F478734

General Info

Members Datasets Scaffolds Average Seq Length
744 294 1488 203

Family's Representative Sequence

Representative Sequence 3300006881|Ga0068865_100318422|Ga0068865_1003184222
Length 234
Sequence LAANECGLRLGGRDPELGNITGTGTTLPTLTDRSTGQEDKRRLILDAAVRVFARKGYHTCRVGDIAEEAGVAHGLLYHYFRSKEELLETIFRETWRDVLDAVRAVEETDESARDQLAGITKILLRAWRRDPDLVRVLVREVTRSSHLQERIEEIDAAFAGLERIIARGQQEGEFRSDLDPRMASYVFYGALEEILTGWVLGQLEDGDEVIARAEQTVVEVICGGLAADREVAKV

Samples

Sample ID Description Type Environment
1 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
132 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
133 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
134 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
135 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
136 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
137 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
138 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
139 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
148 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
149 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
150 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
151 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
152 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
153 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
154 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
155 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
156 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
157 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
158 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
159 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
160 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
161 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
162 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
163 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
164 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
165 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
166 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
167 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
168 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
169 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
170 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
171 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
172 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
173 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
174 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
175 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
176 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
177 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
178 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
179 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
190 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
191 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
192 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
193 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
194 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
195 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
196 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
199 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
200 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
203 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
204 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
205 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
206 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
207 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
208 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
209 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
210 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
211 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
212 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
213 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
217 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
218 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
219 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
220 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
221 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
222 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
223 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
224 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
225 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
228 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
229 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
244 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
260 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
261 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
264 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
265 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
266 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
267 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
268 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
269 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
270 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
271 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
272 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
273 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
274 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
277 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
278 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
279 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
280 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
281 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
282 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
283 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
284 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
285 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
286 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
287 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
288 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
289 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
290 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
291 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
292 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
293 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
294 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 13.17
Rhizosphere 85.22
Stem 0
Stem Tuber 0
Unclassified 10.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068865_100318422 3300006881 Bacteria 1250
2 JGI25407J50210_10001359 3300003373 Bacteria 5530
3 Ga0068869_100549747 3300005334 Unclassified 970
4 Ga0070680_100027894 3300005336 Bacteria 4525
5 Ga0070682_100088246 3300005337 Bacteria 2024
6 Ga0068868_100147955 3300005338 Bacteria 1932
7 Ga0070692_10372736 3300005345 Bacteria 893
8 Ga0070692_10410583 3300005345 Bacteria 857
9 Ga0070668_100207419 3300005347 Bacteria 1611
10 Ga0070671_100093071 3300005355 Bacteria 2526
11 Ga0070671_100332722 3300005355 Bacteria 1295
12 Ga0070674_100065328 3300005356 Unclassified 2553
13 Ga0070673_100092341 3300005364 Bacteria 2476
14 Ga0070673_100172073 3300005364 Bacteria 1849
15 Ga0070659_100347994 3300005366 Bacteria 1243
16 Ga0070667_100061744 3300005367 Bacteria 3173
17 Ga0070703_10001626 3300005406 Bacteria 6682
18 Ga0070709_10046599 3300005434 Bacteria 2696
19 Ga0070709_10046683 3300005434 Bacteria 2694
20 Ga0070714_100068582 3300005435 Bacteria 3060
21 Ga0070713_100067930 3300005436 Bacteria 3003
22 Ga0070710_10023408 3300005437 Bacteria 3247
23 Ga0070710_10024938 3300005437 Bacteria 3160
24 Ga0070710_10035004 3300005437 Unclassified 2735
25 Ga0070711_100226956 3300005439 Unclassified 1454
26 Ga0070705_100016464 3300005440 Bacteria 3842
27 Ga0070705_100179430 3300005440 Bacteria 1433
28 Ga0070705_100270778 3300005440 Bacteria 1203
29 Ga0070700_100173972 3300005441 Bacteria 1493
30 Ga0070694_100054704 3300005444 Bacteria 2704
31 Ga0070708_100060847 3300005445 Bacteria 3372
32 Ga0070708_100062644 3300005445 Bacteria 3327
33 Ga0070708_100076236 3300005445 Unclassified 3028
34 Ga0070708_100183403 3300005445 Bacteria 1957
35 Ga0070708_100704289 3300005445 Bacteria 950
36 Ga0070678_100424800 3300005456 Bacteria 1159
37 Ga0070662_100293717 3300005457 Bacteria 1318
38 Ga0070681_10002438 3300005458 Bacteria 17023
39 Ga0070681_10751172 3300005458 Bacteria 892
40 Ga0070685_10217194 3300005466 Bacteria 1251
41 Ga0070706_100005941 3300005467 Bacteria 11541
42 Ga0070706_100009560 3300005467 Bacteria 9017
43 Ga0070706_100094643 3300005467 Bacteria 2772
44 Ga0070706_100364819 3300005467 Bacteria 1346
45 Ga0070707_100001334 3300005468 Bacteria 24304
46 Ga0070707_100002726 3300005468 Bacteria 16796
47 Ga0070707_100043625 3300005468 Bacteria 4292
48 Ga0070707_100057163 3300005468 Bacteria 3743
49 Ga0070698_100010130 3300005471 Bacteria 10068
50 Ga0070698_100032297 3300005471 Bacteria 5424
51 Ga0070698_100043922 3300005471 Bacteria 4579
52 Ga0070698_100107819 3300005471 Unclassified 2753
53 Ga0070699_100047689 3300005518 Bacteria 3707
54 Ga0070699_100090373 3300005518 Bacteria 2676
55 Ga0070699_100128307 3300005518 Bacteria 2235
56 Ga0070699_100538361 3300005518 Unclassified 1062
57 Ga0070699_100601127 3300005518 Unclassified 1003
58 Ga0070679_100035588 3300005530 Bacteria 4940
59 Ga0070684_100000999 3300005535 Bacteria 20140
60 Ga0070697_100031410 3300005536 Bacteria 4273
61 Ga0070697_100053435 3300005536 Unclassified 3283
62 Ga0070697_100372039 3300005536 Unclassified 1236
63 Ga0070697_100426680 3300005536 Bacteria 1152
64 Ga0070686_100088858 3300005544 Bacteria 2063
65 Ga0070695_100019044 3300005545 Bacteria 4174
66 Ga0070695_100091435 3300005545 Bacteria 2033
67 Ga0070695_100328745 3300005545 Bacteria 1139
68 Ga0070696_100091837 3300005546 Bacteria 2162
69 Ga0070693_100194067 3300005547 Bacteria 1315
70 Ga0070704_100026128 3300005549 Bacteria 3853
71 Ga0070704_100088723 3300005549 Unclassified 2298
72 Ga0068855_100485342 3300005563 Unclassified 1344
73 Ga0070702_100014234 3300005615 Bacteria 4033
74 Ga0068864_100521808 3300005618 Unclassified 1145
75 Ga0068866_10208062 3300005718 Bacteria 1173
76 Ga0068861_100753961 3300005719 Unclassified 909
77 Ga0081455_10076753 3300005937 Bacteria 2751
78 Ga0081455_10348696 3300005937 Bacteria 1045
79 Ga0081538_10000108 3300005981 Bacteria 82426
80 Ga0081538_10005692 3300005981 Bacteria 11148
81 Ga0081539_10001930 3300005985 Bacteria 31892
82 Ga0081539_10002329 3300005985 Bacteria 27351
83 Ga0081539_10007217 3300005985 Bacteria 10223
84 Ga0070717_10031572 3300006028 Bacteria 4262
85 Ga0075432_10049443 3300006058 Bacteria 1481
86 Ga0070715_10020292 3300006163 Unclassified 2561
87 Ga0070715_10034625 3300006163 Bacteria 2071
88 Ga0070716_100062590 3300006173 Unclassified 2158
89 Ga0070716_100094648 3300006173 Bacteria 1816
90 Ga0070716_100300928 3300006173 Bacteria 1116
91 Ga0070712_100001584 3300006175 Bacteria 13901
92 Ga0070712_100010323 3300006175 Bacteria 5888
93 Ga0070712_100415287 3300006175 Bacteria 1114
94 Ga0075367_10279676 3300006178 Bacteria 1049
95 Ga0068871_100040544 3300006358 Bacteria 3730
96 Ga0075428_100191176 3300006844 Bacteria 2214
97 Ga0075431_100040366 3300006847 Bacteria 4810
98 Ga0075433_10012724 3300006852 Bacteria 6809
99 Ga0075433_10022462 3300006852 Bacteria 5295
100 Ga0075433_10027727 3300006852 Bacteria 4807
101 Ga0075433_10045735 3300006852 Bacteria 3806
102 Ga0075434_100015007 3300006871 Bacteria 7418
103 Ga0075434_100101742 3300006871 Bacteria 2880
104 Ga0075434_100116801 3300006871 Bacteria 2681
105 Ga0075434_101466802 3300006871 Unclassified 692
106 Ga0068865_100178702 3300006881 Bacteria 1633
107 Ga0075436_100009506 3300006914 Bacteria 6650
108 Ga0075436_100014894 3300006914 Bacteria 5328
109 Ga0075436_100106096 3300006914 Bacteria 1959
110 Ga0075436_100230056 3300006914 Unclassified 1317
111 Ga0075435_100018555 3300007076 Bacteria 5295
112 Ga0075435_100068139 3300007076 Bacteria 2898
113 Ga0075435_100273561 3300007076 Bacteria 1441
114 Ga0105240_11096606 3300009093 Bacteria 847
115 Ga0111539_10025172 3300009094 Bacteria 7295
116 Ga0111539_10046599 3300009094 Bacteria 5185
117 Ga0111539_10046900 3300009094 Bacteria 5167
118 Ga0111539_10159063 3300009094 Bacteria 2642
119 Ga0111539_10249907 3300009094 Unclassified 2065
120 Ga0111539_10345196 3300009094 Bacteria 1733
121 Ga0111539_10882667 3300009094 Bacteria 1040
122 Ga0111539_11196939 3300009094 Bacteria 882
123 Ga0105245_10015305 3300009098 Bacteria 6684
124 Ga0105245_10023866 3300009098 Bacteria 5367
125 Ga0105245_10075383 3300009098 Bacteria 3071
126 Ga0105245_10229710 3300009098 Unclassified 1794
127 Ga0105245_10261762 3300009098 Bacteria 1683
128 Ga0105245_10424012 3300009098 Bacteria 1334
129 Ga0105247_10155882 3300009101 Bacteria 1508
130 Ga0114129_10014214 3300009147 Bacteria 11342
131 Ga0114129_10043890 3300009147 Bacteria 6290
132 Ga0114129_10052066 3300009147 Bacteria 5746
133 Ga0114129_10082099 3300009147 Bacteria 4479
134 Ga0114129_10208334 3300009147 Bacteria 2644
135 Ga0114129_10443153 3300009147 Unclassified 1705
136 Ga0114129_10540901 3300009147 Bacteria 1516
137 Ga0105243_10012521 3300009148 Bacteria 6415
138 Ga0105243_10032390 3300009148 Bacteria 4039
139 Ga0105243_10134757 3300009148 Bacteria 2100
140 Ga0105243_10521530 3300009148 Unclassified 1130
141 Ga0105241_10049511 3300009174 Bacteria 3200
142 Ga0105241_10072313 3300009174 Bacteria 2680
143 Ga0105242_10094388 3300009176 Bacteria 2523
144 Ga0105242_10406407 3300009176 Bacteria 1272
145 Ga0105242_10658165 3300009176 Bacteria 1019
146 Ga0105242_10737529 3300009176 Bacteria 968
147 Ga0105248_10037171 3300009177 Bacteria 5446
148 Ga0105248_10403846 3300009177 Bacteria 1538
149 Ga0105237_10623815 3300009545 Bacteria 1085
150 Ga0105238_10159235 3300009551 Unclassified 2233
151 Ga0105238_10459722 3300009551 Bacteria 1270
152 Ga0105249_10008550 3300009553 Bacteria 8926
153 Ga0105249_10526487 3300009553 Unclassified 1230
154 Ga0105239_10032166 3300010375 Bacteria 5765
155 Ga0105239_10123880 3300010375 Bacteria 2872
156 Ga0105246_10263965 3300011119 Bacteria 1373
157 Ga0157373_10464043 3300013100 Bacteria 912
158 Ga0157374_10228958 3300013296 Bacteria 1825
159 Ga0157374_11121941 3300013296 Bacteria 807
160 Ga0157378_10007435 3300013297 Bacteria 9569
161 Ga0157378_10075204 3300013297 Bacteria 3040
162 Ga0163162_10004079 3300013306 Bacteria 14016
163 Ga0163162_10748857 3300013306 Unclassified 1096
164 Ga0163162_10785427 3300013306 Bacteria 1070
165 Ga0157372_10523582 3300013307 Bacteria 1382
166 Ga0157372_11889507 3300013307 Bacteria 686
167 Ga0157375_10021031 3300013308 Bacteria 5976
168 Ga0157375_10392474 3300013308 Bacteria 1555
169 Ga0157380_10013152 3300014326 Bacteria 6026
170 Ga0157380_10149391 3300014326 Bacteria 2018
171 Ga0157380_10873862 3300014326 Bacteria 923
172 Ga0157377_10000547 3300014745 Bacteria 15851
173 Ga0157377_10044489 3300014745 Bacteria 2476
174 Ga0157379_10077823 3300014968 Bacteria 2970
175 Ga0157376_10091996 3300014969 Bacteria 2629
176 Ga0157376_10092560 3300014969 Bacteria 2621
177 Ga0157376_10613597 3300014969 Bacteria 1084
178 Ga0163161_10460549 3300017792 Unclassified 1029
179 Ga0206352_10068228 3300020078 Bacteria 866
180 Ga0207653_10000490 3300025885 Bacteria 15471
181 Ga0207692_10006369 3300025898 Bacteria 4785
182 Ga0207692_10421873 3300025898 Bacteria 835
183 Ga0207688_10022234 3300025901 Unclassified 3468
184 Ga0207685_10005258 3300025905 Bacteria 3397
185 Ga0207699_10011479 3300025906 Bacteria 4476
186 Ga0207699_10080045 3300025906 Bacteria 2023
187 Ga0207643_10402908 3300025908 Unclassified 865
188 Ga0207684_10046295 3300025910 Bacteria 3690
189 Ga0207684_10064119 3300025910 Bacteria 3119
190 Ga0207684_10194921 3300025910 Bacteria 1747
191 Ga0207684_10235131 3300025910 Bacteria 1581
192 Ga0207684_10320056 3300025910 Bacteria 1337
193 Ga0207654_10324926 3300025911 Bacteria 1053
194 Ga0207707_10001682 3300025912 Bacteria 20367
195 Ga0207707_10641581 3300025912 Bacteria 896
196 Ga0207693_10001093 3300025915 Bacteria 24388
197 Ga0207693_10018089 3300025915 Bacteria 5615
198 Ga0207693_10104597 3300025915 Bacteria 2220
199 Ga0207663_10163256 3300025916 Bacteria 1575
200 Ga0207663_10207937 3300025916 Unclassified 1416
201 Ga0207657_10292117 3300025919 Bacteria 1292
202 Ga0207657_10677980 3300025919 Unclassified 801
203 Ga0207652_10023045 3300025921 Bacteria 5157
204 Ga0207652_10570240 3300025921 Bacteria 1016
205 Ga0207646_10004284 3300025922 Bacteria 15571
206 Ga0207646_10028310 3300025922 Bacteria 5102
207 Ga0207646_10112975 3300025922 Bacteria 2438
208 Ga0207646_10152081 3300025922 Bacteria 2087
209 Ga0207694_10365000 3300025924 Bacteria 1197
210 Ga0207659_10413259 3300025926 Bacteria 1130
211 Ga0207687_10731367 3300025927 Bacteria 841
212 Ga0207700_10321308 3300025928 Bacteria 1341
213 Ga0207644_10435966 3300025931 Bacteria 1075
214 Ga0207690_10297131 3300025932 Bacteria 1262
215 Ga0207706_10352984 3300025933 Bacteria 1278
216 Ga0207686_10185443 3300025934 Bacteria 1479
217 Ga0207686_10804583 3300025934 Unclassified 754
218 Ga0207709_10131623 3300025935 Bacteria 1706
219 Ga0207709_10286704 3300025935 Bacteria 1218
220 Ga0207704_10502029 3300025938 Unclassified 978
221 Ga0207704_10774874 3300025938 Bacteria 799
222 Ga0207665_10006442 3300025939 Bacteria 7790
223 Ga0207665_10007933 3300025939 Bacteria 7011
224 Ga0207665_10029397 3300025939 Unclassified 3632
225 Ga0207689_10146278 3300025942 Bacteria 1947
226 Ga0207661_10001078 3300025944 Bacteria 18160
227 Ga0207679_10102638 3300025945 Bacteria 2240
228 Ga0207651_10051831 3300025960 Bacteria 2795
229 Ga0207668_10065393 3300025972 Unclassified 2574
230 Ga0207640_10040028 3300025981 Bacteria 2971
231 Ga0207640_10991361 3300025981 Bacteria 739
232 Ga0207678_10115142 3300026067 Bacteria 2294
233 Ga0207678_10516160 3300026067 Bacteria 1043
234 Ga0207708_10280714 3300026075 Bacteria 1349
235 Ga0207702_10036442 3300026078 Bacteria 4115
236 Ga0207676_11217205 3300026095 Bacteria 747
237 Ga0207675_100012199 3300026118 Bacteria 8027
238 Ga0207675_100564647 3300026118 Bacteria 1138
239 Ga0207683_10005713 3300026121 Bacteria 10670
240 Ga0207683_10018838 3300026121 Bacteria 5889
241 Ga0207428_10011431 3300027907 Bacteria 7846
242 Ga0207428_10218953 3300027907 Bacteria 1428
243 Ga0207428_10387637 3300027907 Unclassified 1024
244 Ga0268266_10931819 3300028379 Bacteria 840
245 Ga0307405_10249346 3300031731 Bacteria 1320
246 Ga0307412_10336352 3300031911 Unclassified 1207
247 Ga0307409_100152639 3300031995 Bacteria 2008
248 Ga0307416_100022997 3300032002 Bacteria 4513
249 Ga0307416_100502623 3300032002 Bacteria 1277
250 Ga0307416_101281646 3300032002 Bacteria 839
251 Ga0307415_100055032 3300032126 Bacteria 2720
252 Ga0307415_100122564 3300032126 Bacteria 1952
253 Ga0373938_0001256 3300034957 Bacteria 4076
254 Ga0373929_0001057 3300035085 Bacteria 5343
255 Ga0373940_0009762 3300035088 Bacteria 2240
256 Ga0373952_0003426 3300035092 Bacteria 2862
257 Ga0373932_0007922 3300035112 Bacteria 2536
258 Ga0373941_0072111 3300035115 Bacteria 1148
259 Ga0373960_0000062 3300035121 Bacteria 14949
260 Ga0373960_0217389 3300035121 Bacteria 682
261 Ga0373942_0001059 3300035207 Bacteria 7404
262 Ga0373962_0000807 3300035242 Bacteria 7159
263 Ga0373931_0003378 3300035691 Bacteria 7160
264 Ga0373937_0119177 3300036401 Bacteria 2459
265 Ga0395899_0004487 3300037312 Bacteria 10878
266 Ga0395899_0027218 3300037312 Bacteria 4312
267 Ga0395899_0030427 3300037312 Bacteria 4061
268 Ga0395899_0042003 3300037312 Bacteria 3415
269 Ga0395899_0051499 3300037312 Bacteria 3055
270 Ga0395899_0083012 3300037312 Bacteria 2330
271 Ga0395899_0173050 3300037312 Bacteria 1519
272 Ga0395899_0260172 3300037312 Bacteria 1187
273 Ga0395899_0274111 3300037312 Bacteria 1150
274 Ga0395900_0003596 3300037418 Bacteria 16662
275 Ga0395900_0004619 3300037418 Bacteria 14530
276 Ga0395900_0005500 3300037418 Bacteria 13258
277 Ga0395900_0006523 3300037418 Bacteria 12161
278 Ga0395900_0007355 3300037418 Bacteria 11384
279 Ga0395900_0013999 3300037418 Bacteria 8188
280 Ga0395900_0022223 3300037418 Bacteria 6489
281 Ga0395900_0063227 3300037418 Bacteria 3804
282 Ga0395900_0067970 3300037418 Bacteria 3661
283 Ga0395900_0101888 3300037418 Bacteria 2949
284 Ga0395900_0122623 3300037418 Unclassified 2666
285 Ga0395900_0149150 3300037418 Bacteria 2390
286 Ga0395900_0309996 3300037418 Bacteria 1562
287 Ga0395900_0392127 3300037418 Unclassified 1354
288 Ga0395900_0649608 3300037418 Bacteria 991
289 Ga0395900_0667236 3300037418 Bacteria 975
290 Ga0395900_0822431 3300037418 Bacteria 856
291 Ga0395898_0002928 3300037466 Bacteria 19413
292 Ga0395898_0005497 3300037466 Bacteria 13684
293 Ga0395898_0007699 3300037466 Bacteria 11437
294 Ga0395898_0010458 3300037466 Bacteria 9701
295 Ga0395898_0033721 3300037466 Bacteria 5107
296 Ga0395898_0038499 3300037466 Bacteria 4738
297 Ga0395898_0047144 3300037466 Bacteria 4230
298 Ga0395898_0094226 3300037466 Bacteria 2878
299 Ga0395898_0135769 3300037466 Bacteria 2355
300 Ga0395898_0224913 3300037466 Bacteria 1790
301 Ga0395898_0225700 3300037466 Unclassified 1786
302 Ga0395898_0557624 3300037466 Bacteria 1088
303 Ga0395898_0596639 3300037466 Unclassified 1047
304 Ga0395898_0741998 3300037466 Bacteria 923
305 Ga0395905_0000698 3300037471 Bacteria 44490
306 Ga0395905_0004158 3300037471 Bacteria 15144
307 Ga0395905_0006203 3300037471 Bacteria 12064
308 Ga0395905_0008142 3300037471 Bacteria 10354
309 Ga0395905_0014202 3300037471 Bacteria 7607
310 Ga0395905_0024444 3300037471 Bacteria 5702
311 Ga0395905_0057327 3300037471 Unclassified 3644
312 Ga0395905_0058621 3300037471 Bacteria 3600
313 Ga0395905_0077468 3300037471 Bacteria 3115
314 Ga0395905_0107293 3300037471 Bacteria 2622
315 Ga0395905_0136940 3300037471 Bacteria 2304
316 Ga0395905_0209971 3300037471 Bacteria 1824
317 Ga0395905_0254626 3300037471 Bacteria 1640
318 Ga0395905_0361665 3300037471 Bacteria 1344
319 Ga0395905_0513991 3300037471 Bacteria 1098
320 Ga0395905_0599404 3300037471 Bacteria 1003
321 Ga0395905_0677744 3300037471 Unclassified 933
322 Ga0395905_0745391 3300037471 Bacteria 882
323 Ga0395901_0002126 3300038443 Bacteria 20297
324 Ga0395901_0002813 3300038443 Bacteria 17572
325 Ga0395901_0007390 3300038443 Bacteria 11084
326 Ga0395901_0008689 3300038443 Bacteria 10264
327 Ga0395901_0009435 3300038443 Bacteria 9902
328 Ga0395901_0027813 3300038443 Bacteria 5815
329 Ga0395901_0028131 3300038443 Bacteria 5782
330 Ga0395901_0032458 3300038443 Bacteria 5388
331 Ga0395901_0036191 3300038443 Bacteria 5100
332 Ga0395901_0063593 3300038443 Bacteria 3840
333 Ga0395901_0080272 3300038443 Unclassified 3406
334 Ga0395901_0151680 3300038443 Bacteria 2435
335 Ga0395901_0262357 3300038443 Bacteria 1798
336 Ga0395901_0266090 3300038443 Bacteria 1784
337 Ga0395901_0294464 3300038443 Bacteria 1683
338 Ga0395901_0302204 3300038443 Bacteria 1659
339 Ga0395901_0329910 3300038443 Bacteria 1577
340 Ga0395901_0342076 3300038443 Unclassified 1545
341 Ga0395901_0411528 3300038443 Bacteria 1388
342 Ga0395901_0592113 3300038443 Bacteria 1119
343 Ga0395901_0605725 3300038443 Bacteria 1104
344 Ga0395901_1133507 3300038443 Bacteria 751
345 Ga0395901_1182824 3300038443 Bacteria 731
346 Ga0439436_0071878 3300041404 Bacteria 964
347 Ga0439438_034504 3300041405 Bacteria 1333
348 Ga0439439_0008885 3300041406 Bacteria 2378
349 Ga0439447_040774 3300041407 Bacteria 1132
350 Ga0439466_0059627 3300041411 Bacteria 1232
351 Ga0451793_0909242 3300041452 Bacteria 1491
352 Ga0451798_0435415 3300041458 Bacteria 1522
353 Ga0451806_265883 3300041462 Bacteria 1265
354 Ga0451804_0258854 3300041463 Bacteria 1989
355 Ga0451807_1638120 3300041486 Bacteria 3285
356 Ga0451833_0945614 3300041491 Bacteria 678
357 Ga0451835_0458117 3300041492 Bacteria 7337
358 Ga0451839_0867368 3300041496 Bacteria 2688
359 Ga0451845_0285290 3300041501 Bacteria 1637
360 Ga0451847_0859819 3300041503 Bacteria 1380
361 Ga0451849_0672773 3300041505 Bacteria 3169
362 Ga0451851_0150755 3300041507 Bacteria 1893
363 Ga0451853_0771226 3300041512 Bacteria 1415
364 Ga0439431_0020842 3300041997 Bacteria 1569
365 Ga0439433_0024227 3300041999 Bacteria 1366
366 Ga0439445_0035206 3300042004 Bacteria 1314
367 Ga0439445_0086121 3300042004 Bacteria 882
368 Ga0439449_0072142 3300042007 Bacteria 1272
369 Ga0439451_028786 3300042009 Bacteria 1119
370 Ga0439452_039830 3300042010 Bacteria 1111
371 Ga0450920_015488 3300042122 Bacteria 1450
372 Ga0450920_066898 3300042122 Bacteria 729
373 Ga0450896_050972 3300042133 Bacteria 660
374 Ga0450907_008100 3300042146 Bacteria 1749
375 Ga0439446_0000352 3300042156 Bacteria 8842
376 Ga0439446_0000968 3300042156 Bacteria 6248
377 Ga0439434_0023966 3300042435 Bacteria 1839
378 Ga0439434_0031337 3300042435 Bacteria 1616
379 Ga0439434_0100989 3300042435 Bacteria 929
380 Ga0439434_0112733 3300042435 Bacteria 882
381 Ga0466965_0151638 3300044683 Bacteria 1212
382 Ga0466961_0074340 3300044693 Bacteria 2155
383 Ga0466964_0005579 3300044706 Bacteria 4672
384 Ga0466964_0252620 3300044706 Bacteria 870
385 Ga0466960_0024247 3300044901 Bacteria 2735
386 Ga0466960_0064320 3300044901 Unclassified 1808
387 Ga0466967_0013271 3300045976 Bacteria 6356
388 Ga0466967_0425937 3300045976 Bacteria 1294
389 Ga0466967_0554363 3300045976 Bacteria 1131
390 Ga0466967_1032325 3300045976 Bacteria 819
391 Ga0495592_0214220 3300046454 Bacteria 1292
392 Ga0495603_0042086 3300046455 Bacteria 2731
393 Ga0495603_0284712 3300046455 Bacteria 950
394 Ga0495641_0051480 3300046461 Unclassified 1880
395 Ga0495641_0204702 3300046461 Bacteria 885
396 Ga0495651_0163268 3300046462 Bacteria 1594
397 Ga0495651_0444441 3300046462 Bacteria 839
398 Ga0495653_0147862 3300046463 Bacteria 1645
399 Ga0495653_0321448 3300046463 Bacteria 1003
400 Ga0495582_0014637 3300046473 Bacteria 4309
401 Ga0495605_0081869 3300046474 Bacteria 1509
402 Ga0495639_0100781 3300046475 Bacteria 1363
403 Ga0495664_0321011 3300046477 Bacteria 934
404 Ga0495584_0027475 3300046491 Bacteria 2884
405 Ga0495594_0096007 3300046499 Bacteria 1665
406 Ga0495596_0202349 3300046500 Bacteria 771
407 Ga0495607_0196640 3300046501 Bacteria 1001
408 Ga0495583_0120521 3300046506 Unclassified 1105
409 Ga0495608_0052876 3300046511 Bacteria 2688
410 Ga0495628_0034233 3300046516 Bacteria 4088
411 Ga0495630_0067437 3300046517 Bacteria 2690
412 Ga0495630_0111430 3300046517 Bacteria 2073
413 Ga0495637_0211199 3300046520 Bacteria 710
414 Ga0495637_0223383 3300046520 Unclassified 685
415 Ga0495663_0014171 3300046525 Bacteria 2233
416 Ga0495642_0024232 3300046528 Bacteria 2400
417 Ga0495642_0194000 3300046528 Bacteria 885
418 Ga0495652_0115298 3300046529 Bacteria 2153
419 Ga0495665_0069709 3300046531 Unclassified 1853
420 Ga0495609_0074215 3300046538 Bacteria 1492
421 Ga0495667_0065192 3300046559 Bacteria 2383
422 Ga0495667_0153584 3300046559 Bacteria 1482
423 Ga0495667_0408786 3300046559 Bacteria 855
424 Ga0495656_0145678 3300046615 Bacteria 1139
425 Ga0495656_0177046 3300046615 Unclassified 1046
426 Ga0495656_0225845 3300046615 Bacteria 938
427 Ga0495656_0389845 3300046615 Bacteria 727
428 Ga0495668_0330734 3300046616 Unclassified 836
429 Ga0495611_0345389 3300046648 Bacteria 683
430 Ga0495661_0052112 3300046665 Bacteria 2467
431 Ga0495588_0070907 3300046674 Bacteria 1812
432 Ga0495588_0142904 3300046674 Bacteria 1264
433 Ga0495657_0090947 3300046675 Bacteria 1958
434 Ga0495623_0191464 3300046679 Unclassified 1181
435 Ga0495646_0386432 3300046680 Bacteria 729
436 Ga0495647_0034228 3300046681 Unclassified 1902
437 Ga0495658_0045851 3300046683 Bacteria 2455
438 Ga0495613_0263525 3300046689 Bacteria 1200
439 Ga0495670_0251292 3300046691 Bacteria 943
440 Ga0495671_0135175 3300046692 Bacteria 1202
441 Ga0495589_0032602 3300046794 Bacteria 2619
442 Ga0495589_0066443 3300046794 Bacteria 1766
443 Ga0495581_0003093 3300047315 Bacteria 9519
444 Ga0495604_0025418 3300047317 Bacteria 4720
445 Ga0495636_0036085 3300047318 Unclassified 2038
446 Ga0495674_0111005 3300047319 Bacteria 2325
447 Ga0495674_0138848 3300047319 Bacteria 2043
448 Ga0495674_0189519 3300047319 Bacteria 1710
449 Ga0495676_0069959 3300047321 Bacteria 2706
450 Ga0495676_0280723 3300047321 Bacteria 1128
451 Ga0495680_0365480 3300047322 Unclassified 1002
452 Ga0495677_0143204 3300047445 Unclassified 918
453 Ga0495602_0089688 3300048088 Bacteria 2556
454 Ga0495614_0076400 3300048089 Unclassified 1448
455 Ga0496100_0002226 3300048903 Bacteria 9793
456 Ga0496100_0054615 3300048903 Bacteria 2606
457 Ga0496100_0083793 3300048903 Bacteria 2159
458 Ga0496100_0293278 3300048903 Bacteria 1216
459 Ga0496100_0339082 3300048903 Bacteria 1133
460 Ga0496101_0001928 3300048904 Bacteria 12558
461 Ga0496101_0005286 3300048904 Bacteria 8221
462 Ga0496101_0013807 3300048904 Bacteria 5421
463 Ga0496101_0019074 3300048904 Bacteria 4674
464 Ga0496101_0118996 3300048904 Bacteria 1995
465 Ga0496101_0190319 3300048904 Bacteria 1583
466 Ga0496102_0006057 3300048905 Bacteria 10307
467 Ga0496102_0010580 3300048905 Bacteria 7946
468 Ga0496102_0033148 3300048905 Bacteria 4641
469 Ga0496102_0522575 3300048905 Bacteria 1109
470 Ga0496102_0696565 3300048905 Bacteria 939
471 Ga0496103_0006441 3300048906 Bacteria 7007
472 Ga0496103_0008665 3300048906 Bacteria 6040
473 Ga0496103_0010790 3300048906 Bacteria 5406
474 Ga0496103_0056353 3300048906 Bacteria 2439
475 Ga0496103_0468450 3300048906 Bacteria 807
476 Ga0496104_0000566 3300048907 Bacteria 31603
477 Ga0496104_0006802 3300048907 Bacteria 10074
478 Ga0496104_0017549 3300048907 Bacteria 6520
479 Ga0496104_0029418 3300048907 Bacteria 5096
480 Ga0496104_0094453 3300048907 Bacteria 2861
481 Ga0496104_0118170 3300048907 Bacteria 2545
482 Ga0496105_0000834 3300048908 Bacteria 20972
483 Ga0496105_0002560 3300048908 Bacteria 13204
484 Ga0496105_0015288 3300048908 Bacteria 6112
485 Ga0496105_0163882 3300048908 Bacteria 1824
486 Ga0496105_0262249 3300048908 Bacteria 1397
487 Ga0496105_0420958 3300048908 Bacteria 1057
488 Ga0496106_0036103 3300048909 Bacteria 3697
489 Ga0496106_0044813 3300048909 Bacteria 3322
490 Ga0496106_0143988 3300048909 Bacteria 1876
491 Ga0496106_0148405 3300048909 Bacteria 1848
492 Ga0496106_0262834 3300048909 Bacteria 1381
493 Ga0496106_0389173 3300048909 Bacteria 1120
494 Ga0496106_0704912 3300048909 Bacteria 804
495 Ga0496107_0004351 3300048910 Bacteria 9590
496 Ga0496107_0013630 3300048910 Bacteria 5683
497 Ga0496107_0058502 3300048910 Bacteria 2787
498 Ga0496107_0084014 3300048910 Bacteria 2322
499 Ga0496108_0000906 3300048911 Bacteria 23091
500 Ga0496108_0003016 3300048911 Bacteria 13529
501 Ga0496108_0030054 3300048911 Bacteria 4503
502 Ga0496108_0039321 3300048911 Bacteria 3943
503 Ga0496108_0314805 3300048911 Bacteria 1364
504 Ga0496109_0000918 3300048912 Bacteria 24520
505 Ga0496109_0004615 3300048912 Bacteria 11500
506 Ga0496109_0010078 3300048912 Bacteria 8064
507 Ga0496109_0015392 3300048912 Bacteria 6664
508 Ga0496109_0159513 3300048912 Bacteria 2113
509 Ga0496109_0223676 3300048912 Bacteria 1770
510 Ga0496109_0255503 3300048912 Unclassified 1650
511 Ga0496109_0433492 3300048912 Bacteria 1242
512 Ga0496109_0480523 3300048912 Bacteria 1173
513 Ga0496110_0000951 3300048913 Bacteria 20276
514 Ga0496110_0000997 3300048913 Bacteria 19893
515 Ga0496110_0019486 3300048913 Bacteria 5711
516 Ga0496110_0062762 3300048913 Bacteria 3282
517 Ga0496110_0765062 3300048913 Bacteria 869
518 Ga0496111_0040361 3300048914 Bacteria 3348
519 Ga0496111_0041864 3300048914 Bacteria 3288
520 Ga0496111_0042712 3300048914 Bacteria 3256
521 Ga0496111_0046058 3300048914 Bacteria 3139
522 Ga0496111_0217071 3300048914 Bacteria 1421
523 Ga0496112_0004731 3300048915 Bacteria 11598
524 Ga0496112_0007006 3300048915 Bacteria 9953
525 Ga0496112_0122351 3300048915 Bacteria 2573
526 Ga0496112_0155896 3300048915 Bacteria 2250
527 Ga0496112_0194551 3300048915 Bacteria 1989
528 Ga0496112_0242081 3300048915 Bacteria 1756
529 Ga0496112_0337181 3300048915 Bacteria 1451
530 Ga0496112_0404062 3300048915 Unclassified 1305
531 Ga0496112_0675388 3300048915 Unclassified 962
532 Ga0496113_0058407 3300048916 Bacteria 2902
533 Ga0496113_0108149 3300048916 Bacteria 2161
534 Ga0496113_0383742 3300048916 Bacteria 1128
535 Ga0496114_0000593 3300048917 Bacteria 26747
536 Ga0496114_0025813 3300048917 Bacteria 4806
537 Ga0496114_0040482 3300048917 Bacteria 3858
538 Ga0496114_0088280 3300048917 Bacteria 2630
539 Ga0496114_0137003 3300048917 Bacteria 2117
540 Ga0496114_0406373 3300048917 Bacteria 1206
541 Ga0496114_0689506 3300048917 Bacteria 896
542 Ga0496114_0696934 3300048917 Bacteria 891
543 Ga0496115_0002543 3300048918 Bacteria 13114
544 Ga0496115_0002884 3300048918 Bacteria 12387
545 Ga0496115_0019711 3300048918 Bacteria 5193
546 Ga0496115_0125424 3300048918 Bacteria 2114
547 Ga0496115_0137736 3300048918 Bacteria 2013
548 Ga0501031_0000998 3300049568 Bacteria 17158
549 Ga0501031_0001019 3300049568 Bacteria 16974
550 Ga0501031_0117062 3300049568 Bacteria 1741
551 Ga0501031_0236908 3300049568 Bacteria 1187
552 Ga0501032_0013886 3300049569 Bacteria 5714
553 Ga0501032_0033846 3300049569 Unclassified 3500
554 Ga0501033_0000855 3300049570 Bacteria 27840
555 Ga0501033_0009029 3300049570 Bacteria 7690
556 Ga0501033_0010858 3300049570 Bacteria 6982
557 Ga0501034_0142535 3300049571 Bacteria 2375
558 Ga0501034_0306723 3300049571 Bacteria 1523
559 Ga0501036_0001208 3300049572 Bacteria 19722
560 Ga0501036_0004219 3300049572 Bacteria 11588
561 Ga0501036_0016938 3300049572 Bacteria 6088
562 Ga0501036_0073912 3300049572 Bacteria 2882
563 Ga0501037_0003662 3300049573 Bacteria 11151
564 Ga0501037_0041373 3300049573 Bacteria 3389
565 Ga0501037_0076955 3300049573 Unclassified 2421
566 Ga0501038_0006057 3300049574 Bacteria 11187
567 Ga0501038_0006640 3300049574 Bacteria 10701
568 Ga0501038_0064002 3300049574 Bacteria 3137
569 Ga0501039_0005133 3300049575 Bacteria 9922
570 Ga0501039_0007966 3300049575 Bacteria 8070
571 Ga0501039_0047840 3300049575 Bacteria 3306
572 Ga0501039_0144984 3300049575 Unclassified 1866
573 Ga0501040_0012142 3300049576 Bacteria 5641
574 Ga0501040_0025256 3300049576 Bacteria 3994
575 Ga0501040_0057094 3300049576 Bacteria 2679
576 Ga0501040_0064620 3300049576 Bacteria 2519
577 Ga0501040_0075534 3300049576 Bacteria 2329
578 Ga0501040_0114582 3300049576 Bacteria 1887
579 Ga0501040_0115581 3300049576 Bacteria 1878
580 Ga0501041_0002466 3300049577 Bacteria 10514
581 Ga0501041_0005018 3300049577 Bacteria 7708
582 Ga0501041_0005652 3300049577 Bacteria 7306
583 Ga0501041_0007796 3300049577 Bacteria 6289
584 Ga0501041_0300526 3300049577 Bacteria 1011
585 Ga0501041_0332190 3300049577 Bacteria 959
586 Ga0501041_0345098 3300049577 Bacteria 940
587 Ga0501042_0002378 3300049578 Bacteria 11530
588 Ga0501042_0006859 3300049578 Bacteria 7432
589 Ga0501042_0016392 3300049578 Bacteria 5084
590 Ga0501042_0046164 3300049578 Bacteria 3105
591 Ga0501042_0076123 3300049578 Bacteria 2402
592 Ga0501042_0249093 3300049578 Bacteria 1282
593 Ga0501042_0705699 3300049578 Bacteria 733
594 Ga0501043_0004119 3300049579 Bacteria 11873
595 Ga0501043_0011981 3300049579 Bacteria 6784
596 Ga0501046_0002825 3300049580 Bacteria 16174
597 Ga0501046_0014190 3300049580 Bacteria 6730
598 Ga0501046_0053824 3300049580 Bacteria 3168
599 Ga0501046_0071932 3300049580 Bacteria 2685
600 Ga0501046_0074670 3300049580 Bacteria 2630
601 Ga0501047_0065881 3300049581 Bacteria 3491
602 Ga0501047_0170617 3300049581 Unclassified 2044
603 Ga0501048_0011154 3300049582 Bacteria 6699
604 Ga0501048_0051025 3300049582 Bacteria 2945
605 Ga0501048_0058201 3300049582 Bacteria 2739
606 Ga0501048_0069000 3300049582 Bacteria 2497
607 Ga0501067_0038822 3300049583 Bacteria 2643
608 Ga0501068_0000148 3300049584 Bacteria 32186
609 Ga0501068_0021240 3300049584 Bacteria 3789
610 Ga0501068_0080211 3300049584 Bacteria 2002
611 Ga0501068_0257754 3300049584 Bacteria 1112
612 Ga0501069_0010320 3300049585 Bacteria 4943
613 Ga0501069_0013565 3300049585 Bacteria 4345
614 Ga0501069_0046825 3300049585 Bacteria 2399
615 Ga0501069_0357385 3300049585 Archaea 861
616 Ga0501070_0003232 3300049586 Bacteria 14177
617 Ga0501070_0003933 3300049586 Bacteria 12809
618 Ga0501070_0090349 3300049586 Bacteria 2535
619 Ga0501070_0140387 3300049586 Unclassified 1995
620 Ga0501070_0225261 3300049586 Bacteria 1537
621 Ga0501071_0002533 3300049587 Bacteria 11119
622 Ga0501071_0011669 3300049587 Bacteria 5930
623 Ga0501071_0019089 3300049587 Bacteria 4757
624 Ga0501071_0102503 3300049587 Bacteria 2110
625 Ga0501071_0184525 3300049587 Unclassified 1563
626 Ga0501071_0353138 3300049587 Bacteria 1119
627 Ga0501072_0001504 3300049588 Bacteria 17456
628 Ga0501072_0033122 3300049588 Bacteria 4048
629 Ga0501072_0045409 3300049588 Bacteria 3454
630 Ga0501072_0295577 3300049588 Bacteria 1287
631 Ga0501072_0298983 3300049588 Bacteria 1279
632 Ga0501072_0361378 3300049588 Bacteria 1152
633 Ga0501072_0502206 3300049588 Unclassified 959
634 Ga0501072_0894668 3300049588 Bacteria 694
635 Ga0501073_0001011 3300049589 Bacteria 20308
636 Ga0501073_0002391 3300049589 Bacteria 14041
637 Ga0501073_0176828 3300049589 Bacteria 1477
638 Ga0501074_0005272 3300049590 Bacteria 9306
639 Ga0501074_0005793 3300049590 Bacteria 8913
640 Ga0501074_0038937 3300049590 Bacteria 3443
641 Ga0501074_0067160 3300049590 Bacteria 2579
642 Ga0501074_0500150 3300049590 Bacteria 861
643 Ga0501075_0007514 3300049591 Bacteria 7559
644 Ga0501075_0015620 3300049591 Bacteria 5450
645 Ga0501075_0034637 3300049591 Bacteria 3760
646 Ga0501075_0112681 3300049591 Bacteria 2068
647 Ga0501076_0017659 3300049592 Bacteria 5423
648 Ga0501076_0021757 3300049592 Bacteria 4922
649 Ga0501076_0095098 3300049592 Bacteria 2399
650 Ga0501076_0109854 3300049592 Bacteria 2229
651 Ga0501076_0113070 3300049592 Bacteria 2196
652 Ga0501076_0129954 3300049592 Bacteria 2042
653 Ga0501077_0019023 3300049593 Bacteria 4342
654 Ga0501077_0023456 3300049593 Bacteria 3914
655 Ga0501077_0033890 3300049593 Bacteria 3250
656 Ga0501077_0303792 3300049593 Unclassified 1017
657 Ga0501079_0003411 3300049741 Bacteria 11671
658 Ga0501079_0033900 3300049741 Bacteria 3927
659 Ga0501079_0042817 3300049741 Bacteria 3496
660 Ga0501079_0188978 3300049741 Unclassified 1607
661 Ga0501080_0103269 3300049742 Bacteria 2643
662 Ga0501080_0168680 3300049742 Unclassified 2019
663 Ga0501080_0332773 3300049742 Bacteria 1373
664 Ga0501080_0535774 3300049742 Bacteria 1044
665 Ga0501080_0933246 3300049742 Bacteria 755
666 Ga0501080_1218056 3300049742 Bacteria 647
667 Ga0501081_0006202 3300049743 Bacteria 7745
668 Ga0501081_0009330 3300049743 Bacteria 6392
669 Ga0501081_0045782 3300049743 Bacteria 3004
670 Ga0501081_0077948 3300049743 Bacteria 2316
671 Ga0501081_0181236 3300049743 Bacteria 1524
672 Ga0501081_0316093 3300049743 Bacteria 1147
673 Ga0501081_0401045 3300049743 Bacteria 1015
674 Ga0501081_0821299 3300049743 Bacteria 700
675 Ga0501083_0004800 3300049744 Bacteria 9552
676 Ga0501083_0006150 3300049744 Bacteria 8518
677 Ga0501083_0420851 3300049744 Bacteria 869
678 Ga0501035_0002064 3300049822 Bacteria 19991
679 Ga0501035_0009792 3300049822 Bacteria 8905
680 Ga0501035_0013032 3300049822 Bacteria 7673
681 Ga0501044_0136261 3300049823 Bacteria 2446
682 Ga0501044_0183173 3300049823 Unclassified 2060
683 Ga0501044_0286127 3300049823 Bacteria 1581
684 Ga0501045_0000761 3300049824 Bacteria 20641
685 Ga0501045_0000918 3300049824 Bacteria 19240
686 Ga0501045_0166039 3300049824 Unclassified 1644
687 nmdc:mga0yw44_62906_c1 3300050492 Bacteria 2280
688 nmdc:mga0yw44_87676_c1 3300050492 Bacteria 1962
689 nmdc:mga06z11_439914_c1 3300050494 Unclassified 787
690 nmdc:mga05p37_110941_c1 3300050507 Bacteria 3374
691 nmdc:mga05p37_420276_c1 3300050507 Unclassified 1556
692 nmdc:mga05p37_530307_c1 3300050507 Bacteria 1345
693 nmdc:mga05p37_55907_c1 3300050507 Bacteria 4859
694 nmdc:mga05p37_747892_c1 3300050507 Bacteria 1078
695 nmdc:mga06r32_83319_c1 3300050510 Bacteria 3116
696 nmdc:mga08y16_126264_c1 3300050511 Bacteria 2661
697 nmdc:mga08y16_210428_c1 3300050511 Bacteria 2014
698 nmdc:mga08y16_238451_c1 3300050511 Unclassified 1880
699 nmdc:mga08y16_245742_c1 3300050511 Bacteria 1849
700 nmdc:mga08y16_27968_c1 3300050511 Bacteria 5944
701 nmdc:mga08y16_39726_c1 3300050511 Bacteria 4935
702 nmdc:mga08y16_872413_c1 3300050511 Bacteria 888
703 nmdc:mga0n895_113056_c1 3300050512 Bacteria 2732
704 nmdc:mga0n895_1215325_c1 3300050512 Unclassified 727
705 nmdc:mga0n895_183249_c1 3300050512 Bacteria 2125
706 nmdc:mga0n895_72129_c1 3300050512 Bacteria 3426
707 nmdc:mga0rr50_158996_c1 3300050513 Bacteria 1833
708 nmdc:mga0rr50_329453_c1 3300050513 Bacteria 1282
709 nmdc:mga0rr50_43767_c1 3300050513 Bacteria 3280
710 nmdc:mga0rr50_56657_c1 3300050513 Bacteria 2929
711 nmdc:mga0rr50_599508_c1 3300050513 Bacteria 939
712 nmdc:mga08x19_28961_c1 3300050514 Bacteria 3473
713 nmdc:mga08x19_30095_c1 3300050514 Bacteria 3409
714 nmdc:mga08x19_42636_c1 3300050514 Bacteria 2894
715 nmdc:mga0a205_104359_c1 3300050515 Bacteria 2734
716 nmdc:mga0a205_14592_c1 3300050515 Bacteria 7333
717 nmdc:mga0a205_27453_c1 3300050515 Bacteria 5437
718 Ga0495601_0307188 3300053077 Unclassified 1033
719 Ga0495612_0035415 3300053078 Bacteria 2024
720 Ga0495595_0030536 3300053084 Bacteria 2418
721 Ga0495619_0280102 3300053085 Bacteria 1155
722 Ga0501084_0002075 3300054114 Bacteria 15994
723 Ga0501084_0017188 3300054114 Bacteria 6009
724 Ga0501084_0044531 3300054114 Bacteria 3715
725 Ga0501084_0049638 3300054114 Bacteria 3512
726 Ga0501084_0083608 3300054114 Bacteria 2679
727 Ga0501084_0092396 3300054114 Bacteria 2540
728 Ga0501084_0126225 3300054114 Bacteria 2153
729 Ga0501084_0177581 3300054114 Bacteria 1797
730 Ga0501084_0433099 3300054114 Bacteria 1112
731 Ga0590071_074770 3300059421 Bacteria 838
732 Ga0590077_025113 3300059426 Bacteria 1282
733 Ga0501082_0001530 3300060353 Bacteria 20348
734 Ga0501082_0010704 3300060353 Bacteria 7896
735 Ga0501082_0032701 3300060353 Bacteria 4487
736 Ga0501082_0183510 3300060353 Bacteria 1820
737 Ga0501082_0190258 3300060353 Bacteria 1785
738 Ga0530510_0018892 3300061734 Bacteria 4888
739 Ga0530510_0025098 3300061734 Bacteria 4261
740 Ga0530510_0044723 3300061734 Bacteria 3200
741 Ga0530510_0167983 3300061734 Bacteria 1625
742 Ga0530510_0168585 3300061734 Unclassified 1621
743 Ga0530510_0289046 3300061734 Unclassified 1225
744 Ga0530510_0377076 3300061734 Bacteria 1067
745 Ga0068865_100318422
746 JGI25407J50210_10001359
747 Ga0068869_100549747
748 Ga0070680_100027894
749 Ga0070682_100088246
750 Ga0068868_100147955
751 Ga0070692_10372736
752 Ga0070692_10410583
753 Ga0070668_100207419
754 Ga0070671_100093071
755 Ga0070671_100332722
756 Ga0070674_100065328
757 Ga0070673_100092341
758 Ga0070673_100172073
759 Ga0070659_100347994
760 Ga0070667_100061744
761 Ga0070703_10001626
762 Ga0070709_10046599
763 Ga0070709_10046683
764 Ga0070714_100068582
765 Ga0070713_100067930
766 Ga0070710_10023408
767 Ga0070710_10024938
768 Ga0070710_10035004
769 Ga0070711_100226956
770 Ga0070705_100016464
771 Ga0070705_100179430
772 Ga0070705_100270778
773 Ga0070700_100173972
774 Ga0070694_100054704
775 Ga0070708_100060847
776 Ga0070708_100062644
777 Ga0070708_100076236
778 Ga0070708_100183403
779 Ga0070708_100704289
780 Ga0070678_100424800
781 Ga0070662_100293717
782 Ga0070681_10002438
783 Ga0070681_10751172
784 Ga0070685_10217194
785 Ga0070706_100005941
786 Ga0070706_100009560
787 Ga0070706_100094643
788 Ga0070706_100364819
789 Ga0070707_100001334
790 Ga0070707_100002726
791 Ga0070707_100043625
792 Ga0070707_100057163
793 Ga0070698_100010130
794 Ga0070698_100032297
795 Ga0070698_100043922
796 Ga0070698_100107819
797 Ga0070699_100047689
798 Ga0070699_100090373
799 Ga0070699_100128307
800 Ga0070699_100538361
801 Ga0070699_100601127
802 Ga0070679_100035588
803 Ga0070684_100000999
804 Ga0070697_100031410
805 Ga0070697_100053435
806 Ga0070697_100372039
807 Ga0070697_100426680
808 Ga0070686_100088858
809 Ga0070695_100019044
810 Ga0070695_100091435
811 Ga0070695_100328745
812 Ga0070696_100091837
813 Ga0070693_100194067
814 Ga0070704_100026128
815 Ga0070704_100088723
816 Ga0068855_100485342
817 Ga0070702_100014234
818 Ga0068864_100521808
819 Ga0068866_10208062
820 Ga0068861_100753961
821 Ga0081455_10076753
822 Ga0081455_10348696
823 Ga0081538_10000108
824 Ga0081538_10005692
825 Ga0081539_10001930
826 Ga0081539_10002329
827 Ga0081539_10007217
828 Ga0070717_10031572
829 Ga0075432_10049443
830 Ga0070715_10020292
831 Ga0070715_10034625
832 Ga0070716_100062590
833 Ga0070716_100094648
834 Ga0070716_100300928
835 Ga0070712_100001584
836 Ga0070712_100010323
837 Ga0070712_100415287
838 Ga0075367_10279676
839 Ga0068871_100040544
840 Ga0075428_100191176
841 Ga0075431_100040366
842 Ga0075433_10012724
843 Ga0075433_10022462
844 Ga0075433_10027727
845 Ga0075433_10045735
846 Ga0075434_100015007
847 Ga0075434_100101742
848 Ga0075434_100116801
849 Ga0075434_101466802
850 Ga0068865_100178702
851 Ga0075436_100009506
852 Ga0075436_100014894
853 Ga0075436_100106096
854 Ga0075436_100230056
855 Ga0075435_100018555
856 Ga0075435_100068139
857 Ga0075435_100273561
858 Ga0105240_11096606
859 Ga0111539_10025172
860 Ga0111539_10046599
861 Ga0111539_10046900
862 Ga0111539_10159063
863 Ga0111539_10249907
864 Ga0111539_10345196
865 Ga0111539_10882667
866 Ga0111539_11196939
867 Ga0105245_10015305
868 Ga0105245_10023866
869 Ga0105245_10075383
870 Ga0105245_10229710
871 Ga0105245_10261762
872 Ga0105245_10424012
873 Ga0105247_10155882
874 Ga0114129_10014214
875 Ga0114129_10043890
876 Ga0114129_10052066
877 Ga0114129_10082099
878 Ga0114129_10208334
879 Ga0114129_10443153
880 Ga0114129_10540901
881 Ga0105243_10012521
882 Ga0105243_10032390
883 Ga0105243_10134757
884 Ga0105243_10521530
885 Ga0105241_10049511
886 Ga0105241_10072313
887 Ga0105242_10094388
888 Ga0105242_10406407
889 Ga0105242_10658165
890 Ga0105242_10737529
891 Ga0105248_10037171
892 Ga0105248_10403846
893 Ga0105237_10623815
894 Ga0105238_10159235
895 Ga0105238_10459722
896 Ga0105249_10008550
897 Ga0105249_10526487
898 Ga0105239_10032166
899 Ga0105239_10123880
900 Ga0105246_10263965
901 Ga0157373_10464043
902 Ga0157374_10228958
903 Ga0157374_11121941
904 Ga0157378_10007435
905 Ga0157378_10075204
906 Ga0163162_10004079
907 Ga0163162_10748857
908 Ga0163162_10785427
909 Ga0157372_10523582
910 Ga0157372_11889507
911 Ga0157375_10021031
912 Ga0157375_10392474
913 Ga0157380_10013152
914 Ga0157380_10149391
915 Ga0157380_10873862
916 Ga0157377_10000547
917 Ga0157377_10044489
918 Ga0157379_10077823
919 Ga0157376_10091996
920 Ga0157376_10092560
921 Ga0157376_10613597
922 Ga0163161_10460549
923 Ga0206352_10068228
924 Ga0207653_10000490
925 Ga0207692_10006369
926 Ga0207692_10421873
927 Ga0207688_10022234
928 Ga0207685_10005258
929 Ga0207699_10011479
930 Ga0207699_10080045
931 Ga0207643_10402908
932 Ga0207684_10046295
933 Ga0207684_10064119
934 Ga0207684_10194921
935 Ga0207684_10235131
936 Ga0207684_10320056
937 Ga0207654_10324926
938 Ga0207707_10001682
939 Ga0207707_10641581
940 Ga0207693_10001093
941 Ga0207693_10018089
942 Ga0207693_10104597
943 Ga0207663_10163256
944 Ga0207663_10207937
945 Ga0207657_10292117
946 Ga0207657_10677980
947 Ga0207652_10023045
948 Ga0207652_10570240
949 Ga0207646_10004284
950 Ga0207646_10028310
951 Ga0207646_10112975
952 Ga0207646_10152081
953 Ga0207694_10365000
954 Ga0207659_10413259
955 Ga0207687_10731367
956 Ga0207700_10321308
957 Ga0207644_10435966
958 Ga0207690_10297131
959 Ga0207706_10352984
960 Ga0207686_10185443
961 Ga0207686_10804583
962 Ga0207709_10131623
963 Ga0207709_10286704
964 Ga0207704_10502029
965 Ga0207704_10774874
966 Ga0207665_10006442
967 Ga0207665_10007933
968 Ga0207665_10029397
969 Ga0207689_10146278
970 Ga0207661_10001078
971 Ga0207679_10102638
972 Ga0207651_10051831
973 Ga0207668_10065393
974 Ga0207640_10040028
975 Ga0207640_10991361
976 Ga0207678_10115142
977 Ga0207678_10516160
978 Ga0207708_10280714
979 Ga0207702_10036442
980 Ga0207676_11217205
981 Ga0207675_100012199
982 Ga0207675_100564647
983 Ga0207683_10005713
984 Ga0207683_10018838
985 Ga0207428_10011431
986 Ga0207428_10218953
987 Ga0207428_10387637
988 Ga0268266_10931819
989 Ga0307405_10249346
990 Ga0307412_10336352
991 Ga0307409_100152639
992 Ga0307416_100022997
993 Ga0307416_100502623
994 Ga0307416_101281646
995 Ga0307415_100055032
996 Ga0307415_100122564
997 Ga0373938_0001256
998 Ga0373929_0001057
999 Ga0373940_0009762
1000 Ga0373952_0003426
1001 Ga0373932_0007922
1002 Ga0373941_0072111
1003 Ga0373960_0000062
1004 Ga0373960_0217389
1005 Ga0373942_0001059
1006 Ga0373962_0000807
1007 Ga0373931_0003378
1008 Ga0373937_0119177
1009 Ga0395899_0004487
1010 Ga0395899_0027218
1011 Ga0395899_0030427
1012 Ga0395899_0042003
1013 Ga0395899_0051499
1014 Ga0395899_0083012
1015 Ga0395899_0173050
1016 Ga0395899_0260172
1017 Ga0395899_0274111
1018 Ga0395900_0003596
1019 Ga0395900_0004619
1020 Ga0395900_0005500
1021 Ga0395900_0006523
1022 Ga0395900_0007355
1023 Ga0395900_0013999
1024 Ga0395900_0022223
1025 Ga0395900_0063227
1026 Ga0395900_0067970
1027 Ga0395900_0101888
1028 Ga0395900_0122623
1029 Ga0395900_0149150
1030 Ga0395900_0309996
1031 Ga0395900_0392127
1032 Ga0395900_0649608
1033 Ga0395900_0667236
1034 Ga0395900_0822431
1035 Ga0395898_0002928
1036 Ga0395898_0005497
1037 Ga0395898_0007699
1038 Ga0395898_0010458
1039 Ga0395898_0033721
1040 Ga0395898_0038499
1041 Ga0395898_0047144
1042 Ga0395898_0094226
1043 Ga0395898_0135769
1044 Ga0395898_0224913
1045 Ga0395898_0225700
1046 Ga0395898_0557624
1047 Ga0395898_0596639
1048 Ga0395898_0741998
1049 Ga0395905_0000698
1050 Ga0395905_0004158
1051 Ga0395905_0006203
1052 Ga0395905_0008142
1053 Ga0395905_0014202
1054 Ga0395905_0024444
1055 Ga0395905_0057327
1056 Ga0395905_0058621
1057 Ga0395905_0077468
1058 Ga0395905_0107293
1059 Ga0395905_0136940
1060 Ga0395905_0209971
1061 Ga0395905_0254626
1062 Ga0395905_0361665
1063 Ga0395905_0513991
1064 Ga0395905_0599404
1065 Ga0395905_0677744
1066 Ga0395905_0745391
1067 Ga0395901_0002126
1068 Ga0395901_0002813
1069 Ga0395901_0007390
1070 Ga0395901_0008689
1071 Ga0395901_0009435
1072 Ga0395901_0027813
1073 Ga0395901_0028131
1074 Ga0395901_0032458
1075 Ga0395901_0036191
1076 Ga0395901_0063593
1077 Ga0395901_0080272
1078 Ga0395901_0151680
1079 Ga0395901_0262357
1080 Ga0395901_0266090
1081 Ga0395901_0294464
1082 Ga0395901_0302204
1083 Ga0395901_0329910
1084 Ga0395901_0342076
1085 Ga0395901_0411528
1086 Ga0395901_0592113
1087 Ga0395901_0605725
1088 Ga0395901_1133507
1089 Ga0395901_1182824
1090 Ga0439436_0071878
1091 Ga0439438_034504
1092 Ga0439439_0008885
1093 Ga0439447_040774
1094 Ga0439466_0059627
1095 Ga0451793_0909242
1096 Ga0451798_0435415
1097 Ga0451806_265883
1098 Ga0451804_0258854
1099 Ga0451807_1638120
1100 Ga0451833_0945614
1101 Ga0451835_0458117
1102 Ga0451839_0867368
1103 Ga0451845_0285290
1104 Ga0451847_0859819
1105 Ga0451849_0672773
1106 Ga0451851_0150755
1107 Ga0451853_0771226
1108 Ga0439431_0020842
1109 Ga0439433_0024227
1110 Ga0439445_0035206
1111 Ga0439445_0086121
1112 Ga0439449_0072142
1113 Ga0439451_028786
1114 Ga0439452_039830
1115 Ga0450920_015488
1116 Ga0450920_066898
1117 Ga0450896_050972
1118 Ga0450907_008100
1119 Ga0439446_0000352
1120 Ga0439446_0000968
1121 Ga0439434_0023966
1122 Ga0439434_0031337
1123 Ga0439434_0100989
1124 Ga0439434_0112733
1125 Ga0466965_0151638
1126 Ga0466961_0074340
1127 Ga0466964_0005579
1128 Ga0466964_0252620
1129 Ga0466960_0024247
1130 Ga0466960_0064320
1131 Ga0466967_0013271
1132 Ga0466967_0425937
1133 Ga0466967_0554363
1134 Ga0466967_1032325
1135 Ga0495592_0214220
1136 Ga0495603_0042086
1137 Ga0495603_0284712
1138 Ga0495641_0051480
1139 Ga0495641_0204702
1140 Ga0495651_0163268
1141 Ga0495651_0444441
1142 Ga0495653_0147862
1143 Ga0495653_0321448
1144 Ga0495582_0014637
1145 Ga0495605_0081869
1146 Ga0495639_0100781
1147 Ga0495664_0321011
1148 Ga0495584_0027475
1149 Ga0495594_0096007
1150 Ga0495596_0202349
1151 Ga0495607_0196640
1152 Ga0495583_0120521
1153 Ga0495608_0052876
1154 Ga0495628_0034233
1155 Ga0495630_0067437
1156 Ga0495630_0111430
1157 Ga0495637_0211199
1158 Ga0495637_0223383
1159 Ga0495663_0014171
1160 Ga0495642_0024232
1161 Ga0495642_0194000
1162 Ga0495652_0115298
1163 Ga0495665_0069709
1164 Ga0495609_0074215
1165 Ga0495667_0065192
1166 Ga0495667_0153584
1167 Ga0495667_0408786
1168 Ga0495656_0145678
1169 Ga0495656_0177046
1170 Ga0495656_0225845
1171 Ga0495656_0389845
1172 Ga0495668_0330734
1173 Ga0495611_0345389
1174 Ga0495661_0052112
1175 Ga0495588_0070907
1176 Ga0495588_0142904
1177 Ga0495657_0090947
1178 Ga0495623_0191464
1179 Ga0495646_0386432
1180 Ga0495647_0034228
1181 Ga0495658_0045851
1182 Ga0495613_0263525
1183 Ga0495670_0251292
1184 Ga0495671_0135175
1185 Ga0495589_0032602
1186 Ga0495589_0066443
1187 Ga0495581_0003093
1188 Ga0495604_0025418
1189 Ga0495636_0036085
1190 Ga0495674_0111005
1191 Ga0495674_0138848
1192 Ga0495674_0189519
1193 Ga0495676_0069959
1194 Ga0495676_0280723
1195 Ga0495680_0365480
1196 Ga0495677_0143204
1197 Ga0495602_0089688
1198 Ga0495614_0076400
1199 Ga0496100_0002226
1200 Ga0496100_0054615
1201 Ga0496100_0083793
1202 Ga0496100_0293278
1203 Ga0496100_0339082
1204 Ga0496101_0001928
1205 Ga0496101_0005286
1206 Ga0496101_0013807
1207 Ga0496101_0019074
1208 Ga0496101_0118996
1209 Ga0496101_0190319
1210 Ga0496102_0006057
1211 Ga0496102_0010580
1212 Ga0496102_0033148
1213 Ga0496102_0522575
1214 Ga0496102_0696565
1215 Ga0496103_0006441
1216 Ga0496103_0008665
1217 Ga0496103_0010790
1218 Ga0496103_0056353
1219 Ga0496103_0468450
1220 Ga0496104_0000566
1221 Ga0496104_0006802
1222 Ga0496104_0017549
1223 Ga0496104_0029418
1224 Ga0496104_0094453
1225 Ga0496104_0118170
1226 Ga0496105_0000834
1227 Ga0496105_0002560
1228 Ga0496105_0015288
1229 Ga0496105_0163882
1230 Ga0496105_0262249
1231 Ga0496105_0420958
1232 Ga0496106_0036103
1233 Ga0496106_0044813
1234 Ga0496106_0143988
1235 Ga0496106_0148405
1236 Ga0496106_0262834
1237 Ga0496106_0389173
1238 Ga0496106_0704912
1239 Ga0496107_0004351
1240 Ga0496107_0013630
1241 Ga0496107_0058502
1242 Ga0496107_0084014
1243 Ga0496108_0000906
1244 Ga0496108_0003016
1245 Ga0496108_0030054
1246 Ga0496108_0039321
1247 Ga0496108_0314805
1248 Ga0496109_0000918
1249 Ga0496109_0004615
1250 Ga0496109_0010078
1251 Ga0496109_0015392
1252 Ga0496109_0159513
1253 Ga0496109_0223676
1254 Ga0496109_0255503
1255 Ga0496109_0433492
1256 Ga0496109_0480523
1257 Ga0496110_0000951
1258 Ga0496110_0000997
1259 Ga0496110_0019486
1260 Ga0496110_0062762
1261 Ga0496110_0765062
1262 Ga0496111_0040361
1263 Ga0496111_0041864
1264 Ga0496111_0042712
1265 Ga0496111_0046058
1266 Ga0496111_0217071
1267 Ga0496112_0004731
1268 Ga0496112_0007006
1269 Ga0496112_0122351
1270 Ga0496112_0155896
1271 Ga0496112_0194551
1272 Ga0496112_0242081
1273 Ga0496112_0337181
1274 Ga0496112_0404062
1275 Ga0496112_0675388
1276 Ga0496113_0058407
1277 Ga0496113_0108149
1278 Ga0496113_0383742
1279 Ga0496114_0000593
1280 Ga0496114_0025813
1281 Ga0496114_0040482
1282 Ga0496114_0088280
1283 Ga0496114_0137003
1284 Ga0496114_0406373
1285 Ga0496114_0689506
1286 Ga0496114_0696934
1287 Ga0496115_0002543
1288 Ga0496115_0002884
1289 Ga0496115_0019711
1290 Ga0496115_0125424
1291 Ga0496115_0137736
1292 Ga0501031_0000998
1293 Ga0501031_0001019
1294 Ga0501031_0117062
1295 Ga0501031_0236908
1296 Ga0501032_0013886
1297 Ga0501032_0033846
1298 Ga0501033_0000855
1299 Ga0501033_0009029
1300 Ga0501033_0010858
1301 Ga0501034_0142535
1302 Ga0501034_0306723
1303 Ga0501036_0001208
1304 Ga0501036_0004219
1305 Ga0501036_0016938
1306 Ga0501036_0073912
1307 Ga0501037_0003662
1308 Ga0501037_0041373
1309 Ga0501037_0076955
1310 Ga0501038_0006057
1311 Ga0501038_0006640
1312 Ga0501038_0064002
1313 Ga0501039_0005133
1314 Ga0501039_0007966
1315 Ga0501039_0047840
1316 Ga0501039_0144984
1317 Ga0501040_0012142
1318 Ga0501040_0025256
1319 Ga0501040_0057094
1320 Ga0501040_0064620
1321 Ga0501040_0075534
1322 Ga0501040_0114582
1323 Ga0501040_0115581
1324 Ga0501041_0002466
1325 Ga0501041_0005018
1326 Ga0501041_0005652
1327 Ga0501041_0007796
1328 Ga0501041_0300526
1329 Ga0501041_0332190
1330 Ga0501041_0345098
1331 Ga0501042_0002378
1332 Ga0501042_0006859
1333 Ga0501042_0016392
1334 Ga0501042_0046164
1335 Ga0501042_0076123
1336 Ga0501042_0249093
1337 Ga0501042_0705699
1338 Ga0501043_0004119
1339 Ga0501043_0011981
1340 Ga0501046_0002825
1341 Ga0501046_0014190
1342 Ga0501046_0053824
1343 Ga0501046_0071932
1344 Ga0501046_0074670
1345 Ga0501047_0065881
1346 Ga0501047_0170617
1347 Ga0501048_0011154
1348 Ga0501048_0051025
1349 Ga0501048_0058201
1350 Ga0501048_0069000
1351 Ga0501067_0038822
1352 Ga0501068_0000148
1353 Ga0501068_0021240
1354 Ga0501068_0080211
1355 Ga0501068_0257754
1356 Ga0501069_0010320
1357 Ga0501069_0013565
1358 Ga0501069_0046825
1359 Ga0501069_0357385
1360 Ga0501070_0003232
1361 Ga0501070_0003933
1362 Ga0501070_0090349
1363 Ga0501070_0140387
1364 Ga0501070_0225261
1365 Ga0501071_0002533
1366 Ga0501071_0011669
1367 Ga0501071_0019089
1368 Ga0501071_0102503
1369 Ga0501071_0184525
1370 Ga0501071_0353138
1371 Ga0501072_0001504
1372 Ga0501072_0033122
1373 Ga0501072_0045409
1374 Ga0501072_0295577
1375 Ga0501072_0298983
1376 Ga0501072_0361378
1377 Ga0501072_0502206
1378 Ga0501072_0894668
1379 Ga0501073_0001011
1380 Ga0501073_0002391
1381 Ga0501073_0176828
1382 Ga0501074_0005272
1383 Ga0501074_0005793
1384 Ga0501074_0038937
1385 Ga0501074_0067160
1386 Ga0501074_0500150
1387 Ga0501075_0007514
1388 Ga0501075_0015620
1389 Ga0501075_0034637
1390 Ga0501075_0112681
1391 Ga0501076_0017659
1392 Ga0501076_0021757
1393 Ga0501076_0095098
1394 Ga0501076_0109854
1395 Ga0501076_0113070
1396 Ga0501076_0129954
1397 Ga0501077_0019023
1398 Ga0501077_0023456
1399 Ga0501077_0033890
1400 Ga0501077_0303792
1401 Ga0501079_0003411
1402 Ga0501079_0033900
1403 Ga0501079_0042817
1404 Ga0501079_0188978
1405 Ga0501080_0103269
1406 Ga0501080_0168680
1407 Ga0501080_0332773
1408 Ga0501080_0535774
1409 Ga0501080_0933246
1410 Ga0501080_1218056
1411 Ga0501081_0006202
1412 Ga0501081_0009330
1413 Ga0501081_0045782
1414 Ga0501081_0077948
1415 Ga0501081_0181236
1416 Ga0501081_0316093
1417 Ga0501081_0401045
1418 Ga0501081_0821299
1419 Ga0501083_0004800
1420 Ga0501083_0006150
1421 Ga0501083_0420851
1422 Ga0501035_0002064
1423 Ga0501035_0009792
1424 Ga0501035_0013032
1425 Ga0501044_0136261
1426 Ga0501044_0183173
1427 Ga0501044_0286127
1428 Ga0501045_0000761
1429 Ga0501045_0000918
1430 Ga0501045_0166039
1431 nmdc:mga0yw44_62906_c1
1432 nmdc:mga0yw44_87676_c1
1433 nmdc:mga06z11_439914_c1
1434 nmdc:mga05p37_110941_c1
1435 nmdc:mga05p37_420276_c1
1436 nmdc:mga05p37_530307_c1
1437 nmdc:mga05p37_55907_c1
1438 nmdc:mga05p37_747892_c1
1439 nmdc:mga06r32_83319_c1
1440 nmdc:mga08y16_126264_c1
1441 nmdc:mga08y16_210428_c1
1442 nmdc:mga08y16_238451_c1
1443 nmdc:mga08y16_245742_c1
1444 nmdc:mga08y16_27968_c1
1445 nmdc:mga08y16_39726_c1
1446 nmdc:mga08y16_872413_c1
1447 nmdc:mga0n895_113056_c1
1448 nmdc:mga0n895_1215325_c1
1449 nmdc:mga0n895_183249_c1
1450 nmdc:mga0n895_72129_c1
1451 nmdc:mga0rr50_158996_c1
1452 nmdc:mga0rr50_329453_c1
1453 nmdc:mga0rr50_43767_c1
1454 nmdc:mga0rr50_56657_c1
1455 nmdc:mga0rr50_599508_c1
1456 nmdc:mga08x19_28961_c1
1457 nmdc:mga08x19_30095_c1
1458 nmdc:mga08x19_42636_c1
1459 nmdc:mga0a205_104359_c1
1460 nmdc:mga0a205_14592_c1
1461 nmdc:mga0a205_27453_c1
1462 Ga0495601_0307188
1463 Ga0495612_0035415
1464 Ga0495595_0030536
1465 Ga0495619_0280102
1466 Ga0501084_0002075
1467 Ga0501084_0017188
1468 Ga0501084_0044531
1469 Ga0501084_0049638
1470 Ga0501084_0083608
1471 Ga0501084_0092396
1472 Ga0501084_0126225
1473 Ga0501084_0177581
1474 Ga0501084_0433099
1475 Ga0590071_074770
1476 Ga0590077_025113
1477 Ga0501082_0001530
1478 Ga0501082_0010704
1479 Ga0501082_0032701
1480 Ga0501082_0183510
1481 Ga0501082_0190258
1482 Ga0530510_0018892
1483 Ga0530510_0025098
1484 Ga0530510_0044723
1485 Ga0530510_0167983
1486 Ga0530510_0168585
1487 Ga0530510_0289046
1488 Ga0530510_0377076

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

44

90

0.97

PF17932

TetR_C_24

Tetracyclin repressor-like, C-terminal domain

109

198

0.91

PF17938

TetR_C_29

Tetracyclin repressor-like, C-terminal domain

113

221

0.89

PF08359

TetR_C_4

YsiA-like protein, C-terminal region

91

224

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gpa-assembly1.cif.gz_A structural analysis of fatty acid degradation regulator fadr from bacillus halodurans 0.8815 14 199
3vpr-assembly2.cif.gz_C crystal structure of a tetr family transcriptional regulator pfmr from thermus thermophilus hb8 0.8734 15 198
3whc-assembly2.cif.gz_D crystal structure of a transcriptional regulator fadr from bacillus subtilis in complex with stearoyl-coa 0.8652 11 198
3vpr-assembly2.cif.gz_D crystal structure of a tetr family transcriptional regulator pfmr from thermus thermophilus hb8 0.8645 12 199
5gpa-assembly1.cif.gz_B structural analysis of fatty acid degradation regulator fadr from bacillus halodurans 0.8618 14 197
ID Description Score Start End Superfamily
3whbA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 1.008 10 53 1.10.10.60
3whcD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 1.005 11 53 1.10.10.60
5gpaA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 1.004 14 53 1.10.10.60
5gpaB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9988 14 53 1.10.10.60
3whcB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9978 11 53 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A538JXR9-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9799 2 199 GO:0000976
GO:0003700
AF-A0A538MU75-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9769 2 199 GO:0000976
GO:0003700
AF-A0A538DL25-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9761 1 199 GO:0000976
GO:0003700
AF-A0A537ZS25-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9749 9 199 GO:0000976
GO:0003700
AF-A0A538DL25-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9713 1 199 GO:0000976
GO:0003700

Map