 |
| 206 | Ga0207646_10028310 | 3300025922 | Bacteria | 5102 |
| 207 | Ga0207646_10112975 | 3300025922 | Bacteria | 2438 |
| 208 | Ga0207646_10152081 | 3300025922 | Bacteria | 2087 |
| 209 | Ga0207694_10365000 | 3300025924 | Bacteria | 1197 |
| 210 | Ga0207659_10413259 | 3300025926 | Bacteria | 1130 |
| 211 | Ga0207687_10731367 | 3300025927 | Bacteria | 841 |
| 212 | Ga0207700_10321308 | 3300025928 | Bacteria | 1341 |
| 213 | Ga0207644_10435966 | 3300025931 | Bacteria | 1075 |
| 214 | Ga0207690_10297131 | 3300025932 | Bacteria | 1262 |
| 215 | Ga0207706_10352984 | 3300025933 | Bacteria | 1278 |
| 216 | Ga0207686_10185443 | 3300025934 | Bacteria | 1479 |
| 217 | Ga0207686_10804583 | 3300025934 | Unclassified | 754 |
| 218 | Ga0207709_10131623 | 3300025935 | Bacteria | 1706 |
| 219 | Ga0207709_10286704 | 3300025935 | Bacteria | 1218 |
| 220 | Ga0207704_10502029 | 3300025938 | Unclassified | 978 |
| 221 | Ga0207704_10774874 | 3300025938 | Bacteria | 799 |
| 222 | Ga0207665_10006442 | 3300025939 | Bacteria | 7790 |
| 223 | Ga0207665_10007933 | 3300025939 | Bacteria | 7011 |
| 224 | Ga0207665_10029397 | 3300025939 | Unclassified | 3632 |
| 225 | Ga0207689_10146278 | 3300025942 | Bacteria | 1947 |
| 226 | Ga0207661_10001078 | 3300025944 | Bacteria | 18160 |
| 227 | Ga0207679_10102638 | 3300025945 | Bacteria | 2240 |
| 228 | Ga0207651_10051831 | 3300025960 | Bacteria | 2795 |
| 229 | Ga0207668_10065393 | 3300025972 | Unclassified | 2574 |
| 230 | Ga0207640_10040028 | 3300025981 | Bacteria | 2971 |
| 231 | Ga0207640_10991361 | 3300025981 | Bacteria | 739 |
| 232 | Ga0207678_10115142 | 3300026067 | Bacteria | 2294 |
| 233 | Ga0207678_10516160 | 3300026067 | Bacteria | 1043 |
| 234 | Ga0207708_10280714 | 3300026075 | Bacteria | 1349 |
| 235 | Ga0207702_10036442 | 3300026078 | Bacteria | 4115 |
| 236 | Ga0207676_11217205 | 3300026095 | Bacteria | 747 |
| 237 | Ga0207675_100012199 | 3300026118 | Bacteria | 8027 |
| 238 | Ga0207675_100564647 | 3300026118 | Bacteria | 1138 |
| 239 | Ga0207683_10005713 | 3300026121 | Bacteria | 10670 |
| 240 | Ga0207683_10018838 | 3300026121 | Bacteria | 5889 |
| 241 | Ga0207428_10011431 | 3300027907 | Bacteria | 7846 |
| 242 | Ga0207428_10218953 | 3300027907 | Bacteria | 1428 |
| 243 | Ga0207428_10387637 | 3300027907 | Unclassified | 1024 |
| 244 | Ga0268266_10931819 | 3300028379 | Bacteria | 840 |
| 245 | Ga0307405_10249346 | 3300031731 | Bacteria | 1320 |
| 246 | Ga0307412_10336352 | 3300031911 | Unclassified | 1207 |
| 247 | Ga0307409_100152639 | 3300031995 | Bacteria | 2008 |
| 248 | Ga0307416_100022997 | 3300032002 | Bacteria | 4513 |
| 249 | Ga0307416_100502623 | 3300032002 | Bacteria | 1277 |
| 250 | Ga0307416_101281646 | 3300032002 | Bacteria | 839 |
| 251 | Ga0307415_100055032 | 3300032126 | Bacteria | 2720 |
| 252 | Ga0307415_100122564 | 3300032126 | Bacteria | 1952 |
| 253 | Ga0373938_0001256 | 3300034957 | Bacteria | 4076 |
| 254 | Ga0373929_0001057 | 3300035085 | Bacteria | 5343 |
| 255 | Ga0373940_0009762 | 3300035088 | Bacteria | 2240 |
| 256 | Ga0373952_0003426 | 3300035092 | Bacteria | 2862 |
| 257 | Ga0373932_0007922 | 3300035112 | Bacteria | 2536 |
| 258 | Ga0373941_0072111 | 3300035115 | Bacteria | 1148 |
| 259 | Ga0373960_0000062 | 3300035121 | Bacteria | 14949 |
| 260 | Ga0373960_0217389 | 3300035121 | Bacteria | 682 |
| 261 | Ga0373942_0001059 | 3300035207 | Bacteria | 7404 |
| 262 | Ga0373962_0000807 | 3300035242 | Bacteria | 7159 |
| 263 | Ga0373931_0003378 | 3300035691 | Bacteria | 7160 |
| 264 | Ga0373937_0119177 | 3300036401 | Bacteria | 2459 |
| 265 | Ga0395899_0004487 | 3300037312 | Bacteria | 10878 |
| 266 | Ga0395899_0027218 | 3300037312 | Bacteria | 4312 |
| 267 | Ga0395899_0030427 | 3300037312 | Bacteria | 4061 |
| 268 | Ga0395899_0042003 | 3300037312 | Bacteria | 3415 |
| 269 | Ga0395899_0051499 | 3300037312 | Bacteria | 3055 |
| 270 | Ga0395899_0083012 | 3300037312 | Bacteria | 2330 |
| 271 | Ga0395899_0173050 | 3300037312 | Bacteria | 1519 |
| 272 | Ga0395899_0260172 | 3300037312 | Bacteria | 1187 |
| 273 | Ga0395899_0274111 | 3300037312 | Bacteria | 1150 |
| 274 | Ga0395900_0003596 | 3300037418 | Bacteria | 16662 |
| 275 | Ga0395900_0004619 | 3300037418 | Bacteria | 14530 |
| 276 | Ga0395900_0005500 | 3300037418 | Bacteria | 13258 |
| 277 | Ga0395900_0006523 | 3300037418 | Bacteria | 12161 |
| 278 | Ga0395900_0007355 | 3300037418 | Bacteria | 11384 |
| 279 | Ga0395900_0013999 | 3300037418 | Bacteria | 8188 |
| 280 | Ga0395900_0022223 | 3300037418 | Bacteria | 6489 |
| 281 | Ga0395900_0063227 | 3300037418 | Bacteria | 3804 |
| 282 | Ga0395900_0067970 | 3300037418 | Bacteria | 3661 |
| 283 | Ga0395900_0101888 | 3300037418 | Bacteria | 2949 |
| 284 | Ga0395900_0122623 | 3300037418 | Unclassified | 2666 |
| 285 | Ga0395900_0149150 | 3300037418 | Bacteria | 2390 |
| 286 | Ga0395900_0309996 | 3300037418 | Bacteria | 1562 |
| 287 | Ga0395900_0392127 | 3300037418 | Unclassified | 1354 |
| 288 | Ga0395900_0649608 | 3300037418 | Bacteria | 991 |
| 289 | Ga0395900_0667236 | 3300037418 | Bacteria | 975 |
| 290 | Ga0395900_0822431 | 3300037418 | Bacteria | 856 |
| 291 | Ga0395898_0002928 | 3300037466 | Bacteria | 19413 |
| 292 | Ga0395898_0005497 | 3300037466 | Bacteria | 13684 |
| 293 | Ga0395898_0007699 | 3300037466 | Bacteria | 11437 |
| 294 | Ga0395898_0010458 | 3300037466 | Bacteria | 9701 |
| 295 | Ga0395898_0033721 | 3300037466 | Bacteria | 5107 |
| 296 | Ga0395898_0038499 | 3300037466 | Bacteria | 4738 |
| 297 | Ga0395898_0047144 | 3300037466 | Bacteria | 4230 |
| 298 | Ga0395898_0094226 | 3300037466 | Bacteria | 2878 |
| 299 | Ga0395898_0135769 | 3300037466 | Bacteria | 2355 |
| 300 | Ga0395898_0224913 | 3300037466 | Bacteria | 1790 |
| 301 | Ga0395898_0225700 | 3300037466 | Unclassified | 1786 |
| 302 | Ga0395898_0557624 | 3300037466 | Bacteria | 1088 |
| 303 | Ga0395898_0596639 | 3300037466 | Unclassified | 1047 |
| 304 | Ga0395898_0741998 | 3300037466 | Bacteria | 923 |
| 305 | Ga0395905_0000698 | 3300037471 | Bacteria | 44490 |
| 306 | Ga0395905_0004158 | 3300037471 | Bacteria | 15144 |
| 307 | Ga0395905_0006203 | 3300037471 | Bacteria | 12064 |
| 308 | Ga0395905_0008142 | 3300037471 | Bacteria | 10354 |
| 309 | Ga0395905_0014202 | 3300037471 | Bacteria | 7607 |
| 310 | Ga0395905_0024444 | 3300037471 | Bacteria | 5702 |
| 311 | Ga0395905_0057327 | 3300037471 | Unclassified | 3644 |
| 312 | Ga0395905_0058621 | 3300037471 | Bacteria | 3600 |
| 313 | Ga0395905_0077468 | 3300037471 | Bacteria | 3115 |
| 314 | Ga0395905_0107293 | 3300037471 | Bacteria | 2622 |
| 315 | Ga0395905_0136940 | 3300037471 | Bacteria | 2304 |
| 316 | Ga0395905_0209971 | 3300037471 | Bacteria | 1824 |
| 317 | Ga0395905_0254626 | 3300037471 | Bacteria | 1640 |
| 318 | Ga0395905_0361665 | 3300037471 | Bacteria | 1344 |
| 319 | Ga0395905_0513991 | 3300037471 | Bacteria | 1098 |
| 320 | Ga0395905_0599404 | 3300037471 | Bacteria | 1003 |
| 321 | Ga0395905_0677744 | 3300037471 | Unclassified | 933 |
| 322 | Ga0395905_0745391 | 3300037471 | Bacteria | 882 |
| 323 | Ga0395901_0002126 | 3300038443 | Bacteria | 20297 |
| 324 | Ga0395901_0002813 | 3300038443 | Bacteria | 17572 |
| 325 | Ga0395901_0007390 | 3300038443 | Bacteria | 11084 |
| 326 | Ga0395901_0008689 | 3300038443 | Bacteria | 10264 |
| 327 | Ga0395901_0009435 | 3300038443 | Bacteria | 9902 |
| 328 | Ga0395901_0027813 | 3300038443 | Bacteria | 5815 |
| 329 | Ga0395901_0028131 | 3300038443 | Bacteria | 5782 |
| 330 | Ga0395901_0032458 | 3300038443 | Bacteria | 5388 |
| 331 | Ga0395901_0036191 | 3300038443 | Bacteria | 5100 |
| 332 | Ga0395901_0063593 | 3300038443 | Bacteria | 3840 |
| 333 | Ga0395901_0080272 | 3300038443 | Unclassified | 3406 |
| 334 | Ga0395901_0151680 | 3300038443 | Bacteria | 2435 |
| 335 | Ga0395901_0262357 | 3300038443 | Bacteria | 1798 |
| 336 | Ga0395901_0266090 | 3300038443 | Bacteria | 1784 |
| 337 | Ga0395901_0294464 | 3300038443 | Bacteria | 1683 |
| 338 | Ga0395901_0302204 | 3300038443 | Bacteria | 1659 |
| 339 | Ga0395901_0329910 | 3300038443 | Bacteria | 1577 |
| 340 | Ga0395901_0342076 | 3300038443 | Unclassified | 1545 |
| 341 | Ga0395901_0411528 | 3300038443 | Bacteria | 1388 |
| 342 | Ga0395901_0592113 | 3300038443 | Bacteria | 1119 |
| 343 | Ga0395901_0605725 | 3300038443 | Bacteria | 1104 |
| 344 | Ga0395901_1133507 | 3300038443 | Bacteria | 751 |
| 345 | Ga0395901_1182824 | 3300038443 | Bacteria | 731 |
| 346 | Ga0439436_0071878 | 3300041404 | Bacteria | 964 |
| 347 | Ga0439438_034504 | 3300041405 | Bacteria | 1333 |
| 348 | Ga0439439_0008885 | 3300041406 | Bacteria | 2378 |
| 349 | Ga0439447_040774 | 3300041407 | Bacteria | 1132 |
| 350 | Ga0439466_0059627 | 3300041411 | Bacteria | 1232 |
| 351 | Ga0451793_0909242 | 3300041452 | Bacteria | 1491 |
| 352 | Ga0451798_0435415 | 3300041458 | Bacteria | 1522 |
| 353 | Ga0451806_265883 | 3300041462 | Bacteria | 1265 |
| 354 | Ga0451804_0258854 | 3300041463 | Bacteria | 1989 |
| 355 | Ga0451807_1638120 | 3300041486 | Bacteria | 3285 |
| 356 | Ga0451833_0945614 | 3300041491 | Bacteria | 678 |
| 357 | Ga0451835_0458117 | 3300041492 | Bacteria | 7337 |
| 358 | Ga0451839_0867368 | 3300041496 | Bacteria | 2688 |
| 359 | Ga0451845_0285290 | 3300041501 | Bacteria | 1637 |
| 360 | Ga0451847_0859819 | 3300041503 | Bacteria | 1380 |
| 361 | Ga0451849_0672773 | 3300041505 | Bacteria | 3169 |
| 362 | Ga0451851_0150755 | 3300041507 | Bacteria | 1893 |
| 363 | Ga0451853_0771226 | 3300041512 | Bacteria | 1415 |
| 364 | Ga0439431_0020842 | 3300041997 | Bacteria | 1569 |
| 365 | Ga0439433_0024227 | 3300041999 | Bacteria | 1366 |
| 366 | Ga0439445_0035206 | 3300042004 | Bacteria | 1314 |
| 367 | Ga0439445_0086121 | 3300042004 | Bacteria | 882 |
| 368 | Ga0439449_0072142 | 3300042007 | Bacteria | 1272 |
| 369 | Ga0439451_028786 | 3300042009 | Bacteria | 1119 |
| 370 | Ga0439452_039830 | 3300042010 | Bacteria | 1111 |
| 371 | Ga0450920_015488 | 3300042122 | Bacteria | 1450 |
| 372 | Ga0450920_066898 | 3300042122 | Bacteria | 729 |
| 373 | Ga0450896_050972 | 3300042133 | Bacteria | 660 |
| 374 | Ga0450907_008100 | 3300042146 | Bacteria | 1749 |
| 375 | Ga0439446_0000352 | 3300042156 | Bacteria | 8842 |
| 376 | Ga0439446_0000968 | 3300042156 | Bacteria | 6248 |
| 377 | Ga0439434_0023966 | 3300042435 | Bacteria | 1839 |
| 378 | Ga0439434_0031337 | 3300042435 | Bacteria | 1616 |
| 379 | Ga0439434_0100989 | 3300042435 | Bacteria | 929 |
| 380 | Ga0439434_0112733 | 3300042435 | Bacteria | 882 |
| 381 | Ga0466965_0151638 | 3300044683 | Bacteria | 1212 |
| 382 | Ga0466961_0074340 | 3300044693 | Bacteria | 2155 |
| 383 | Ga0466964_0005579 | 3300044706 | Bacteria | 4672 |
| 384 | Ga0466964_0252620 | 3300044706 | Bacteria | 870 |
| 385 | Ga0466960_0024247 | 3300044901 | Bacteria | 2735 |
| 386 | Ga0466960_0064320 | 3300044901 | Unclassified | 1808 |
| 387 | Ga0466967_0013271 | 3300045976 | Bacteria | 6356 |
| 388 | Ga0466967_0425937 | 3300045976 | Bacteria | 1294 |
| 389 | Ga0466967_0554363 | 3300045976 | Bacteria | 1131 |
| 390 | Ga0466967_1032325 | 3300045976 | Bacteria | 819 |
| 391 | Ga0495592_0214220 | 3300046454 | Bacteria | 1292 |
| 392 | Ga0495603_0042086 | 3300046455 | Bacteria | 2731 |
| 393 | Ga0495603_0284712 | 3300046455 | Bacteria | 950 |
| 394 | Ga0495641_0051480 | 3300046461 | Unclassified | 1880 |
| 395 | Ga0495641_0204702 | 3300046461 | Bacteria | 885 |
| 396 | Ga0495651_0163268 | 3300046462 | Bacteria | 1594 |
| 397 | Ga0495651_0444441 | 3300046462 | Bacteria | 839 |
| 398 | Ga0495653_0147862 | 3300046463 | Bacteria | 1645 |
| 399 | Ga0495653_0321448 | 3300046463 | Bacteria | 1003 |
| 400 | Ga0495582_0014637 | 3300046473 | Bacteria | 4309 |
| 401 | Ga0495605_0081869 | 3300046474 | Bacteria | 1509 |
| 402 | Ga0495639_0100781 | 3300046475 | Bacteria | 1363 |
| 403 | Ga0495664_0321011 | 3300046477 | Bacteria | 934 |
| 404 | Ga0495584_0027475 | 3300046491 | Bacteria | 2884 |
| 405 | Ga0495594_0096007 | 3300046499 | Bacteria | 1665 |
| 406 | Ga0495596_0202349 | 3300046500 | Bacteria | 771 |
| 407 | Ga0495607_0196640 | 3300046501 | Bacteria | 1001 |
| 408 | Ga0495583_0120521 | 3300046506 | Unclassified | 1105 |
| 409 | Ga0495608_0052876 | 3300046511 | Bacteria | 2688 |
| 410 | Ga0495628_0034233 | 3300046516 | Bacteria | 4088 |
| 411 | Ga0495630_0067437 | 3300046517 | Bacteria | 2690 |
| 412 | Ga0495630_0111430 | 3300046517 | Bacteria | 2073 |
| 413 | Ga0495637_0211199 | 3300046520 | Bacteria | 710 |
| 414 | Ga0495637_0223383 | 3300046520 | Unclassified | 685 |
| 415 | Ga0495663_0014171 | 3300046525 | Bacteria | 2233 |
| 416 | Ga0495642_0024232 | 3300046528 | Bacteria | 2400 |
| 417 | Ga0495642_0194000 | 3300046528 | Bacteria | 885 |
| 418 | Ga0495652_0115298 | 3300046529 | Bacteria | 2153 |
| 419 | Ga0495665_0069709 | 3300046531 | Unclassified | 1853 |
| 420 | Ga0495609_0074215 | 3300046538 | Bacteria | 1492 |
| 421 | Ga0495667_0065192 | 3300046559 | Bacteria | 2383 |
| 422 | Ga0495667_0153584 | 3300046559 | Bacteria | 1482 |
| 423 | Ga0495667_0408786 | 3300046559 | Bacteria | 855 |
| 424 | Ga0495656_0145678 | 3300046615 | Bacteria | 1139 |
| 425 | Ga0495656_0177046 | 3300046615 | Unclassified | 1046 |
| 426 | Ga0495656_0225845 | 3300046615 | Bacteria | 938 |
| 427 | Ga0495656_0389845 | 3300046615 | Bacteria | 727 |
| 428 | Ga0495668_0330734 | 3300046616 | Unclassified | 836 |
| 429 | Ga0495611_0345389 | 3300046648 | Bacteria | 683 |
| 430 | Ga0495661_0052112 | 3300046665 | Bacteria | 2467 |
| 431 | Ga0495588_0070907 | 3300046674 | Bacteria | 1812 |
| 432 | Ga0495588_0142904 | 3300046674 | Bacteria | 1264 |
| 433 | Ga0495657_0090947 | 3300046675 | Bacteria | 1958 |
| 434 | Ga0495623_0191464 | 3300046679 | Unclassified | 1181 |
| 435 | Ga0495646_0386432 | 3300046680 | Bacteria | 729 |
| 436 | Ga0495647_0034228 | 3300046681 | Unclassified | 1902 |
| 437 | Ga0495658_0045851 | 3300046683 | Bacteria | 2455 |
| 438 | Ga0495613_0263525 | 3300046689 | Bacteria | 1200 |
| 439 | Ga0495670_0251292 | 3300046691 | Bacteria | 943 |
| 440 | Ga0495671_0135175 | 3300046692 | Bacteria | 1202 |
| 441 | Ga0495589_0032602 | 3300046794 | Bacteria | 2619 |
| 442 | Ga0495589_0066443 | 3300046794 | Bacteria | 1766 |
| 443 | Ga0495581_0003093 | 3300047315 | Bacteria | 9519 |
| 444 | Ga0495604_0025418 | 3300047317 | Bacteria | 4720 |
| 445 | Ga0495636_0036085 | 3300047318 | Unclassified | 2038 |
| 446 | Ga0495674_0111005 | 3300047319 | Bacteria | 2325 |
| 447 | Ga0495674_0138848 | 3300047319 | Bacteria | 2043 |
| 448 | Ga0495674_0189519 | 3300047319 | Bacteria | 1710 |
| 449 | Ga0495676_0069959 | 3300047321 | Bacteria | 2706 |
| 450 | Ga0495676_0280723 | 3300047321 | Bacteria | 1128 |
| 451 | Ga0495680_0365480 | 3300047322 | Unclassified | 1002 |
| 452 | Ga0495677_0143204 | 3300047445 | Unclassified | 918 |
| 453 | Ga0495602_0089688 | 3300048088 | Bacteria | 2556 |
| 454 | Ga0495614_0076400 | 3300048089 | Unclassified | 1448 |
| 455 | Ga0496100_0002226 | 3300048903 | Bacteria | 9793 |
| 456 | Ga0496100_0054615 | 3300048903 | Bacteria | 2606 |
| 457 | Ga0496100_0083793 | 3300048903 | Bacteria | 2159 |
| 458 | Ga0496100_0293278 | 3300048903 | Bacteria | 1216 |
| 459 | Ga0496100_0339082 | 3300048903 | Bacteria | 1133 |
| 460 | Ga0496101_0001928 | 3300048904 | Bacteria | 12558 |
| 461 | Ga0496101_0005286 | 3300048904 | Bacteria | 8221 |
| 462 | Ga0496101_0013807 | 3300048904 | Bacteria | 5421 |
| 463 | Ga0496101_0019074 | 3300048904 | Bacteria | 4674 |
| 464 | Ga0496101_0118996 | 3300048904 | Bacteria | 1995 |
| 465 | Ga0496101_0190319 | 3300048904 | Bacteria | 1583 |
| 466 | Ga0496102_0006057 | 3300048905 | Bacteria | 10307 |
| 467 | Ga0496102_0010580 | 3300048905 | Bacteria | 7946 |
| 468 | Ga0496102_0033148 | 3300048905 | Bacteria | 4641 |
| 469 | Ga0496102_0522575 | 3300048905 | Bacteria | 1109 |
| 470 | Ga0496102_0696565 | 3300048905 | Bacteria | 939 |
| 471 | Ga0496103_0006441 | 3300048906 | Bacteria | 7007 |
| 472 | Ga0496103_0008665 | 3300048906 | Bacteria | 6040 |
| 473 | Ga0496103_0010790 | 3300048906 | Bacteria | 5406 |
| 474 | Ga0496103_0056353 | 3300048906 | Bacteria | 2439 |
| 475 | Ga0496103_0468450 | 3300048906 | Bacteria | 807 |
| 476 | Ga0496104_0000566 | 3300048907 | Bacteria | 31603 |
| 477 | Ga0496104_0006802 | 3300048907 | Bacteria | 10074 |
| 478 | Ga0496104_0017549 | 3300048907 | Bacteria | 6520 |
| 479 | Ga0496104_0029418 | 3300048907 | Bacteria | 5096 |
| 480 | Ga0496104_0094453 | 3300048907 | Bacteria | 2861 |
| 481 | Ga0496104_0118170 | 3300048907 | Bacteria | 2545 |
| 482 | Ga0496105_0000834 | 3300048908 | Bacteria | 20972 |
| 483 | Ga0496105_0002560 | 3300048908 | Bacteria | 13204 |
| 484 | Ga0496105_0015288 | 3300048908 | Bacteria | 6112 |
| 485 | Ga0496105_0163882 | 3300048908 | Bacteria | 1824 |
| 486 | Ga0496105_0262249 | 3300048908 | Bacteria | 1397 |
| 487 | Ga0496105_0420958 | 3300048908 | Bacteria | 1057 |
| 488 | Ga0496106_0036103 | 3300048909 | Bacteria | 3697 |
| 489 | Ga0496106_0044813 | 3300048909 | Bacteria | 3322 |
| 490 | Ga0496106_0143988 | 3300048909 | Bacteria | 1876 |
| 491 | Ga0496106_0148405 | 3300048909 | Bacteria | 1848 |
| 492 | Ga0496106_0262834 | 3300048909 | Bacteria | 1381 |
| 493 | Ga0496106_0389173 | 3300048909 | Bacteria | 1120 |
| 494 | Ga0496106_0704912 | 3300048909 | Bacteria | 804 |
| 495 | Ga0496107_0004351 | 3300048910 | Bacteria | 9590 |
| 496 | Ga0496107_0013630 | 3300048910 | Bacteria | 5683 |
| 497 | Ga0496107_0058502 | 3300048910 | Bacteria | 2787 |
| 498 | Ga0496107_0084014 | 3300048910 | Bacteria | 2322 |
| 499 | Ga0496108_0000906 | 3300048911 | Bacteria | 23091 |
| 500 | Ga0496108_0003016 | 3300048911 | Bacteria | 13529 |
| 501 | Ga0496108_0030054 | 3300048911 | Bacteria | 4503 |
| 502 | Ga0496108_0039321 | 3300048911 | Bacteria | 3943 |
| 503 | Ga0496108_0314805 | 3300048911 | Bacteria | 1364 |
| 504 | Ga0496109_0000918 | 3300048912 | Bacteria | 24520 |
| 505 | Ga0496109_0004615 | 3300048912 | Bacteria | 11500 |
| 506 | Ga0496109_0010078 | 3300048912 | Bacteria | 8064 |
| 507 | Ga0496109_0015392 | 3300048912 | Bacteria | 6664 |
| 508 | Ga0496109_0159513 | 3300048912 | Bacteria | 2113 |
| 509 | Ga0496109_0223676 | 3300048912 | Bacteria | 1770 |
| 510 | Ga0496109_0255503 | 3300048912 | Unclassified | 1650 |
| 511 | Ga0496109_0433492 | 3300048912 | Bacteria | 1242 |
| 512 | Ga0496109_0480523 | 3300048912 | Bacteria | 1173 |
| 513 | Ga0496110_0000951 | 3300048913 | Bacteria | 20276 |
| 514 | Ga0496110_0000997 | 3300048913 | Bacteria | 19893 |
| 515 | Ga0496110_0019486 | 3300048913 | Bacteria | 5711 |
| 516 | Ga0496110_0062762 | 3300048913 | Bacteria | 3282 |
| 517 | Ga0496110_0765062 | 3300048913 | Bacteria | 869 |
| 518 | Ga0496111_0040361 | 3300048914 | Bacteria | 3348 |
| 519 | Ga0496111_0041864 | 3300048914 | Bacteria | 3288 |
| 520 | Ga0496111_0042712 | 3300048914 | Bacteria | 3256 |
| 521 | Ga0496111_0046058 | 3300048914 | Bacteria | 3139 |
| 522 | Ga0496111_0217071 | 3300048914 | Bacteria | 1421 |
| 523 | Ga0496112_0004731 | 3300048915 | Bacteria | 11598 |
| 524 | Ga0496112_0007006 | 3300048915 | Bacteria | 9953 |
| 525 | Ga0496112_0122351 | 3300048915 | Bacteria | 2573 |
| 526 | Ga0496112_0155896 | 3300048915 | Bacteria | 2250 |
| 527 | Ga0496112_0194551 | 3300048915 | Bacteria | 1989 |
| 528 | Ga0496112_0242081 | 3300048915 | Bacteria | 1756 |
| 529 | Ga0496112_0337181 | 3300048915 | Bacteria | 1451 |
| 530 | Ga0496112_0404062 | 3300048915 | Unclassified | 1305 |
| 531 | Ga0496112_0675388 | 3300048915 | Unclassified | 962 |
| 532 | Ga0496113_0058407 | 3300048916 | Bacteria | 2902 |
| 533 | Ga0496113_0108149 | 3300048916 | Bacteria | 2161 |
| 534 | Ga0496113_0383742 | 3300048916 | Bacteria | 1128 |
| 535 | Ga0496114_0000593 | 3300048917 | Bacteria | 26747 |
| 536 | Ga0496114_0025813 | 3300048917 | Bacteria | 4806 |
| 537 | Ga0496114_0040482 | 3300048917 | Bacteria | 3858 |
| 538 | Ga0496114_0088280 | 3300048917 | Bacteria | 2630 |
| 539 | Ga0496114_0137003 | 3300048917 | Bacteria | 2117 |
| 540 | Ga0496114_0406373 | 3300048917 | Bacteria | 1206 |
| 541 | Ga0496114_0689506 | 3300048917 | Bacteria | 896 |
| 542 | Ga0496114_0696934 | 3300048917 | Bacteria | 891 |
| 543 | Ga0496115_0002543 | 3300048918 | Bacteria | 13114 |
| 544 | Ga0496115_0002884 | 3300048918 | Bacteria | 12387 |
| 545 | Ga0496115_0019711 | 3300048918 | Bacteria | 5193 |
| 546 | Ga0496115_0125424 | 3300048918 | Bacteria | 2114 |
| 547 | Ga0496115_0137736 | 3300048918 | Bacteria | 2013 |
| 548 | Ga0501031_0000998 | 3300049568 | Bacteria | 17158 |
| 549 | Ga0501031_0001019 | 3300049568 | Bacteria | 16974 |
| 550 | Ga0501031_0117062 | 3300049568 | Bacteria | 1741 |
| 551 | Ga0501031_0236908 | 3300049568 | Bacteria | 1187 |
| 552 | Ga0501032_0013886 | 3300049569 | Bacteria | 5714 |
| 553 | Ga0501032_0033846 | 3300049569 | Unclassified | 3500 |
| 554 | Ga0501033_0000855 | 3300049570 | Bacteria | 27840 |
| 555 | Ga0501033_0009029 | 3300049570 | Bacteria | 7690 |
| 556 | Ga0501033_0010858 | 3300049570 | Bacteria | 6982 |
| 557 | Ga0501034_0142535 | 3300049571 | Bacteria | 2375 |
| 558 | Ga0501034_0306723 | 3300049571 | Bacteria | 1523 |
| 559 | Ga0501036_0001208 | 3300049572 | Bacteria | 19722 |
| 560 | Ga0501036_0004219 | 3300049572 | Bacteria | 11588 |
| 561 | Ga0501036_0016938 | 3300049572 | Bacteria | 6088 |
| 562 | Ga0501036_0073912 | 3300049572 | Bacteria | 2882 |
| 563 | Ga0501037_0003662 | 3300049573 | Bacteria | 11151 |
| 564 | Ga0501037_0041373 | 3300049573 | Bacteria | 3389 |
| 565 | Ga0501037_0076955 | 3300049573 | Unclassified | 2421 |
| 566 | Ga0501038_0006057 | 3300049574 | Bacteria | 11187 |
| 567 | Ga0501038_0006640 | 3300049574 | Bacteria | 10701 |
| 568 | Ga0501038_0064002 | 3300049574 | Bacteria | 3137 |
| 569 | Ga0501039_0005133 | 3300049575 | Bacteria | 9922 |
| 570 | Ga0501039_0007966 | 3300049575 | Bacteria | 8070 |
| 571 | Ga0501039_0047840 | 3300049575 | Bacteria | 3306 |
| 572 | Ga0501039_0144984 | 3300049575 | Unclassified | 1866 |
| 573 | Ga0501040_0012142 | 3300049576 | Bacteria | 5641 |
| 574 | Ga0501040_0025256 | 3300049576 | Bacteria | 3994 |
| 575 | Ga0501040_0057094 | 3300049576 | Bacteria | 2679 |
| 576 | Ga0501040_0064620 | 3300049576 | Bacteria | 2519 |
| 577 | Ga0501040_0075534 | 3300049576 | Bacteria | 2329 |
| 578 | Ga0501040_0114582 | 3300049576 | Bacteria | 1887 |
| 579 | Ga0501040_0115581 | 3300049576 | Bacteria | 1878 |
| 580 | Ga0501041_0002466 | 3300049577 | Bacteria | 10514 |
| 581 | Ga0501041_0005018 | 3300049577 | Bacteria | 7708 |
| 582 | Ga0501041_0005652 | 3300049577 | Bacteria | 7306 |
| 583 | Ga0501041_0007796 | 3300049577 | Bacteria | 6289 |
| 584 | Ga0501041_0300526 | 3300049577 | Bacteria | 1011 |
| 585 | Ga0501041_0332190 | 3300049577 | Bacteria | 959 |
| 586 | Ga0501041_0345098 | 3300049577 | Bacteria | 940 |
| 587 | Ga0501042_0002378 | 3300049578 | Bacteria | 11530 |
| 588 | Ga0501042_0006859 | 3300049578 | Bacteria | 7432 |
| 589 | Ga0501042_0016392 | 3300049578 | Bacteria | 5084 |
| 590 | Ga0501042_0046164 | 3300049578 | Bacteria | 3105 |
| 591 | Ga0501042_0076123 | 3300049578 | Bacteria | 2402 |
| 592 | Ga0501042_0249093 | 3300049578 | Bacteria | 1282 |
| 593 | Ga0501042_0705699 | 3300049578 | Bacteria | 733 |
| 594 | Ga0501043_0004119 | 3300049579 | Bacteria | 11873 |
| 595 | Ga0501043_0011981 | 3300049579 | Bacteria | 6784 |
| 596 | Ga0501046_0002825 | 3300049580 | Bacteria | 16174 |
| 597 | Ga0501046_0014190 | 3300049580 | Bacteria | 6730 |
| 598 | Ga0501046_0053824 | 3300049580 | Bacteria | 3168 |
| 599 | Ga0501046_0071932 | 3300049580 | Bacteria | 2685 |
| 600 | Ga0501046_0074670 | 3300049580 | Bacteria | 2630 |
| 601 | Ga0501047_0065881 | 3300049581 | Bacteria | 3491 |
| 602 | Ga0501047_0170617 | 3300049581 | Unclassified | 2044 |
| 603 | Ga0501048_0011154 | 3300049582 | Bacteria | 6699 |
| 604 | Ga0501048_0051025 | 3300049582 | Bacteria | 2945 |
| 605 | Ga0501048_0058201 | 3300049582 | Bacteria | 2739 |
| 606 | Ga0501048_0069000 | 3300049582 | Bacteria | 2497 |
| 607 | Ga0501067_0038822 | 3300049583 | Bacteria | 2643 |
| 608 | Ga0501068_0000148 | 3300049584 | Bacteria | 32186 |
| 609 | Ga0501068_0021240 | 3300049584 | Bacteria | 3789 |
| 610 | Ga0501068_0080211 | 3300049584 | Bacteria | 2002 |
| 611 | Ga0501068_0257754 | 3300049584 | Bacteria | 1112 |
| 612 | Ga0501069_0010320 | 3300049585 | Bacteria | 4943 |
| 613 | Ga0501069_0013565 | 3300049585 | Bacteria | 4345 |
| 614 | Ga0501069_0046825 | 3300049585 | Bacteria | 2399 |
| 615 | Ga0501069_0357385 | 3300049585 | Archaea | 861 |
| 616 | Ga0501070_0003232 | 3300049586 | Bacteria | 14177 |
| 617 | Ga0501070_0003933 | 3300049586 | Bacteria | 12809 |
| 618 | Ga0501070_0090349 | 3300049586 | Bacteria | 2535 |
| 619 | Ga0501070_0140387 | 3300049586 | Unclassified | 1995 |
| 620 | Ga0501070_0225261 | 3300049586 | Bacteria | 1537 |
| 621 | Ga0501071_0002533 | 3300049587 | Bacteria | 11119 |
| 622 | Ga0501071_0011669 | 3300049587 | Bacteria | 5930 |
| 623 | Ga0501071_0019089 | 3300049587 | Bacteria | 4757 |
| 624 | Ga0501071_0102503 | 3300049587 | Bacteria | 2110 |
| 625 | Ga0501071_0184525 | 3300049587 | Unclassified | 1563 |
| 626 | Ga0501071_0353138 | 3300049587 | Bacteria | 1119 |
| 627 | Ga0501072_0001504 | 3300049588 | Bacteria | 17456 |
| 628 | Ga0501072_0033122 | 3300049588 | Bacteria | 4048 |
| 629 | Ga0501072_0045409 | 3300049588 | Bacteria | 3454 |
| 630 | Ga0501072_0295577 | 3300049588 | Bacteria | 1287 |
| 631 | Ga0501072_0298983 | 3300049588 | Bacteria | 1279 |
| 632 | Ga0501072_0361378 | 3300049588 | Bacteria | 1152 |
| 633 | Ga0501072_0502206 | 3300049588 | Unclassified | 959 |
| 634 | Ga0501072_0894668 | 3300049588 | Bacteria | 694 |
| 635 | Ga0501073_0001011 | 3300049589 | Bacteria | 20308 |
| 636 | Ga0501073_0002391 | 3300049589 | Bacteria | 14041 |
| 637 | Ga0501073_0176828 | 3300049589 | Bacteria | 1477 |
| 638 | Ga0501074_0005272 | 3300049590 | Bacteria | 9306 |
| 639 | Ga0501074_0005793 | 3300049590 | Bacteria | 8913 |
| 640 | Ga0501074_0038937 | 3300049590 | Bacteria | 3443 |
| 641 | Ga0501074_0067160 | 3300049590 | Bacteria | 2579 |
| 642 | Ga0501074_0500150 | 3300049590 | Bacteria | 861 |
| 643 | Ga0501075_0007514 | 3300049591 | Bacteria | 7559 |
| 644 | Ga0501075_0015620 | 3300049591 | Bacteria | 5450 |
| 645 | Ga0501075_0034637 | 3300049591 | Bacteria | 3760 |
| 646 | Ga0501075_0112681 | 3300049591 | Bacteria | 2068 |
| 647 | Ga0501076_0017659 | 3300049592 | Bacteria | 5423 |
| 648 | Ga0501076_0021757 | 3300049592 | Bacteria | 4922 |
| 649 | Ga0501076_0095098 | 3300049592 | Bacteria | 2399 |
| 650 | Ga0501076_0109854 | 3300049592 | Bacteria | 2229 |
| 651 | Ga0501076_0113070 | 3300049592 | Bacteria | 2196 |
| 652 | Ga0501076_0129954 | 3300049592 | Bacteria | 2042 |
| 653 | Ga0501077_0019023 | 3300049593 | Bacteria | 4342 |
| 654 | Ga0501077_0023456 | 3300049593 | Bacteria | 3914 |
| 655 | Ga0501077_0033890 | 3300049593 | Bacteria | 3250 |
| 656 | Ga0501077_0303792 | 3300049593 | Unclassified | 1017 |
| 657 | Ga0501079_0003411 | 3300049741 | Bacteria | 11671 |
| 658 | Ga0501079_0033900 | 3300049741 | Bacteria | 3927 |
| 659 | Ga0501079_0042817 | 3300049741 | Bacteria | 3496 |
| 660 | Ga0501079_0188978 | 3300049741 | Unclassified | 1607 |
| 661 | Ga0501080_0103269 | 3300049742 | Bacteria | 2643 |
| 662 | Ga0501080_0168680 | 3300049742 | Unclassified | 2019 |
| 663 | Ga0501080_0332773 | 3300049742 | Bacteria | 1373 |
| 664 | Ga0501080_0535774 | 3300049742 | Bacteria | 1044 |
| 665 | Ga0501080_0933246 | 3300049742 | Bacteria | 755 |
| 666 | Ga0501080_1218056 | 3300049742 | Bacteria | 647 |
| 667 | Ga0501081_0006202 | 3300049743 | Bacteria | 7745 |
| 668 | Ga0501081_0009330 | 3300049743 | Bacteria | 6392 |
| 669 | Ga0501081_0045782 | 3300049743 | Bacteria | 3004 |
| 670 | Ga0501081_0077948 | 3300049743 | Bacteria | 2316 |
| 671 | Ga0501081_0181236 | 3300049743 | Bacteria | 1524 |
| 672 | Ga0501081_0316093 | 3300049743 | Bacteria | 1147 |
| 673 | Ga0501081_0401045 | 3300049743 | Bacteria | 1015 |
| 674 | Ga0501081_0821299 | 3300049743 | Bacteria | 700 |
| 675 | Ga0501083_0004800 | 3300049744 | Bacteria | 9552 |
| 676 | Ga0501083_0006150 | 3300049744 | Bacteria | 8518 |
| 677 | Ga0501083_0420851 | 3300049744 | Bacteria | 869 |
| 678 | Ga0501035_0002064 | 3300049822 | Bacteria | 19991 |
| 679 | Ga0501035_0009792 | 3300049822 | Bacteria | 8905 |
| 680 | Ga0501035_0013032 | 3300049822 | Bacteria | 7673 |
| 681 | Ga0501044_0136261 | 3300049823 | Bacteria | 2446 |
| 682 | Ga0501044_0183173 | 3300049823 | Unclassified | 2060 |
| 683 | Ga0501044_0286127 | 3300049823 | Bacteria | 1581 |
| 684 | Ga0501045_0000761 | 3300049824 | Bacteria | 20641 |
| 685 | Ga0501045_0000918 | 3300049824 | Bacteria | 19240 |
| 686 | Ga0501045_0166039 | 3300049824 | Unclassified | 1644 |
| 687 | nmdc:mga0yw44_62906_c1 | 3300050492 | Bacteria | 2280 |
| 688 | nmdc:mga0yw44_87676_c1 | 3300050492 | Bacteria | 1962 |
| 689 | nmdc:mga06z11_439914_c1 | 3300050494 | Unclassified | 787 |
| 690 | nmdc:mga05p37_110941_c1 | 3300050507 | Bacteria | 3374 |
| 691 | nmdc:mga05p37_420276_c1 | 3300050507 | Unclassified | 1556 |
| 692 | nmdc:mga05p37_530307_c1 | 3300050507 | Bacteria | 1345 |
| 693 | nmdc:mga05p37_55907_c1 | 3300050507 | Bacteria | 4859 |
| 694 | nmdc:mga05p37_747892_c1 | 3300050507 | Bacteria | 1078 |
| 695 | nmdc:mga06r32_83319_c1 | 3300050510 | Bacteria | 3116 |
| 696 | nmdc:mga08y16_126264_c1 | 3300050511 | Bacteria | 2661 |
| 697 | nmdc:mga08y16_210428_c1 | 3300050511 | Bacteria | 2014 |
| 698 | nmdc:mga08y16_238451_c1 | 3300050511 | Unclassified | 1880 |
| 699 | nmdc:mga08y16_245742_c1 | 3300050511 | Bacteria | 1849 |
| 700 | nmdc:mga08y16_27968_c1 | 3300050511 | Bacteria | 5944 |
| 701 | nmdc:mga08y16_39726_c1 | 3300050511 | Bacteria | 4935 |
| 702 | nmdc:mga08y16_872413_c1 | 3300050511 | Bacteria | 888 |
| 703 | nmdc:mga0n895_113056_c1 | 3300050512 | Bacteria | 2732 |
| 704 | nmdc:mga0n895_1215325_c1 | 3300050512 | Unclassified | 727 |
| 705 | nmdc:mga0n895_183249_c1 | 3300050512 | Bacteria | 2125 |
| 706 | nmdc:mga0n895_72129_c1 | 3300050512 | Bacteria | 3426 |
| 707 | nmdc:mga0rr50_158996_c1 | 3300050513 | Bacteria | 1833 |
| 708 | nmdc:mga0rr50_329453_c1 | 3300050513 | Bacteria | 1282 |
| 709 | nmdc:mga0rr50_43767_c1 | 3300050513 | Bacteria | 3280 |
| 710 | nmdc:mga0rr50_56657_c1 | 3300050513 | Bacteria | 2929 |
| 711 | nmdc:mga0rr50_599508_c1 | 3300050513 | Bacteria | 939 |
| 712 | nmdc:mga08x19_28961_c1 | 3300050514 | Bacteria | 3473 |
| 713 | nmdc:mga08x19_30095_c1 | 3300050514 | Bacteria | 3409 |
| 714 | nmdc:mga08x19_42636_c1 | 3300050514 | Bacteria | 2894 |
| 715 | nmdc:mga0a205_104359_c1 | 3300050515 | Bacteria | 2734 |
| 716 | nmdc:mga0a205_14592_c1 | 3300050515 | Bacteria | 7333 |
| 717 | nmdc:mga0a205_27453_c1 | 3300050515 | Bacteria | 5437 |
| 718 | Ga0495601_0307188 | 3300053077 | Unclassified | 1033 |
| 719 | Ga0495612_0035415 | 3300053078 | Bacteria | 2024 |
| 720 | Ga0495595_0030536 | 3300053084 | Bacteria | 2418 |
| 721 | Ga0495619_0280102 | 3300053085 | Bacteria | 1155 |
| 722 | Ga0501084_0002075 | 3300054114 | Bacteria | 15994 |
| 723 | Ga0501084_0017188 | 3300054114 | Bacteria | 6009 |
| 724 | Ga0501084_0044531 | 3300054114 | Bacteria | 3715 |
| 725 | Ga0501084_0049638 | 3300054114 | Bacteria | 3512 |
| 726 | Ga0501084_0083608 | 3300054114 | Bacteria | 2679 |
| 727 | Ga0501084_0092396 | 3300054114 | Bacteria | 2540 |
| 728 | Ga0501084_0126225 | 3300054114 | Bacteria | 2153 |
| 729 | Ga0501084_0177581 | 3300054114 | Bacteria | 1797 |
| 730 | Ga0501084_0433099 | 3300054114 | Bacteria | 1112 |
| 731 | Ga0590071_074770 | 3300059421 | Bacteria | 838 |
| 732 | Ga0590077_025113 | 3300059426 | Bacteria | 1282 |
| 733 | Ga0501082_0001530 | 3300060353 | Bacteria | 20348 |
| 734 | Ga0501082_0010704 | 3300060353 | Bacteria | 7896 |
| 735 | Ga0501082_0032701 | 3300060353 | Bacteria | 4487 |
| 736 | Ga0501082_0183510 | 3300060353 | Bacteria | 1820 |
| 737 | Ga0501082_0190258 | 3300060353 | Bacteria | 1785 |
| 738 | Ga0530510_0018892 | 3300061734 | Bacteria | 4888 |
| 739 | Ga0530510_0025098 | 3300061734 | Bacteria | 4261 |
| 740 | Ga0530510_0044723 | 3300061734 | Bacteria | 3200 |
| 741 | Ga0530510_0167983 | 3300061734 | Bacteria | 1625 |
| 742 | Ga0530510_0168585 | 3300061734 | Unclassified | 1621 |
| 743 | Ga0530510_0289046 | 3300061734 | Unclassified | 1225 |
| 744 | Ga0530510_0377076 | 3300061734 | Bacteria | 1067 |
| 745 | Ga0068865_100318422 | |||
| 746 | JGI25407J50210_10001359 | |||
| 747 | Ga0068869_100549747 | |||
| 748 | Ga0070680_100027894 | |||
| 749 | Ga0070682_100088246 | |||
| 750 | Ga0068868_100147955 | |||
| 751 | Ga0070692_10372736 | |||
| 752 | Ga0070692_10410583 | |||
| 753 | Ga0070668_100207419 | |||
| 754 | Ga0070671_100093071 | |||
| 755 | Ga0070671_100332722 | |||
| 756 | Ga0070674_100065328 | |||
| 757 | Ga0070673_100092341 | |||
| 758 | Ga0070673_100172073 | |||
| 759 | Ga0070659_100347994 | |||
| 760 | Ga0070667_100061744 | |||
| 761 | Ga0070703_10001626 | |||
| 762 | Ga0070709_10046599 | |||
| 763 | Ga0070709_10046683 | |||
| 764 | Ga0070714_100068582 | |||
| 765 | Ga0070713_100067930 | |||
| 766 | Ga0070710_10023408 | |||
| 767 | Ga0070710_10024938 | |||
| 768 | Ga0070710_10035004 | |||
| 769 | Ga0070711_100226956 | |||
| 770 | Ga0070705_100016464 | |||
| 771 | Ga0070705_100179430 | |||
| 772 | Ga0070705_100270778 | |||
| 773 | Ga0070700_100173972 | |||
| 774 | Ga0070694_100054704 | |||
| 775 | Ga0070708_100060847 | |||
| 776 | Ga0070708_100062644 | |||
| 777 | Ga0070708_100076236 | |||
| 778 | Ga0070708_100183403 | |||
| 779 | Ga0070708_100704289 | |||
| 780 | Ga0070678_100424800 | |||
| 781 | Ga0070662_100293717 | |||
| 782 | Ga0070681_10002438 | |||
| 783 | Ga0070681_10751172 | |||
| 784 | Ga0070685_10217194 | |||
| 785 | Ga0070706_100005941 | |||
| 786 | Ga0070706_100009560 | |||
| 787 | Ga0070706_100094643 | |||
| 788 | Ga0070706_100364819 | |||
| 789 | Ga0070707_100001334 | |||
| 790 | Ga0070707_100002726 | |||
| 791 | Ga0070707_100043625 | |||
| 792 | Ga0070707_100057163 | |||
| 793 | Ga0070698_100010130 | |||
| 794 | Ga0070698_100032297 | |||
| 795 | Ga0070698_100043922 | |||
| 796 | Ga0070698_100107819 | |||
| 797 | Ga0070699_100047689 | |||
| 798 | Ga0070699_100090373 | |||
| 799 | Ga0070699_100128307 | |||
| 800 | Ga0070699_100538361 | |||
| 801 | Ga0070699_100601127 | |||
| 802 | Ga0070679_100035588 | |||
| 803 | Ga0070684_100000999 | |||
| 804 | Ga0070697_100031410 | |||
| 805 | Ga0070697_100053435 | |||
| 806 | Ga0070697_100372039 | |||
| 807 | Ga0070697_100426680 | |||
| 808 | Ga0070686_100088858 | |||
| 809 | Ga0070695_100019044 | |||
| 810 | Ga0070695_100091435 | |||
| 811 | Ga0070695_100328745 | |||
| 812 | Ga0070696_100091837 | |||
| 813 | Ga0070693_100194067 | |||
| 814 | Ga0070704_100026128 | |||
| 815 | Ga0070704_100088723 | |||
| 816 | Ga0068855_100485342 | |||
| 817 | Ga0070702_100014234 | |||
| 818 | Ga0068864_100521808 | |||
| 819 | Ga0068866_10208062 | |||
| 820 | Ga0068861_100753961 | |||
| 821 | Ga0081455_10076753 | |||
| 822 | Ga0081455_10348696 | |||
| 823 | Ga0081538_10000108 | |||
| 824 | Ga0081538_10005692 | |||
| 825 | Ga0081539_10001930 | |||
| 826 | Ga0081539_10002329 | |||
| 827 | Ga0081539_10007217 | |||
| 828 | Ga0070717_10031572 | |||
| 829 | Ga0075432_10049443 | |||
| 830 | Ga0070715_10020292 | |||
| 831 | Ga0070715_10034625 | |||
| 832 | Ga0070716_100062590 | |||
| 833 | Ga0070716_100094648 | |||
| 834 | Ga0070716_100300928 | |||
| 835 | Ga0070712_100001584 | |||
| 836 | Ga0070712_100010323 | |||
| 837 | Ga0070712_100415287 | |||
| 838 | Ga0075367_10279676 | |||
| 839 | Ga0068871_100040544 | |||
| 840 | Ga0075428_100191176 | |||
| 841 | Ga0075431_100040366 | |||
| 842 | Ga0075433_10012724 | |||
| 843 | Ga0075433_10022462 | |||
| 844 | Ga0075433_10027727 | |||
| 845 | Ga0075433_10045735 | |||
| 846 | Ga0075434_100015007 | |||
| 847 | Ga0075434_100101742 | |||
| 848 | Ga0075434_100116801 | |||
| 849 | Ga0075434_101466802 | |||
| 850 | Ga0068865_100178702 | |||
| 851 | Ga0075436_100009506 | |||
| 852 | Ga0075436_100014894 | |||
| 853 | Ga0075436_100106096 | |||
| 854 | Ga0075436_100230056 | |||
| 855 | Ga0075435_100018555 | |||
| 856 | Ga0075435_100068139 | |||
| 857 | Ga0075435_100273561 | |||
| 858 | Ga0105240_11096606 | |||
| 859 | Ga0111539_10025172 | |||
| 860 | Ga0111539_10046599 | |||
| 861 | Ga0111539_10046900 | |||
| 862 | Ga0111539_10159063 | |||
| 863 | Ga0111539_10249907 | |||
| 864 | Ga0111539_10345196 | |||
| 865 | Ga0111539_10882667 | |||
| 866 | Ga0111539_11196939 | |||
| 867 | Ga0105245_10015305 | |||
| 868 | Ga0105245_10023866 | |||
| 869 | Ga0105245_10075383 | |||
| 870 | Ga0105245_10229710 | |||
| 871 | Ga0105245_10261762 | |||
| 872 | Ga0105245_10424012 | |||
| 873 | Ga0105247_10155882 | |||
| 874 | Ga0114129_10014214 | |||
| 875 | Ga0114129_10043890 | |||
| 876 | Ga0114129_10052066 | |||
| 877 | Ga0114129_10082099 | |||
| 878 | Ga0114129_10208334 | |||
| 879 | Ga0114129_10443153 | |||
| 880 | Ga0114129_10540901 | |||
| 881 | Ga0105243_10012521 | |||
| 882 | Ga0105243_10032390 | |||
| 883 | Ga0105243_10134757 | |||
| 884 | Ga0105243_10521530 | |||
| 885 | Ga0105241_10049511 | |||
| 886 | Ga0105241_10072313 | |||
| 887 | Ga0105242_10094388 | |||
| 888 | Ga0105242_10406407 | |||
| 889 | Ga0105242_10658165 | |||
| 890 | Ga0105242_10737529 | |||
| 891 | Ga0105248_10037171 | |||
| 892 | Ga0105248_10403846 | |||
| 893 | Ga0105237_10623815 | |||
| 894 | Ga0105238_10159235 | |||
| 895 | Ga0105238_10459722 | |||
| 896 | Ga0105249_10008550 | |||
| 897 | Ga0105249_10526487 | |||
| 898 | Ga0105239_10032166 | |||
| 899 | Ga0105239_10123880 | |||
| 900 | Ga0105246_10263965 | |||
| 901 | Ga0157373_10464043 | |||
| 902 | Ga0157374_10228958 | |||
| 903 | Ga0157374_11121941 | |||
| 904 | Ga0157378_10007435 | |||
| 905 | Ga0157378_10075204 | |||
| 906 | Ga0163162_10004079 | |||
| 907 | Ga0163162_10748857 | |||
| 908 | Ga0163162_10785427 | |||
| 909 | Ga0157372_10523582 | |||
| 910 | Ga0157372_11889507 | |||
| 911 | Ga0157375_10021031 | |||
| 912 | Ga0157375_10392474 | |||
| 913 | Ga0157380_10013152 | |||
| 914 | Ga0157380_10149391 | |||
| 915 | Ga0157380_10873862 | |||
| 916 | Ga0157377_10000547 | |||
| 917 | Ga0157377_10044489 | |||
| 918 | Ga0157379_10077823 | |||
| 919 | Ga0157376_10091996 | |||
| 920 | Ga0157376_10092560 | |||
| 921 | Ga0157376_10613597 | |||
| 922 | Ga0163161_10460549 | |||
| 923 | Ga0206352_10068228 | |||
| 924 | Ga0207653_10000490 | |||
| 925 | Ga0207692_10006369 | |||
| 926 | Ga0207692_10421873 | |||
| 927 | Ga0207688_10022234 | |||
| 928 | Ga0207685_10005258 | |||
| 929 | Ga0207699_10011479 | |||
| 930 | Ga0207699_10080045 | |||
| 931 | Ga0207643_10402908 | |||
| 932 | Ga0207684_10046295 | |||
| 933 | Ga0207684_10064119 | |||
| 934 | Ga0207684_10194921 | |||
| 935 | Ga0207684_10235131 | |||
| 936 | Ga0207684_10320056 | |||
| 937 | Ga0207654_10324926 | |||
| 938 | Ga0207707_10001682 | |||
| 939 | Ga0207707_10641581 | |||
| 940 | Ga0207693_10001093 | |||
| 941 | Ga0207693_10018089 | |||
| 942 | Ga0207693_10104597 | |||
| 943 | Ga0207663_10163256 | |||
| 944 | Ga0207663_10207937 | |||
| 945 | Ga0207657_10292117 | |||
| 946 | Ga0207657_10677980 | |||
| 947 | Ga0207652_10023045 | |||
| 948 | Ga0207652_10570240 | |||
| 949 | Ga0207646_10004284 | |||
| 950 | Ga0207646_10028310 | |||
| 951 | Ga0207646_10112975 | |||
| 952 | Ga0207646_10152081 | |||
| 953 | Ga0207694_10365000 | |||
| 954 | Ga0207659_10413259 | |||
| 955 | Ga0207687_10731367 | |||
| 956 | Ga0207700_10321308 | |||
| 957 | Ga0207644_10435966 | |||
| 958 | Ga0207690_10297131 | |||
| 959 | Ga0207706_10352984 | |||
| 960 | Ga0207686_10185443 | |||
| 961 | Ga0207686_10804583 | |||
| 962 | Ga0207709_10131623 | |||
| 963 | Ga0207709_10286704 | |||
| 964 | Ga0207704_10502029 | |||
| 965 | Ga0207704_10774874 | |||
| 966 | Ga0207665_10006442 | |||
| 967 | Ga0207665_10007933 | |||
| 968 | Ga0207665_10029397 | |||
| 969 | Ga0207689_10146278 | |||
| 970 | Ga0207661_10001078 | |||
| 971 | Ga0207679_10102638 | |||
| 972 | Ga0207651_10051831 | |||
| 973 | Ga0207668_10065393 | |||
| 974 | Ga0207640_10040028 | |||
| 975 | Ga0207640_10991361 | |||
| 976 | Ga0207678_10115142 | |||
| 977 | Ga0207678_10516160 | |||
| 978 | Ga0207708_10280714 | |||
| 979 | Ga0207702_10036442 | |||
| 980 | Ga0207676_11217205 | |||
| 981 | Ga0207675_100012199 | |||
| 982 | Ga0207675_100564647 | |||
| 983 | Ga0207683_10005713 | |||
| 984 | Ga0207683_10018838 | |||
| 985 | Ga0207428_10011431 | |||
| 986 | Ga0207428_10218953 | |||
| 987 | Ga0207428_10387637 | |||
| 988 | Ga0268266_10931819 | |||
| 989 | Ga0307405_10249346 | |||
| 990 | Ga0307412_10336352 | |||
| 991 | Ga0307409_100152639 | |||
| 992 | Ga0307416_100022997 | |||
| 993 | Ga0307416_100502623 | |||
| 994 | Ga0307416_101281646 | |||
| 995 | Ga0307415_100055032 | |||
| 996 | Ga0307415_100122564 | |||
| 997 | Ga0373938_0001256 | |||
| 998 | Ga0373929_0001057 | |||
| 999 | Ga0373940_0009762 | |||
| 1000 | Ga0373952_0003426 | |||
| 1001 | Ga0373932_0007922 | |||
| 1002 | Ga0373941_0072111 | |||
| 1003 | Ga0373960_0000062 | |||
| 1004 | Ga0373960_0217389 | |||
| 1005 | Ga0373942_0001059 | |||
| 1006 | Ga0373962_0000807 | |||
| 1007 | Ga0373931_0003378 | |||
| 1008 | Ga0373937_0119177 | |||
| 1009 | Ga0395899_0004487 | |||
| 1010 | Ga0395899_0027218 | |||
| 1011 | Ga0395899_0030427 | |||
| 1012 | Ga0395899_0042003 | |||
| 1013 | Ga0395899_0051499 | |||
| 1014 | Ga0395899_0083012 | |||
| 1015 | Ga0395899_0173050 | |||
| 1016 | Ga0395899_0260172 | |||
| 1017 | Ga0395899_0274111 | |||
| 1018 | Ga0395900_0003596 | |||
| 1019 | Ga0395900_0004619 | |||
| 1020 | Ga0395900_0005500 | |||
| 1021 | Ga0395900_0006523 | |||
| 1022 | Ga0395900_0007355 | |||
| 1023 | Ga0395900_0013999 | |||
| 1024 | Ga0395900_0022223 | |||
| 1025 | Ga0395900_0063227 | |||
| 1026 | Ga0395900_0067970 | |||
| 1027 | Ga0395900_0101888 | |||
| 1028 | Ga0395900_0122623 | |||
| 1029 | Ga0395900_0149150 | |||
| 1030 | Ga0395900_0309996 | |||
| 1031 | Ga0395900_0392127 | |||
| 1032 | Ga0395900_0649608 | |||
| 1033 | Ga0395900_0667236 | |||
| 1034 | Ga0395900_0822431 | |||
| 1035 | Ga0395898_0002928 | |||
| 1036 | Ga0395898_0005497 | |||
| 1037 | Ga0395898_0007699 | |||
| 1038 | Ga0395898_0010458 | |||
| 1039 | Ga0395898_0033721 | |||
| 1040 | Ga0395898_0038499 | |||
| 1041 | Ga0395898_0047144 | |||
| 1042 | Ga0395898_0094226 | |||
| 1043 | Ga0395898_0135769 | |||
| 1044 | Ga0395898_0224913 | |||
| 1045 | Ga0395898_0225700 | |||
| 1046 | Ga0395898_0557624 | |||
| 1047 | Ga0395898_0596639 | |||
| 1048 | Ga0395898_0741998 | |||
| 1049 | Ga0395905_0000698 | |||
| 1050 | Ga0395905_0004158 | |||
| 1051 | Ga0395905_0006203 | |||
| 1052 | Ga0395905_0008142 | |||
| 1053 | Ga0395905_0014202 | |||
| 1054 | Ga0395905_0024444 | |||
| 1055 | Ga0395905_0057327 | |||
| 1056 | Ga0395905_0058621 | |||
| 1057 | Ga0395905_0077468 | |||
| 1058 | Ga0395905_0107293 | |||
| 1059 | Ga0395905_0136940 | |||
| 1060 | Ga0395905_0209971 | |||
| 1061 | Ga0395905_0254626 | |||
| 1062 | Ga0395905_0361665 | |||
| 1063 | Ga0395905_0513991 | |||
| 1064 | Ga0395905_0599404 | |||
| 1065 | Ga0395905_0677744 | |||
| 1066 | Ga0395905_0745391 | |||
| 1067 | Ga0395901_0002126 | |||
| 1068 | Ga0395901_0002813 | |||
| 1069 | Ga0395901_0007390 | |||
| 1070 | Ga0395901_0008689 | |||
| 1071 | Ga0395901_0009435 | |||
| 1072 | Ga0395901_0027813 | |||
| 1073 | Ga0395901_0028131 | |||
| 1074 | Ga0395901_0032458 | |||
| 1075 | Ga0395901_0036191 | |||
| 1076 | Ga0395901_0063593 | |||
| 1077 | Ga0395901_0080272 | |||
| 1078 | Ga0395901_0151680 | |||
| 1079 | Ga0395901_0262357 | |||
| 1080 | Ga0395901_0266090 | |||
| 1081 | Ga0395901_0294464 | |||
| 1082 | Ga0395901_0302204 | |||
| 1083 | Ga0395901_0329910 | |||
| 1084 | Ga0395901_0342076 | |||
| 1085 | Ga0395901_0411528 | |||
| 1086 | Ga0395901_0592113 | |||
| 1087 | Ga0395901_0605725 | |||
| 1088 | Ga0395901_1133507 | |||
| 1089 | Ga0395901_1182824 | |||
| 1090 | Ga0439436_0071878 | |||
| 1091 | Ga0439438_034504 | |||
| 1092 | Ga0439439_0008885 | |||
| 1093 | Ga0439447_040774 | |||
| 1094 | Ga0439466_0059627 | |||
| 1095 | Ga0451793_0909242 | |||
| 1096 | Ga0451798_0435415 | |||
| 1097 | Ga0451806_265883 | |||
| 1098 | Ga0451804_0258854 | |||
| 1099 | Ga0451807_1638120 | |||
| 1100 | Ga0451833_0945614 | |||
| 1101 | Ga0451835_0458117 | |||
| 1102 | Ga0451839_0867368 | |||
| 1103 | Ga0451845_0285290 | |||
| 1104 | Ga0451847_0859819 | |||
| 1105 | Ga0451849_0672773 | |||
| 1106 | Ga0451851_0150755 | |||
| 1107 | Ga0451853_0771226 | |||
| 1108 | Ga0439431_0020842 | |||
| 1109 | Ga0439433_0024227 | |||
| 1110 | Ga0439445_0035206 | |||
| 1111 | Ga0439445_0086121 | |||
| 1112 | Ga0439449_0072142 | |||
| 1113 | Ga0439451_028786 | |||
| 1114 | Ga0439452_039830 | |||
| 1115 | Ga0450920_015488 | |||
| 1116 | Ga0450920_066898 | |||
| 1117 | Ga0450896_050972 | |||
| 1118 | Ga0450907_008100 | |||
| 1119 | Ga0439446_0000352 | |||
| 1120 | Ga0439446_0000968 | |||
| 1121 | Ga0439434_0023966 | |||
| 1122 | Ga0439434_0031337 | |||
| 1123 | Ga0439434_0100989 | |||
| 1124 | Ga0439434_0112733 | |||
| 1125 | Ga0466965_0151638 | |||
| 1126 | Ga0466961_0074340 | |||
| 1127 | Ga0466964_0005579 | |||
| 1128 | Ga0466964_0252620 | |||
| 1129 | Ga0466960_0024247 | |||
| 1130 | Ga0466960_0064320 | |||
| 1131 | Ga0466967_0013271 | |||
| 1132 | Ga0466967_0425937 | |||
| 1133 | Ga0466967_0554363 | |||
| 1134 | Ga0466967_1032325 | |||
| 1135 | Ga0495592_0214220 | |||
| 1136 | Ga0495603_0042086 | |||
| 1137 | Ga0495603_0284712 | |||
| 1138 | Ga0495641_0051480 | |||
| 1139 | Ga0495641_0204702 | |||
| 1140 | Ga0495651_0163268 | |||
| 1141 | Ga0495651_0444441 | |||
| 1142 | Ga0495653_0147862 | |||
| 1143 | Ga0495653_0321448 | |||
| 1144 | Ga0495582_0014637 | |||
| 1145 | Ga0495605_0081869 | |||
| 1146 | Ga0495639_0100781 | |||
| 1147 | Ga0495664_0321011 | |||
| 1148 | Ga0495584_0027475 | |||
| 1149 | Ga0495594_0096007 | |||
| 1150 | Ga0495596_0202349 | |||
| 1151 | Ga0495607_0196640 | |||
| 1152 | Ga0495583_0120521 | |||
| 1153 | Ga0495608_0052876 | |||
| 1154 | Ga0495628_0034233 | |||
| 1155 | Ga0495630_0067437 | |||
| 1156 | Ga0495630_0111430 | |||
| 1157 | Ga0495637_0211199 | |||
| 1158 | Ga0495637_0223383 | |||
| 1159 | Ga0495663_0014171 | |||
| 1160 | Ga0495642_0024232 | |||
| 1161 | Ga0495642_0194000 | |||
| 1162 | Ga0495652_0115298 | |||
| 1163 | Ga0495665_0069709 | |||
| 1164 | Ga0495609_0074215 | |||
| 1165 | Ga0495667_0065192 | |||
| 1166 | Ga0495667_0153584 | |||
| 1167 | Ga0495667_0408786 | |||
| 1168 | Ga0495656_0145678 | |||
| 1169 | Ga0495656_0177046 | |||
| 1170 | Ga0495656_0225845 | |||
| 1171 | Ga0495656_0389845 | |||
| 1172 | Ga0495668_0330734 | |||
| 1173 | Ga0495611_0345389 | |||
| 1174 | Ga0495661_0052112 | |||
| 1175 | Ga0495588_0070907 | |||
| 1176 | Ga0495588_0142904 | |||
| 1177 | Ga0495657_0090947 | |||
| 1178 | Ga0495623_0191464 | |||
| 1179 | Ga0495646_0386432 | |||
| 1180 | Ga0495647_0034228 | |||
| 1181 | Ga0495658_0045851 | |||
| 1182 | Ga0495613_0263525 | |||
| 1183 | Ga0495670_0251292 | |||
| 1184 | Ga0495671_0135175 | |||
| 1185 | Ga0495589_0032602 | |||
| 1186 | Ga0495589_0066443 | |||
| 1187 | Ga0495581_0003093 | |||
| 1188 | Ga0495604_0025418 | |||
| 1189 | Ga0495636_0036085 | |||
| 1190 | Ga0495674_0111005 | |||
| 1191 | Ga0495674_0138848 | |||
| 1192 | Ga0495674_0189519 | |||
| 1193 | Ga0495676_0069959 | |||
| 1194 | Ga0495676_0280723 | |||
| 1195 | Ga0495680_0365480 | |||
| 1196 | Ga0495677_0143204 | |||
| 1197 | Ga0495602_0089688 | |||
| 1198 | Ga0495614_0076400 | |||
| 1199 | Ga0496100_0002226 | |||
| 1200 | Ga0496100_0054615 | |||
| 1201 | Ga0496100_0083793 | |||
| 1202 | Ga0496100_0293278 | |||
| 1203 | Ga0496100_0339082 | |||
| 1204 | Ga0496101_0001928 | |||
| 1205 | Ga0496101_0005286 | |||
| 1206 | Ga0496101_0013807 | |||
| 1207 | Ga0496101_0019074 | |||
| 1208 | Ga0496101_0118996 | |||
| 1209 | Ga0496101_0190319 | |||
| 1210 | Ga0496102_0006057 | |||
| 1211 | Ga0496102_0010580 | |||
| 1212 | Ga0496102_0033148 | |||
| 1213 | Ga0496102_0522575 | |||
| 1214 | Ga0496102_0696565 | |||
| 1215 | Ga0496103_0006441 | |||
| 1216 | Ga0496103_0008665 | |||
| 1217 | Ga0496103_0010790 | |||
| 1218 | Ga0496103_0056353 | |||
| 1219 | Ga0496103_0468450 | |||
| 1220 | Ga0496104_0000566 | |||
| 1221 | Ga0496104_0006802 | |||
| 1222 | Ga0496104_0017549 | |||
| 1223 | Ga0496104_0029418 | |||
| 1224 | Ga0496104_0094453 | |||
| 1225 | Ga0496104_0118170 | |||
| 1226 | Ga0496105_0000834 | |||
| 1227 | Ga0496105_0002560 | |||
| 1228 | Ga0496105_0015288 | |||
| 1229 | Ga0496105_0163882 | |||
| 1230 | Ga0496105_0262249 | |||
| 1231 | Ga0496105_0420958 | |||
| 1232 | Ga0496106_0036103 | |||
| 1233 | Ga0496106_0044813 | |||
| 1234 | Ga0496106_0143988 | |||
| 1235 | Ga0496106_0148405 | |||
| 1236 | Ga0496106_0262834 | |||
| 1237 | Ga0496106_0389173 | |||
| 1238 | Ga0496106_0704912 | |||
| 1239 | Ga0496107_0004351 | |||
| 1240 | Ga0496107_0013630 | |||
| 1241 | Ga0496107_0058502 | |||
| 1242 | Ga0496107_0084014 | |||
| 1243 | Ga0496108_0000906 | |||
| 1244 | Ga0496108_0003016 | |||
| 1245 | Ga0496108_0030054 | |||
| 1246 | Ga0496108_0039321 | |||
| 1247 | Ga0496108_0314805 | |||
| 1248 | Ga0496109_0000918 | |||
| 1249 | Ga0496109_0004615 | |||
| 1250 | Ga0496109_0010078 | |||
| 1251 | Ga0496109_0015392 | |||
| 1252 | Ga0496109_0159513 | |||
| 1253 | Ga0496109_0223676 | |||
| 1254 | Ga0496109_0255503 | |||
| 1255 | Ga0496109_0433492 | |||
| 1256 | Ga0496109_0480523 | |||
| 1257 | Ga0496110_0000951 | |||
| 1258 | Ga0496110_0000997 | |||
| 1259 | Ga0496110_0019486 | |||
| 1260 | Ga0496110_0062762 | |||
| 1261 | Ga0496110_0765062 | |||
| 1262 | Ga0496111_0040361 | |||
| 1263 | Ga0496111_0041864 | |||
| 1264 | Ga0496111_0042712 | |||
| 1265 | Ga0496111_0046058 | |||
| 1266 | Ga0496111_0217071 | |||
| 1267 | Ga0496112_0004731 | |||
| 1268 | Ga0496112_0007006 | |||
| 1269 | Ga0496112_0122351 | |||
| 1270 | Ga0496112_0155896 | |||
| 1271 | Ga0496112_0194551 | |||
| 1272 | Ga0496112_0242081 | |||
| 1273 | Ga0496112_0337181 | |||
| 1274 | Ga0496112_0404062 | |||
| 1275 | Ga0496112_0675388 | |||
| 1276 | Ga0496113_0058407 | |||
| 1277 | Ga0496113_0108149 | |||
| 1278 | Ga0496113_0383742 | |||
| 1279 | Ga0496114_0000593 | |||
| 1280 | Ga0496114_0025813 | |||
| 1281 | Ga0496114_0040482 | |||
| 1282 | Ga0496114_0088280 | |||
| 1283 | Ga0496114_0137003 | |||
| 1284 | Ga0496114_0406373 | |||
| 1285 | Ga0496114_0689506 | |||
| 1286 | Ga0496114_0696934 | |||
| 1287 | Ga0496115_0002543 | |||
| 1288 | Ga0496115_0002884 | |||
| 1289 | Ga0496115_0019711 | |||
| 1290 | Ga0496115_0125424 | |||
| 1291 | Ga0496115_0137736 | |||
| 1292 | Ga0501031_0000998 | |||
| 1293 | Ga0501031_0001019 | |||
| 1294 | Ga0501031_0117062 | |||
| 1295 | Ga0501031_0236908 | |||
| 1296 | Ga0501032_0013886 | |||
| 1297 | Ga0501032_0033846 | |||
| 1298 | Ga0501033_0000855 | |||
| 1299 | Ga0501033_0009029 | |||
| 1300 | Ga0501033_0010858 | |||
| 1301 | Ga0501034_0142535 | |||
| 1302 | Ga0501034_0306723 | |||
| 1303 | Ga0501036_0001208 | |||
| 1304 | Ga0501036_0004219 | |||
| 1305 | Ga0501036_0016938 | |||
| 1306 | Ga0501036_0073912 | |||
| 1307 | Ga0501037_0003662 | |||
| 1308 | Ga0501037_0041373 | |||
| 1309 | Ga0501037_0076955 | |||
| 1310 | Ga0501038_0006057 | |||
| 1311 | Ga0501038_0006640 | |||
| 1312 | Ga0501038_0064002 | |||
| 1313 | Ga0501039_0005133 | |||
| 1314 | Ga0501039_0007966 | |||
| 1315 | Ga0501039_0047840 | |||
| 1316 | Ga0501039_0144984 | |||
| 1317 | Ga0501040_0012142 | |||
| 1318 | Ga0501040_0025256 | |||
| 1319 | Ga0501040_0057094 | |||
| 1320 | Ga0501040_0064620 | |||
| 1321 | Ga0501040_0075534 | |||
| 1322 | Ga0501040_0114582 | |||
| 1323 | Ga0501040_0115581 | |||
| 1324 | Ga0501041_0002466 | |||
| 1325 | Ga0501041_0005018 | |||
| 1326 | Ga0501041_0005652 | |||
| 1327 | Ga0501041_0007796 | |||
| 1328 | Ga0501041_0300526 | |||
| 1329 | Ga0501041_0332190 | |||
| 1330 | Ga0501041_0345098 | |||
| 1331 | Ga0501042_0002378 | |||
| 1332 | Ga0501042_0006859 | |||
| 1333 | Ga0501042_0016392 | |||
| 1334 | Ga0501042_0046164 | |||
| 1335 | Ga0501042_0076123 | |||
| 1336 | Ga0501042_0249093 | |||
| 1337 | Ga0501042_0705699 | |||
| 1338 | Ga0501043_0004119 | |||
| 1339 | Ga0501043_0011981 | |||
| 1340 | Ga0501046_0002825 | |||
| 1341 | Ga0501046_0014190 | |||
| 1342 | Ga0501046_0053824 | |||
| 1343 | Ga0501046_0071932 | |||
| 1344 | Ga0501046_0074670 | |||
| 1345 | Ga0501047_0065881 | |||
| 1346 | Ga0501047_0170617 | |||
| 1347 | Ga0501048_0011154 | |||
| 1348 | Ga0501048_0051025 | |||
| 1349 | Ga0501048_0058201 | |||
| 1350 | Ga0501048_0069000 | |||
| 1351 | Ga0501067_0038822 | |||
| 1352 | Ga0501068_0000148 | |||
| 1353 | Ga0501068_0021240 | |||
| 1354 | Ga0501068_0080211 | |||
| 1355 | Ga0501068_0257754 | |||
| 1356 | Ga0501069_0010320 | |||
| 1357 | Ga0501069_0013565 | |||
| 1358 | Ga0501069_0046825 | |||
| 1359 | Ga0501069_0357385 | |||
| 1360 | Ga0501070_0003232 | |||
| 1361 | Ga0501070_0003933 | |||
| 1362 | Ga0501070_0090349 | |||
| 1363 | Ga0501070_0140387 | |||
| 1364 | Ga0501070_0225261 | |||
| 1365 | Ga0501071_0002533 | |||
| 1366 | Ga0501071_0011669 | |||
| 1367 | Ga0501071_0019089 | |||
| 1368 | Ga0501071_0102503 | |||
| 1369 | Ga0501071_0184525 | |||
| 1370 | Ga0501071_0353138 | |||
| 1371 | Ga0501072_0001504 | |||
| 1372 | Ga0501072_0033122 | |||
| 1373 | Ga0501072_0045409 | |||
| 1374 | Ga0501072_0295577 | |||
| 1375 | Ga0501072_0298983 | |||
| 1376 | Ga0501072_0361378 | |||
| 1377 | Ga0501072_0502206 | |||
| 1378 | Ga0501072_0894668 | |||
| 1379 | Ga0501073_0001011 | |||
| 1380 | Ga0501073_0002391 | |||
| 1381 | Ga0501073_0176828 | |||
| 1382 | Ga0501074_0005272 | |||
| 1383 | Ga0501074_0005793 | |||
| 1384 | Ga0501074_0038937 | |||
| 1385 | Ga0501074_0067160 | |||
| 1386 | Ga0501074_0500150 | |||
| 1387 | Ga0501075_0007514 | |||
| 1388 | Ga0501075_0015620 | |||
| 1389 | Ga0501075_0034637 | |||
| 1390 | Ga0501075_0112681 | |||
| 1391 | Ga0501076_0017659 | |||
| 1392 | Ga0501076_0021757 | |||
| 1393 | Ga0501076_0095098 | |||
| 1394 | Ga0501076_0109854 | |||
| 1395 | Ga0501076_0113070 | |||
| 1396 | Ga0501076_0129954 | |||
| 1397 | Ga0501077_0019023 | |||
| 1398 | Ga0501077_0023456 | |||
| 1399 | Ga0501077_0033890 | |||
| 1400 | Ga0501077_0303792 | |||
| 1401 | Ga0501079_0003411 | |||
| 1402 | Ga0501079_0033900 | |||
| 1403 | Ga0501079_0042817 | |||
| 1404 | Ga0501079_0188978 | |||
| 1405 | Ga0501080_0103269 | |||
| 1406 | Ga0501080_0168680 | |||
| 1407 | Ga0501080_0332773 | |||
| 1408 | Ga0501080_0535774 | |||
| 1409 | Ga0501080_0933246 | |||
| 1410 | Ga0501080_1218056 | |||
| 1411 | Ga0501081_0006202 | |||
| 1412 | Ga0501081_0009330 | |||
| 1413 | Ga0501081_0045782 | |||
| 1414 | Ga0501081_0077948 | |||
| 1415 | Ga0501081_0181236 | |||
| 1416 | Ga0501081_0316093 | |||
| 1417 | Ga0501081_0401045 | |||
| 1418 | Ga0501081_0821299 | |||
| 1419 | Ga0501083_0004800 | |||
| 1420 | Ga0501083_0006150 | |||
| 1421 | Ga0501083_0420851 | |||
| 1422 | Ga0501035_0002064 | |||
| 1423 | Ga0501035_0009792 | |||
| 1424 | Ga0501035_0013032 | |||
| 1425 | Ga0501044_0136261 | |||
| 1426 | Ga0501044_0183173 | |||
| 1427 | Ga0501044_0286127 | |||
| 1428 | Ga0501045_0000761 | |||
| 1429 | Ga0501045_0000918 | |||
| 1430 | Ga0501045_0166039 | |||
| 1431 | nmdc:mga0yw44_62906_c1 | |||
| 1432 | nmdc:mga0yw44_87676_c1 | |||
| 1433 | nmdc:mga06z11_439914_c1 | |||
| 1434 | nmdc:mga05p37_110941_c1 | |||
| 1435 | nmdc:mga05p37_420276_c1 | |||
| 1436 | nmdc:mga05p37_530307_c1 | |||
| 1437 | nmdc:mga05p37_55907_c1 | |||
| 1438 | nmdc:mga05p37_747892_c1 | |||
| 1439 | nmdc:mga06r32_83319_c1 | |||
| 1440 | nmdc:mga08y16_126264_c1 | |||
| 1441 | nmdc:mga08y16_210428_c1 | |||
| 1442 | nmdc:mga08y16_238451_c1 | |||
| 1443 | nmdc:mga08y16_245742_c1 | |||
| 1444 | nmdc:mga08y16_27968_c1 | |||
| 1445 | nmdc:mga08y16_39726_c1 | |||
| 1446 | nmdc:mga08y16_872413_c1 | |||
| 1447 | nmdc:mga0n895_113056_c1 | |||
| 1448 | nmdc:mga0n895_1215325_c1 | |||
| 1449 | nmdc:mga0n895_183249_c1 | |||
| 1450 | nmdc:mga0n895_72129_c1 | |||
| 1451 | nmdc:mga0rr50_158996_c1 | |||
| 1452 | nmdc:mga0rr50_329453_c1 | |||
| 1453 | nmdc:mga0rr50_43767_c1 | |||
| 1454 | nmdc:mga0rr50_56657_c1 | |||
| 1455 | nmdc:mga0rr50_599508_c1 | |||
| 1456 | nmdc:mga08x19_28961_c1 | |||
| 1457 | nmdc:mga08x19_30095_c1 | |||
| 1458 | nmdc:mga08x19_42636_c1 | |||
| 1459 | nmdc:mga0a205_104359_c1 | |||
| 1460 | nmdc:mga0a205_14592_c1 | |||
| 1461 | nmdc:mga0a205_27453_c1 | |||
| 1462 | Ga0495601_0307188 | |||
| 1463 | Ga0495612_0035415 | |||
| 1464 | Ga0495595_0030536 | |||
| 1465 | Ga0495619_0280102 | |||
| 1466 | Ga0501084_0002075 | |||
| 1467 | Ga0501084_0017188 | |||
| 1468 | Ga0501084_0044531 | |||
| 1469 | Ga0501084_0049638 | |||
| 1470 | Ga0501084_0083608 | |||
| 1471 | Ga0501084_0092396 | |||
| 1472 | Ga0501084_0126225 | |||
| 1473 | Ga0501084_0177581 | |||
| 1474 | Ga0501084_0433099 | |||
| 1475 | Ga0590071_074770 | |||
| 1476 | Ga0590077_025113 | |||
| 1477 | Ga0501082_0001530 | |||
| 1478 | Ga0501082_0010704 | |||
| 1479 | Ga0501082_0032701 | |||
| 1480 | Ga0501082_0183510 | |||
| 1481 | Ga0501082_0190258 | |||
| 1482 | Ga0530510_0018892 | |||
| 1483 | Ga0530510_0025098 | |||
| 1484 | Ga0530510_0044723 | |||
| 1485 | Ga0530510_0167983 | |||
| 1486 | Ga0530510_0168585 | |||
| 1487 | Ga0530510_0289046 | |||
| 1488 | Ga0530510_0377076 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5gpa-assembly1.cif.gz_A | structural analysis of fatty acid degradation regulator fadr from bacillus halodurans | 0.8815 | 14 | 199 |
| 3vpr-assembly2.cif.gz_C | crystal structure of a tetr family transcriptional regulator pfmr from thermus thermophilus hb8 | 0.8734 | 15 | 198 |
| 3whc-assembly2.cif.gz_D | crystal structure of a transcriptional regulator fadr from bacillus subtilis in complex with stearoyl-coa | 0.8652 | 11 | 198 |
| 3vpr-assembly2.cif.gz_D | crystal structure of a tetr family transcriptional regulator pfmr from thermus thermophilus hb8 | 0.8645 | 12 | 199 |
| 5gpa-assembly1.cif.gz_B | structural analysis of fatty acid degradation regulator fadr from bacillus halodurans | 0.8618 | 14 | 197 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3whbA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 1.008 | 10 | 53 | 1.10.10.60 |
| 3whcD01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 1.005 | 11 | 53 | 1.10.10.60 |
| 5gpaA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 1.004 | 14 | 53 | 1.10.10.60 |
| 5gpaB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9988 | 14 | 53 | 1.10.10.60 |
| 3whcB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9978 | 11 | 53 | 1.10.10.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538JXR9-F1-model_v4 | TetR/AcrR family transcriptional regulator | 0.9799 | 2 | 199 |
GO:0000976
GO:0003700 |
| AF-A0A538MU75-F1-model_v4 | TetR/AcrR family transcriptional regulator | 0.9769 | 2 | 199 |
GO:0000976
GO:0003700 |
| AF-A0A538DL25-F1-model_v4 | TetR/AcrR family transcriptional regulator | 0.9761 | 1 | 199 |
GO:0000976
GO:0003700 |
| AF-A0A537ZS25-F1-model_v4 | TetR/AcrR family transcriptional regulator | 0.9749 | 9 | 199 |
GO:0000976
GO:0003700 |
| AF-A0A538DL25-F1-model_v4 | TetR/AcrR family transcriptional regulator | 0.9713 | 1 | 199 |
GO:0000976
GO:0003700 |