F478600

General Info

Members Datasets Scaffolds Average Seq Length
741 286 1482 230

Family's Representative Sequence

Representative Sequence 3300042137|Ga0450902_000126|Ga0450902_000126_2101_2853
Length 250
Sequence MKMTMAMESDLMKALMVMASLLLLGGCATDGQAPWTTMLAPASCSKLSSEQELSLNLADDLVNDGKLHASLANLQSLPDNLVEVRLRKAKVYRLLGRSEAEPLYRSLLGTCLNADAEHGLGQLYAARGDNGQAQAHLQRAARLAPTNENIRNDLGVVYLNQLRLEDARFEFLTAIELKQNNQLATLNLVTLLLYQNNWQQAAEVVSRAHLTPEQFSDAQERAEKLKSPVRARPVAGNQVAVAIDAQPAIK

Samples

Sample ID Description Type Environment
1 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
24 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
25 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
26 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
27 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
32 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
33 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
42 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
43 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
46 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
48 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
49 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
50 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
68 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
71 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
72 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
73 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
74 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
82 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
83 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
84 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
85 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
86 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
87 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
88 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
89 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
90 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
91 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
92 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
93 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
94 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
95 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
96 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
97 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
98 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
99 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
100 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
101 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
102 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
103 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
104 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
105 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
108 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
109 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
110 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
111 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
112 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
113 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
114 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
115 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
116 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
117 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
118 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
119 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
120 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
121 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
122 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
123 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
124 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
125 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
126 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
127 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
128 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
129 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
130 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
131 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
132 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
133 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
134 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
135 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
136 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
137 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
143 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
148 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
149 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
150 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
151 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
160 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
161 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
162 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
163 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
164 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
165 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
166 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
167 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
168 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
169 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
170 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
178 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
181 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
184 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
185 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
186 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
189 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
190 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
191 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
192 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
193 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
194 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
195 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
196 2511231010 Pseudomonas sp. GM25 Isolate Nodule
197 2511231011 Pseudomonas sp. GM30 Isolate Nodule
198 2511231021 Pseudomonas sp. GM78 Isolate Nodule
199 2511231023 Pseudomonas sp. GM80 Isolate Nodule
200 2511231031 Pseudomonas sp. GM16 Isolate Nodule
201 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
202 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
203 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
204 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
205 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
206 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
207 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
208 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
209 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
210 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
211 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
212 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
213 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
214 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
215 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
216 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
217 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
218 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
219 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
220 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
221 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
222 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
223 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
224 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
225 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
226 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
227 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
228 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
229 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
230 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
231 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
232 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
233 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
234 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
235 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
236 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
237 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
238 2773857673 Pseudomonas sp. 443 Isolate Unclassified
239 2784132063 Pseudomonas sp. 424 Isolate Unclassified
240 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
241 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
242 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
243 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
244 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
245 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
246 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
247 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
248 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
249 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
250 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
251 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
252 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
253 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
254 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
255 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
256 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
257 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
258 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
259 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
260 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
261 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
262 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
263 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
264 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
265 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
266 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
267 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
268 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
269 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
270 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
271 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
272 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
273 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
274 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
275 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
276 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
277 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
278 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
279 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
280 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
281 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
282 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
283 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
284 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
285 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
286 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.72
Metatranscriptomes 0
Isolates 12.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.37
Nodule 1.08
Rhizoplane 4.32
Rhizosphere 78.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0450902_000126 3300042137 Bacteria 8236
2 JGI25162J39368_1000195 3300002737 Bacteria 63625
3 JGI25163J39215_1000123 3300002771 Bacteria 32339
4 JGI25164J39214_1000225 3300002772 Bacteria 44028
5 JGI25165J46597_1000291 3300003214 Bacteria 63625
6 Ga0055536_1000299 3300003781 Bacteria 37245
7 Ga0055536_1002690 3300003781 Bacteria 9864
8 Ga0055530_10000340 3300003791 Bacteria 42245
9 Ga0055540_1000162 3300003792 Bacteria 66694
10 Ga0055531_10000734 3300003794 Bacteria 27738
11 Ga0065714_10005355 3300005288 Bacteria 4141
12 Ga0065714_10064550 3300005288 Bacteria 37462
13 Ga0065714_10095920 3300005288 Bacteria 1774
14 Ga0065704_10101121 3300005289 Bacteria 2249
15 Ga0065712_10091402 3300005290 Bacteria 2375
16 Ga0070670_100001980 3300005331 Bacteria 16755
17 Ga0070669_100000487 3300005353 Bacteria 30089
18 Ga0070669_100000956 3300005353 Bacteria 21096
19 Ga0070662_100000137 3300005457 Bacteria 41312
20 Ga0070662_100014133 3300005457 Bacteria 5327
21 Ga0068853_100003083 3300005539 Bacteria 12733
22 Ga0070665_100044833 3300005548 Bacteria 4440
23 Ga0070665_100180913 3300005548 Bacteria 2109
24 Ga0070664_100004017 3300005564 Bacteria 11813
25 Ga0068854_100052077 3300005578 Bacteria 2934
26 Ga0068851_10000004 3300005834 Bacteria 269685
27 Ga0075363_100195622 3300006048 Bacteria 1154
28 Ga0075364_10023533 3300006051 Bacteria 3901
29 Ga0075432_10001534 3300006058 Bacteria 7573
30 Ga0079104_1008163 3300006946 Bacteria 3701
31 Ga0105251_10000378 3300009011 Bacteria 43722
32 Ga0105251_10001590 3300009011 Bacteria 19393
33 Ga0105251_10002232 3300009011 Bacteria 15456
34 Ga0105251_10002448 3300009011 Bacteria 14586
35 Ga0105251_10004027 3300009011 Bacteria 10360
36 Ga0105251_10005274 3300009011 Bacteria 8502
37 Ga0105251_10011087 3300009011 Bacteria 5170
38 Ga0105251_10011613 3300009011 Bacteria 5025
39 Ga0105251_10025992 3300009011 Bacteria 2986
40 Ga0105251_10195102 3300009011 Bacteria 912
41 Ga0105244_10001726 3300009036 Bacteria 17210
42 Ga0105244_10003786 3300009036 Bacteria 10673
43 Ga0105244_10012893 3300009036 Bacteria 4919
44 Ga0105244_10029320 3300009036 Bacteria 2943
45 Ga0105244_10134580 3300009036 Bacteria 1191
46 Ga0105250_10001060 3300009092 Bacteria 15713
47 Ga0105250_10001756 3300009092 Bacteria 11420
48 Ga0105250_10002278 3300009092 Bacteria 9754
49 Ga0105250_10015196 3300009092 Bacteria 3154
50 Ga0105250_10015343 3300009092 Bacteria 3137
51 Ga0105250_10015500 3300009092 Bacteria 3121
52 Ga0105243_10000225 3300009148 Bacteria 65179
53 Ga0105243_10001399 3300009148 Bacteria 21339
54 Ga0105243_10051250 3300009148 Bacteria 3264
55 Ga0105248_10013078 3300009177 Bacteria 9140
56 Ga0105239_10367155 3300010375 Bacteria 1626
57 Ga0105246_10000388 3300011119 Bacteria 23524
58 Ga0105246_10001581 3300011119 Bacteria 13546
59 Ga0105246_10005439 3300011119 Bacteria 7759
60 Ga0157345_1000032 3300012498 Bacteria 34992
61 Ga0157373_10000478 3300013100 Bacteria 31776
62 Ga0157373_10000520 3300013100 Bacteria 30210
63 Ga0157373_10000957 3300013100 Bacteria 22395
64 Ga0157373_10001143 3300013100 Bacteria 20374
65 Ga0157373_10003846 3300013100 Bacteria 11351
66 Ga0157373_10004155 3300013100 Bacteria 10919
67 Ga0157373_10041792 3300013100 Bacteria 3279
68 Ga0157373_10063759 3300013100 Bacteria 2609
69 Ga0157371_10001273 3300013102 Bacteria 26580
70 Ga0157371_10002656 3300013102 Bacteria 16922
71 Ga0157371_10004342 3300013102 Bacteria 12430
72 Ga0157371_10012005 3300013102 Bacteria 6640
73 Ga0157370_10056395 3300013104 Bacteria 3739
74 Ga0157370_10124707 3300013104 Bacteria 2404
75 Ga0157370_10252986 3300013104 Bacteria 1629
76 Ga0157370_10297740 3300013104 Bacteria 1489
77 Ga0157369_10001544 3300013105 Bacteria 28184
78 Ga0157369_10002672 3300013105 Bacteria 21260
79 Ga0157369_10009425 3300013105 Bacteria 11160
80 Ga0157369_10025492 3300013105 Bacteria 6566
81 Ga0157369_10089566 3300013105 Bacteria 3285
82 Ga0157369_10093228 3300013105 Bacteria 3215
83 Ga0163162_10000902 3300013306 Bacteria 27672
84 Ga0163162_10001902 3300013306 Bacteria 19672
85 Ga0163162_10027322 3300013306 Bacteria 5643
86 Ga0163162_10079639 3300013306 Bacteria 3342
87 Ga0163162_10109707 3300013306 Bacteria 2856
88 Ga0157372_10001315 3300013307 Bacteria 26899
89 Ga0157375_10030722 3300013308 Bacteria 5069
90 Ga0157375_10421181 3300013308 Bacteria 1501
91 Ga0182008_10000453 3300014497 Bacteria 31306
92 Ga0182008_10002063 3300014497 Bacteria 12875
93 Ga0182008_10002202 3300014497 Bacteria 12361
94 Ga0182008_10003707 3300014497 Bacteria 9113
95 Ga0182008_10003797 3300014497 Bacteria 8976
96 Ga0182006_1000793 3300015261 Bacteria 21248
97 Ga0182006_1001453 3300015261 Bacteria 14278
98 Ga0182006_1019703 3300015261 Bacteria 2837
99 Ga0182006_1062786 3300015261 Bacteria 1397
100 Ga0182006_1089673 3300015261 Bacteria 1108
101 Ga0182006_1089847 3300015261 Bacteria 1107
102 Ga0182006_1098899 3300015261 Bacteria 1038
103 Ga0182007_10000283 3300015262 Bacteria 33739
104 Ga0182007_10056599 3300015262 Bacteria 1288
105 Ga0182005_1014025 3300015265 Bacteria 2248
106 Ga0182005_1053790 3300015265 Bacteria 1096
107 Ga0182005_1055009 3300015265 Bacteria 1084
108 Ga0163161_10002587 3300017792 Bacteria 12909
109 Ga0163161_10002849 3300017792 Bacteria 12268
110 Ga0163161_10004085 3300017792 Bacteria 10210
111 Ga0163161_10006965 3300017792 Bacteria 7815
112 Ga0163161_10010903 3300017792 Bacteria 6301
113 Ga0163161_10018631 3300017792 Bacteria 4866
114 Ga0163161_10037911 3300017792 Bacteria 3455
115 Ga0163161_10234423 3300017792 Bacteria 1425
116 Ga0163161_10281818 3300017792 Bacteria 1304
117 Ga0163161_10292061 3300017792 Bacteria 1282
118 Ga0209760_100031 3300025207 Bacteria 141487
119 Ga0209563_101022 3300025230 Bacteria 8139
120 Ga0207427_100067 3300025231 Bacteria 164839
121 Ga0209437_100016 3300025233 Bacteria 710118
122 Ga0209233_1000156 3300025261 Bacteria 164839
123 Ga0209675_1008238 3300025291 Bacteria 3864
124 Ga0209676_1000025 3300025292 Bacteria 577569
125 Ga0209676_1000426 3300025292 Bacteria 73938
126 Ga0209050_1000500 3300025298 Bacteria 66746
127 Ga0209051_1000089 3300025303 Bacteria 175572
128 Ga0209257_1000034 3300025304 Bacteria 662719
129 Ga0207656_10000007 3300025321 Bacteria 289154
130 Ga0207696_1000085 3300025711 Bacteria 195968
131 Ga0207696_1000494 3300025711 Bacteria 33110
132 Ga0207696_1002204 3300025711 Bacteria 9758
133 Ga0207696_1014255 3300025711 Bacteria 2734
134 Ga0207696_1022429 3300025711 Bacteria 2006
135 Ga0207655_1000946 3300025728 Bacteria 30094
136 Ga0207655_1002034 3300025728 Bacteria 17088
137 Ga0207655_1002631 3300025728 Bacteria 14222
138 Ga0207655_1013895 3300025728 Bacteria 4589
139 Ga0207713_1000323 3300025735 Bacteria 54106
140 Ga0207713_1000494 3300025735 Bacteria 40630
141 Ga0207713_1000540 3300025735 Bacteria 37977
142 Ga0207713_1001743 3300025735 Bacteria 16708
143 Ga0207713_1001804 3300025735 Bacteria 16362
144 Ga0207713_1002389 3300025735 Bacteria 13716
145 Ga0207713_1004120 3300025735 Bacteria 9571
146 Ga0207713_1007421 3300025735 Bacteria 6472
147 Ga0207713_1057402 3300025735 Bacteria 1505
148 Ga0207681_10001305 3300025923 Bacteria 16063
149 Ga0207681_10002871 3300025923 Bacteria 10884
150 Ga0207650_10000073 3300025925 Bacteria 137141
151 Ga0207706_10000178 3300025933 Bacteria 70787
152 Ga0207706_10024333 3300025933 Bacteria 5428
153 Ga0207709_10000022 3300025935 Bacteria 383573
154 Ga0207709_10000634 3300025935 Bacteria 28758
155 Ga0207711_10102403 3300025941 Bacteria 2535
156 Ga0207679_10031482 3300025945 Bacteria 3713
157 Ga0207640_10249701 3300025981 Bacteria 1376
158 Ga0207639_10014912 3300026041 Bacteria 5474
159 Ga0209281_1006417 3300027111 Bacteria 3073
160 Ga0207428_10111887 3300027907 Bacteria 2101
161 Ga0268266_10084356 3300028379 Bacteria 2774
162 Ga0268266_10223068 3300028379 Bacteria 1733
163 Ga0268266_10287500 3300028379 Bacteria 1530
164 Ga0307517_10024989 3300028786 Bacteria 7330
165 Ga0307515_10373416 3300028794 Bacteria 1062
166 Ga0307511_10142496 3300030521 Bacteria 1403
167 Ga0316178_1157834 3300030735 Bacteria 9732
168 Ga0307509_10025355 3300031507 Bacteria 6623
169 Ga0307408_100009264 3300031548 Bacteria 6490
170 Ga0307516_10280580 3300031730 Bacteria 1348
171 Ga0307405_10000102 3300031731 Bacteria 35010
172 Ga0307412_10006331 3300031911 Bacteria 6685
173 Ga0307412_10087703 3300031911 Bacteria 2168
174 Ga0307414_10317061 3300032004 Bacteria 1325
175 Ga0307411_10055804 3300032005 Bacteria 2600
176 Ga0307510_10001007 3300033180 Bacteria 29876
177 Ga0439438_000202 3300041405 Bacteria 27274
178 Ga0439438_000461 3300041405 Bacteria 18366
179 Ga0439447_001229 3300041407 Bacteria 9331
180 Ga0439445_0002057 3300042004 Bacteria 4446
181 Ga0439432_002878 3300042006 Bacteria 6412
182 Ga0439432_003172 3300042006 Bacteria 6115
183 Ga0439451_000325 3300042009 Bacteria 9276
184 Ga0439451_000367 3300042009 Bacteria 8724
185 Ga0439451_000406 3300042009 Bacteria 8401
186 Ga0439451_003273 3300042009 Bacteria 3283
187 Ga0439451_026996 3300042009 Bacteria 1157
188 Ga0439452_000251 3300042010 Bacteria 36945
189 Ga0439452_000279 3300042010 Bacteria 33718
190 Ga0439452_005026 3300042010 Bacteria 4321
191 Ga0439452_025736 3300042010 Bacteria 1491
192 Ga0439456_003808 3300042013 Bacteria 3069
193 Ga0439463_013773 3300042016 Bacteria 1992
194 Ga0450911_000222 3300042115 Bacteria 22157
195 Ga0450923_065373 3300042125 Bacteria 799
196 Ga0450892_007631 3300042130 Bacteria 916
197 Ga0450894_004725 3300042131 Bacteria 1767
198 Ga0450896_007777 3300042133 Bacteria 1480
199 Ga0450898_000500 3300042134 Bacteria 4580
200 Ga0450899_003279 3300042135 Bacteria 1743
201 Ga0450903_000290 3300042138 Bacteria 11087
202 Ga0450903_001109 3300042138 Bacteria 5110
203 Ga0450904_000401 3300042139 Bacteria 8872
204 Ga0450905_000016 3300042142 Bacteria 15938
205 Ga0450906_000142 3300042145 Bacteria 13113
206 Ga0450908_015984 3300042184 Bacteria 1341
207 Ga0450918_004664 3300042531 Bacteria 2486
208 Ga0450893_0001166 3300042532 Bacteria 3963
209 Ga0450893_0012758 3300042532 Bacteria 1396
210 Ga0495617_003955 3300046452 Bacteria 5458
211 Ga0495617_008190 3300046452 Bacteria 3609
212 Ga0495617_008301 3300046452 Bacteria 3583
213 Ga0495617_008758 3300046452 Bacteria 3484
214 Ga0495617_009272 3300046452 Bacteria 3378
215 Ga0495617_012325 3300046452 Bacteria 2912
216 Ga0495617_013075 3300046452 Bacteria 2828
217 Ga0495617_013134 3300046452 Bacteria 2820
218 Ga0495617_024895 3300046452 Bacteria 2018
219 Ga0495617_055170 3300046452 Bacteria 1318
220 Ga0495627_000147 3300046453 Bacteria 84285
221 Ga0495627_000549 3300046453 Bacteria 30961
222 Ga0495627_000859 3300046453 Bacteria 21684
223 Ga0495627_001809 3300046453 Bacteria 11397
224 Ga0495627_006732 3300046453 Bacteria 4472
225 Ga0495627_009104 3300046453 Bacteria 3667
226 Ga0495627_026082 3300046453 Bacteria 1888
227 Ga0495627_058420 3300046453 Bacteria 1145
228 Ga0495627_116131 3300046453 Bacteria 757
229 Ga0495592_0014254 3300046454 Bacteria 6037
230 Ga0495590_0001031 3300046457 Bacteria 12276
231 Ga0495590_0001766 3300046457 Bacteria 9177
232 Ga0495590_0010833 3300046457 Bacteria 3416
233 Ga0495590_0012641 3300046457 Bacteria 3128
234 Ga0495591_000620 3300046458 Bacteria 26619
235 Ga0495591_000927 3300046458 Bacteria 20169
236 Ga0495591_000952 3300046458 Bacteria 19793
237 Ga0495591_004093 3300046458 Bacteria 7259
238 Ga0495591_004366 3300046458 Bacteria 6965
239 Ga0495591_005039 3300046458 Bacteria 6215
240 Ga0495591_010535 3300046458 Bacteria 3575
241 Ga0495591_010610 3300046458 Bacteria 3554
242 Ga0495591_016064 3300046458 Bacteria 2621
243 Ga0495638_0000542 3300046460 Bacteria 43515
244 Ga0495638_0000910 3300046460 Bacteria 30212
245 Ga0495638_0002355 3300046460 Bacteria 15490
246 Ga0495638_0003401 3300046460 Bacteria 12542
247 Ga0495638_0004095 3300046460 Bacteria 11154
248 Ga0495638_0011875 3300046460 Bacteria 5988
249 Ga0495638_0023083 3300046460 Bacteria 4075
250 Ga0495638_0035370 3300046460 Bacteria 3185
251 Ga0495638_0057641 3300046460 Bacteria 2408
252 Ga0495653_0001932 3300046463 Bacteria 16339
253 Ga0495653_0112087 3300046463 Bacteria 1958
254 Ga0495653_0156194 3300046463 Bacteria 1588
255 Ga0495650_0001112 3300046471 Bacteria 29424
256 Ga0495650_0003482 3300046471 Bacteria 11436
257 Ga0495650_0007130 3300046471 Bacteria 6787
258 Ga0495650_0021904 3300046471 Bacteria 3074
259 Ga0495650_0032901 3300046471 Bacteria 2313
260 Ga0495605_0003210 3300046474 Bacteria 9807
261 Ga0495605_0008531 3300046474 Bacteria 5791
262 Ga0495605_0009602 3300046474 Bacteria 5434
263 Ga0495605_0012283 3300046474 Bacteria 4753
264 Ga0495605_0013957 3300046474 Bacteria 4411
265 Ga0495605_0014740 3300046474 Bacteria 4270
266 Ga0495605_0014927 3300046474 Bacteria 4236
267 Ga0495584_0001647 3300046491 Bacteria 13128
268 Ga0495584_0006548 3300046491 Bacteria 6087
269 Ga0495584_0013026 3300046491 Bacteria 4243
270 Ga0495584_0051294 3300046491 Bacteria 2077
271 Ga0495584_0077911 3300046491 Bacteria 1667
272 Ga0495584_0098344 3300046491 Bacteria 1478
273 Ga0495585_0000748 3300046492 Bacteria 28801
274 Ga0495585_0001333 3300046492 Bacteria 19603
275 Ga0495585_0001365 3300046492 Bacteria 19315
276 Ga0495585_0002530 3300046492 Bacteria 12996
277 Ga0495585_0002556 3300046492 Bacteria 12895
278 Ga0495585_0013168 3300046492 Bacteria 4846
279 Ga0495585_0015297 3300046492 Bacteria 4458
280 Ga0495585_0016751 3300046492 Bacteria 4245
281 Ga0495596_0002694 3300046500 Bacteria 9366
282 Ga0495607_0000550 3300046501 Bacteria 36652
283 Ga0495607_0003006 3300046501 Bacteria 13165
284 Ga0495607_0004334 3300046501 Bacteria 10465
285 Ga0495607_0004810 3300046501 Bacteria 9850
286 Ga0495607_0014080 3300046501 Bacteria 5220
287 Ga0495607_0015682 3300046501 Bacteria 4905
288 Ga0495607_0017469 3300046501 Bacteria 4603
289 Ga0495607_0023361 3300046501 Bacteria 3871
290 Ga0495607_0030624 3300046501 Bacteria 3302
291 Ga0495607_0032769 3300046501 Bacteria 3168
292 Ga0495607_0035585 3300046501 Bacteria 3010
293 Ga0495607_0097371 3300046501 Bacteria 1582
294 Ga0495583_0001460 3300046506 Bacteria 23844
295 Ga0495583_0002079 3300046506 Bacteria 18065
296 Ga0495606_0001304 3300046507 Bacteria 34367
297 Ga0495606_0001668 3300046507 Bacteria 28854
298 Ga0495606_0002205 3300046507 Bacteria 23321
299 Ga0495606_0003653 3300046507 Bacteria 16123
300 Ga0495606_0006071 3300046507 Bacteria 11286
301 Ga0495606_0006248 3300046507 Bacteria 11059
302 Ga0495606_0011154 3300046507 Bacteria 7362
303 Ga0495606_0027041 3300046507 Bacteria 4074
304 Ga0495606_0041587 3300046507 Bacteria 3081
305 Ga0495606_0081022 3300046507 Bacteria 2018
306 Ga0495610_0001179 3300046512 Bacteria 23660
307 Ga0495610_0001556 3300046512 Bacteria 20208
308 Ga0495610_0001951 3300046512 Bacteria 17738
309 Ga0495610_0005126 3300046512 Bacteria 9414
310 Ga0495610_0008970 3300046512 Bacteria 6394
311 Ga0495610_0009308 3300046512 Bacteria 6224
312 Ga0495610_0009680 3300046512 Bacteria 6064
313 Ga0495610_0010659 3300046512 Bacteria 5691
314 Ga0495610_0018408 3300046512 Bacteria 3947
315 Ga0495610_0041445 3300046512 Bacteria 2311
316 Ga0495616_0000505 3300046513 Bacteria 29552
317 Ga0495616_0000511 3300046513 Bacteria 29411
318 Ga0495616_0000706 3300046513 Bacteria 24753
319 Ga0495616_0001350 3300046513 Bacteria 17116
320 Ga0495616_0009378 3300046513 Bacteria 5733
321 Ga0495616_0014433 3300046513 Bacteria 4421
322 Ga0495616_0031845 3300046513 Bacteria 2758
323 Ga0495616_0034389 3300046513 Bacteria 2632
324 Ga0495616_0042765 3300046513 Bacteria 2304
325 Ga0495620_0000355 3300046515 Bacteria 31797
326 Ga0495620_0001051 3300046515 Bacteria 16934
327 Ga0495620_0003252 3300046515 Bacteria 9312
328 Ga0495620_0006617 3300046515 Bacteria 6349
329 Ga0495620_0008488 3300046515 Bacteria 5512
330 Ga0495620_0021596 3300046515 Bacteria 3123
331 Ga0495631_0000286 3300046518 Bacteria 35275
332 Ga0495631_0000532 3300046518 Bacteria 25537
333 Ga0495631_0001328 3300046518 Bacteria 15161
334 Ga0495631_0003875 3300046518 Bacteria 8101
335 Ga0495631_0014785 3300046518 Bacteria 3758
336 Ga0495631_0038245 3300046518 Bacteria 2134
337 Ga0495632_0000497 3300046519 Bacteria 37001
338 Ga0495632_0001765 3300046519 Bacteria 17499
339 Ga0495632_0014476 3300046519 Bacteria 4460
340 Ga0495632_0015046 3300046519 Bacteria 4351
341 Ga0495632_0019015 3300046519 Bacteria 3751
342 Ga0495632_0020606 3300046519 Bacteria 3566
343 Ga0495632_0020770 3300046519 Bacteria 3548
344 Ga0495632_0024211 3300046519 Bacteria 3229
345 Ga0495632_0024436 3300046519 Bacteria 3208
346 Ga0495632_0026375 3300046519 Bacteria 3059
347 Ga0495632_0058350 3300046519 Bacteria 1881
348 Ga0495632_0064957 3300046519 Bacteria 1763
349 Ga0495632_0083436 3300046519 Bacteria 1521
350 Ga0495637_0000655 3300046520 Bacteria 24162
351 Ga0495637_0001364 3300046520 Bacteria 14664
352 Ga0495637_0002550 3300046520 Bacteria 10023
353 Ga0495637_0003412 3300046520 Bacteria 8438
354 Ga0495637_0014090 3300046520 Bacteria 3779
355 Ga0495637_0030428 3300046520 Bacteria 2395
356 Ga0495637_0045023 3300046520 Bacteria 1874
357 Ga0495637_0063916 3300046520 Bacteria 1502
358 Ga0495637_0201306 3300046520 Bacteria 731
359 Ga0495643_0002882 3300046522 Bacteria 13041
360 Ga0495643_0021217 3300046522 Bacteria 3730
361 Ga0495643_0043048 3300046522 Bacteria 2458
362 Ga0495643_0131278 3300046522 Bacteria 1257
363 Ga0495644_0000278 3300046523 Bacteria 23512
364 Ga0495644_0000335 3300046523 Bacteria 21541
365 Ga0495648_0000215 3300046524 Bacteria 66028
366 Ga0495648_0000735 3300046524 Bacteria 34912
367 Ga0495648_0001320 3300046524 Bacteria 24586
368 Ga0495648_0006966 3300046524 Bacteria 9117
369 Ga0495648_0012221 3300046524 Bacteria 6417
370 Ga0495648_0026658 3300046524 Bacteria 3886
371 Ga0495648_0041652 3300046524 Bacteria 2897
372 Ga0495648_0053914 3300046524 Bacteria 2432
373 Ga0495648_0070908 3300046524 Bacteria 2022
374 Ga0495666_0001177 3300046526 Bacteria 12580
375 Ga0495666_0159970 3300046526 Bacteria 1044
376 Ga0495654_0000412 3300046530 Bacteria 36467
377 Ga0495654_0000786 3300046530 Bacteria 24451
378 Ga0495654_0000951 3300046530 Bacteria 21452
379 Ga0495654_0002256 3300046530 Bacteria 12476
380 Ga0495654_0002723 3300046530 Bacteria 11158
381 Ga0495654_0003741 3300046530 Bacteria 9214
382 Ga0495654_0004154 3300046530 Bacteria 8688
383 Ga0495654_0022278 3300046530 Bacteria 3291
384 Ga0495654_0032070 3300046530 Bacteria 2664
385 Ga0495654_0033459 3300046530 Bacteria 2601
386 Ga0495654_0039929 3300046530 Bacteria 2340
387 Ga0495654_0078461 3300046530 Bacteria 1552
388 Ga0495654_0081115 3300046530 Bacteria 1521
389 Ga0495654_0118955 3300046530 Bacteria 1197
390 Ga0495587_0012305 3300046536 Bacteria 5393
391 Ga0495587_0023022 3300046536 Bacteria 3830
392 Ga0495609_0000505 3300046538 Bacteria 31398
393 Ga0495609_0012433 3300046538 Bacteria 4038
394 Ga0495609_0014930 3300046538 Bacteria 3643
395 Ga0495609_0020787 3300046538 Bacteria 3029
396 Ga0495609_0049260 3300046538 Bacteria 1880
397 Ga0495597_0000659 3300046542 Bacteria 28075
398 Ga0495597_0004542 3300046542 Bacteria 7594
399 Ga0495597_0006301 3300046542 Bacteria 6146
400 Ga0495597_0025178 3300046542 Bacteria 2740
401 Ga0495597_0026390 3300046542 Bacteria 2668
402 Ga0495597_0124827 3300046542 Bacteria 1070
403 Ga0495645_0011416 3300046543 Bacteria 6250
404 Ga0495622_0000739 3300046557 Bacteria 18390
405 Ga0495622_0011990 3300046557 Bacteria 4008
406 Ga0495622_0089187 3300046557 Bacteria 1417
407 Ga0495633_0001604 3300046558 Bacteria 17147
408 Ga0495633_0006087 3300046558 Bacteria 7228
409 Ga0495633_0007049 3300046558 Bacteria 6544
410 Ga0495633_0144587 3300046558 Bacteria 1099
411 Ga0495656_0087346 3300046615 Bacteria 1420
412 Ga0495668_0000891 3300046616 Bacteria 33605
413 Ga0495668_0028975 3300046616 Bacteria 3129
414 Ga0495668_0081667 3300046616 Bacteria 1773
415 Ga0495668_0125832 3300046616 Bacteria 1403
416 Ga0495634_0000750 3300046642 Bacteria 31392
417 Ga0495634_0007094 3300046642 Bacteria 8450
418 Ga0495611_0000255 3300046648 Bacteria 36899
419 Ga0495611_0014616 3300046648 Bacteria 3356
420 Ga0495611_0087104 3300046648 Bacteria 1441
421 Ga0495625_0002197 3300046660 Bacteria 21607
422 Ga0495625_0009697 3300046660 Bacteria 8019
423 Ga0495625_0019920 3300046660 Bacteria 5190
424 Ga0495625_0032472 3300046660 Bacteria 3869
425 Ga0495625_0038779 3300046660 Bacteria 3484
426 Ga0495625_0070957 3300046660 Bacteria 2445
427 Ga0495635_0000942 3300046663 Bacteria 19194
428 Ga0495661_0000363 3300046665 Bacteria 49099
429 Ga0495661_0001713 3300046665 Bacteria 17741
430 Ga0495661_0009466 3300046665 Bacteria 6687
431 Ga0495661_0015380 3300046665 Bacteria 5107
432 Ga0495661_0030675 3300046665 Bacteria 3420
433 Ga0495661_0031300 3300046665 Bacteria 3379
434 Ga0495661_0082255 3300046665 Bacteria 1854
435 Ga0495661_0138151 3300046665 Bacteria 1328
436 Ga0495661_0210817 3300046665 Bacteria 1011
437 Ga0495588_0010988 3300046674 Bacteria 4236
438 Ga0495588_0023567 3300046674 Bacteria 3049
439 Ga0495623_0007457 3300046679 Bacteria 7102
440 Ga0495623_0008514 3300046679 Bacteria 6662
441 Ga0495646_0016256 3300046680 Bacteria 4723
442 Ga0495613_0002793 3300046689 Bacteria 13111
443 Ga0495613_0036504 3300046689 Bacteria 3644
444 Ga0495613_0198749 3300046689 Bacteria 1414
445 Ga0495624_0000185 3300046690 Bacteria 46826
446 Ga0495670_0000410 3300046691 Bacteria 20521
447 Ga0495670_0009802 3300046691 Bacteria 4708
448 Ga0495670_0014410 3300046691 Bacteria 3886
449 Ga0495670_0137577 3300046691 Bacteria 1276
450 Ga0495670_0213317 3300046691 Bacteria 1024
451 Ga0495671_0001703 3300046692 Bacteria 14350
452 Ga0495671_0004276 3300046692 Bacteria 8580
453 Ga0495671_0006964 3300046692 Bacteria 6484
454 Ga0495671_0010655 3300046692 Bacteria 5085
455 Ga0495671_0013376 3300046692 Bacteria 4447
456 Ga0495671_0016278 3300046692 Bacteria 3973
457 Ga0495671_0023634 3300046692 Bacteria 3210
458 Ga0495671_0029795 3300046692 Bacteria 2799
459 Ga0495671_0034411 3300046692 Bacteria 2575
460 Ga0495671_0060970 3300046692 Bacteria 1861
461 Ga0495649_0001334 3300046694 Bacteria 18764
462 Ga0495649_0001421 3300046694 Bacteria 18097
463 Ga0495649_0002090 3300046694 Bacteria 14348
464 Ga0495649_0002896 3300046694 Bacteria 11884
465 Ga0495649_0004480 3300046694 Bacteria 9118
466 Ga0495649_0004685 3300046694 Bacteria 8880
467 Ga0495649_0004975 3300046694 Bacteria 8552
468 Ga0495649_0013193 3300046694 Bacteria 4772
469 Ga0495649_0138953 3300046694 Bacteria 1279
470 Ga0495589_0000425 3300046794 Bacteria 31317
471 Ga0495589_0004022 3300046794 Bacteria 7878
472 Ga0495589_0015647 3300046794 Bacteria 3900
473 Ga0495589_0019091 3300046794 Bacteria 3517
474 Ga0495589_0024165 3300046794 Bacteria 3089
475 Ga0495600_0037531 3300046809 Bacteria 3150
476 Ga0495600_0046433 3300046809 Bacteria 2833
477 Ga0495660_0000504 3300046810 Bacteria 32167
478 Ga0495660_0002181 3300046810 Bacteria 12603
479 Ga0495660_0005835 3300046810 Bacteria 7345
480 Ga0495660_0015245 3300046810 Bacteria 4441
481 Ga0495660_0030600 3300046810 Bacteria 3031
482 Ga0495660_0052370 3300046810 Bacteria 2217
483 Ga0495660_0069640 3300046810 Bacteria 1869
484 Ga0495660_0131674 3300046810 Bacteria 1254
485 Ga0495660_0243870 3300046810 Bacteria 836
486 Ga0495604_0011205 3300047317 Bacteria 7118
487 Ga0495604_0015620 3300047317 Bacteria 6062
488 Ga0495674_0020483 3300047319 Bacteria 6120
489 Ga0495672_0000726 3300047320 Bacteria 36268
490 Ga0495672_0001739 3300047320 Bacteria 21032
491 Ga0495672_0002786 3300047320 Bacteria 15610
492 Ga0495672_0008066 3300047320 Bacteria 7826
493 Ga0495672_0009193 3300047320 Bacteria 7196
494 Ga0495672_0014554 3300047320 Bacteria 5380
495 Ga0495672_0028260 3300047320 Bacteria 3550
496 Ga0495672_0033347 3300047320 Bacteria 3190
497 Ga0495672_0071300 3300047320 Bacteria 1966
498 Ga0495676_0000884 3300047321 Bacteria 25009
499 Ga0495676_0001079 3300047321 Bacteria 23112
500 Ga0495680_0001910 3300047322 Bacteria 21867
501 Ga0495680_0010782 3300047322 Bacteria 8141
502 Ga0495680_0055316 3300047322 Bacteria 3078
503 Ga0495680_0099088 3300047322 Bacteria 2173
504 Ga0495680_0397819 3300047322 Bacteria 951
505 Ga0495683_0000452 3300047323 Bacteria 32302
506 Ga0495683_0001738 3300047323 Bacteria 13776
507 Ga0495683_0002619 3300047323 Bacteria 10764
508 Ga0495683_0016173 3300047323 Bacteria 3874
509 Ga0495683_0027610 3300047323 Bacteria 2902
510 Ga0495675_0137170 3300047444 Bacteria 1518
511 Ga0495677_0202361 3300047445 Bacteria 772
512 Ga0495679_001297 3300047446 Bacteria 14566
513 Ga0495679_001838 3300047446 Bacteria 11480
514 Ga0495679_004171 3300047446 Bacteria 6748
515 Ga0495679_005915 3300047446 Bacteria 5360
516 Ga0495679_011441 3300047446 Bacteria 3425
517 Ga0495673_0000759 3300047469 Bacteria 30614
518 Ga0495673_0000890 3300047469 Bacteria 27481
519 Ga0495673_0001076 3300047469 Bacteria 23960
520 Ga0495673_0002437 3300047469 Bacteria 13100
521 Ga0495673_0009592 3300047469 Bacteria 5346
522 Ga0495673_0026582 3300047469 Bacteria 2765
523 Ga0495673_0038735 3300047469 Bacteria 2166
524 Ga0495673_0072708 3300047469 Bacteria 1442
525 Ga0495681_0000171 3300047470 Bacteria 54448
526 Ga0495681_0000457 3300047470 Bacteria 31283
527 Ga0495681_0000508 3300047470 Bacteria 29718
528 Ga0495681_0000981 3300047470 Bacteria 21817
529 Ga0495681_0005014 3300047470 Bacteria 8926
530 Ga0495681_0008238 3300047470 Bacteria 6551
531 Ga0495681_0008861 3300047470 Bacteria 6253
532 Ga0495681_0012190 3300047470 Bacteria 5065
533 Ga0495681_0016417 3300047470 Bacteria 4152
534 Ga0495681_0027611 3300047470 Bacteria 2933
535 Ga0495684_0002673 3300047471 Bacteria 14124
536 Ga0495686_0002074 3300047472 Bacteria 19701
537 Ga0495686_0011047 3300047472 Bacteria 6387
538 Ga0495686_0030379 3300047472 Bacteria 3509
539 Ga0495686_0080202 3300047472 Bacteria 1995
540 Ga0495593_0003815 3300047673 Bacteria 9003
541 Ga0495593_0006571 3300047673 Bacteria 6803
542 Ga0495593_0011499 3300047673 Bacteria 5081
543 Ga0495593_0024249 3300047673 Bacteria 3363
544 Ga0495602_0000848 3300048088 Bacteria 29417
545 Ga0495614_0074733 3300048089 Bacteria 1464
546 Ga0495626_0000726 3300048091 Bacteria 30830
547 Ga0495626_0001495 3300048091 Bacteria 18442
548 Ga0495626_0006234 3300048091 Bacteria 6811
549 Ga0495626_0010707 3300048091 Bacteria 4876
550 Ga0495626_0010974 3300048091 Bacteria 4809
551 Ga0495626_0011213 3300048091 Bacteria 4747
552 Ga0495626_0015308 3300048091 Bacteria 3931
553 Ga0496101_0518212 3300048904 Bacteria 942
554 Ga0496102_0000419 3300048905 Bacteria 48952
555 Ga0496103_0001964 3300048906 Bacteria 13296
556 Ga0496106_0055543 3300048909 Bacteria 2993
557 Ga0496106_0180064 3300048909 Bacteria 1678
558 Ga0496110_0080720 3300048913 Bacteria 2899
559 Ga0496111_0209034 3300048914 Bacteria 1450
560 Ga0496116_0000338 3300048919 Bacteria 75100
561 Ga0496116_0001012 3300048919 Bacteria 34285
562 Ga0496116_0002599 3300048919 Bacteria 18786
563 Ga0496116_0004365 3300048919 Bacteria 13523
564 Ga0496116_0012636 3300048919 Bacteria 6877
565 Ga0496116_0024608 3300048919 Bacteria 4447
566 Ga0496116_0049883 3300048919 Bacteria 2794
567 Ga0496116_0109461 3300048919 Bacteria 1628
568 Ga0496117_0000712 3300048920 Bacteria 52613
569 Ga0496117_0003653 3300048920 Bacteria 17695
570 Ga0496117_0005368 3300048920 Bacteria 13500
571 Ga0496117_0005706 3300048920 Bacteria 12956
572 Ga0496117_0006175 3300048920 Bacteria 12236
573 Ga0496117_0006888 3300048920 Bacteria 11278
574 Ga0496117_0015564 3300048920 Bacteria 6475
575 Ga0496117_0027875 3300048920 Bacteria 4386
576 Ga0496117_0046700 3300048920 Bacteria 3113
577 Ga0496118_0004004 3300048921 Bacteria 17933
578 Ga0496118_0005607 3300048921 Bacteria 14179
579 Ga0496118_0028792 3300048921 Bacteria 4670
580 Ga0496118_0039993 3300048921 Bacteria 3733
581 Ga0496118_0109646 3300048921 Bacteria 1836
582 Ga0496119_0003010 3300048922 Bacteria 17854
583 Ga0496119_0011059 3300048922 Bacteria 7521
584 Ga0496119_0075535 3300048922 Bacteria 1958
585 Ga0496119_0104940 3300048922 Bacteria 1579
586 Ga0496120_0001345 3300048923 Bacteria 30280
587 Ga0496120_0006476 3300048923 Bacteria 8983
588 Ga0496120_0020080 3300048923 Bacteria 4257
589 Ga0496121_0000713 3300048924 Bacteria 61654
590 Ga0496121_0001802 3300048924 Bacteria 34607
591 Ga0496121_0005084 3300048924 Bacteria 17154
592 Ga0496121_0006906 3300048924 Bacteria 13851
593 Ga0496121_0013221 3300048924 Bacteria 8894
594 Ga0496121_0029593 3300048924 Bacteria 5058
595 Ga0496121_0055549 3300048924 Bacteria 3298
596 Ga0496122_0003076 3300048925 Bacteria 22461
597 Ga0496122_0004317 3300048925 Bacteria 17801
598 Ga0496122_0008121 3300048925 Bacteria 11434
599 Ga0496122_0009196 3300048925 Bacteria 10464
600 Ga0496122_0009627 3300048925 Bacteria 10121
601 Ga0496122_0009764 3300048925 Bacteria 10024
602 Ga0496122_0014063 3300048925 Bacteria 7768
603 Ga0496122_0033721 3300048925 Bacteria 4204
604 Ga0496122_0164034 3300048925 Bacteria 1350
605 Ga0496123_0002303 3300048926 Bacteria 23972
606 Ga0496123_0004296 3300048926 Bacteria 15141
607 Ga0496123_0006317 3300048926 Bacteria 11517
608 Ga0496123_0008403 3300048926 Bacteria 9488
609 Ga0496123_0010737 3300048926 Bacteria 8047
610 Ga0496123_0012181 3300048926 Bacteria 7360
611 Ga0496123_0035016 3300048926 Bacteria 3586
612 Ga0496123_0072847 3300048926 Bacteria 2134
613 Ga0496124_0001071 3300048927 Bacteria 43253
614 Ga0496124_0001277 3300048927 Bacteria 38265
615 Ga0496124_0003709 3300048927 Bacteria 18440
616 Ga0496124_0005979 3300048927 Bacteria 13435
617 Ga0496124_0007771 3300048927 Bacteria 11328
618 Ga0496124_0029997 3300048927 Bacteria 4835
619 Ga0496124_0334065 3300048927 Bacteria 1079
620 Ga0496125_0000948 3300048928 Bacteria 45536
621 Ga0496125_0002443 3300048928 Bacteria 24133
622 Ga0496125_0004226 3300048928 Bacteria 16728
623 Ga0496125_0007586 3300048928 Bacteria 11522
624 Ga0496125_0011572 3300048928 Bacteria 8814
625 Ga0496125_0015480 3300048928 Bacteria 7372
626 Ga0496125_0064739 3300048928 Bacteria 2902
627 Ga0496125_0146537 3300048928 Bacteria 1630
628 Ga0496126_0011442 3300048929 Bacteria 9183
629 Ga0495678_000534 3300049459 Bacteria 36836
630 Ga0495678_001271 3300049459 Bacteria 20466
631 Ga0495678_005619 3300049459 Bacteria 6860
632 Ga0495678_006249 3300049459 Bacteria 6365
633 Ga0495678_006916 3300049459 Bacteria 5953
634 Ga0495678_009530 3300049459 Bacteria 4797
635 Ga0495678_015047 3300049459 Bacteria 3574
636 Ga0495678_015398 3300049459 Bacteria 3518
637 Ga0495678_017139 3300049459 Bacteria 3290
638 Ga0495678_046412 3300049459 Bacteria 1708
639 Ga0495678_085437 3300049459 Bacteria 1124
640 Ga0495682_0001524 3300049460 Bacteria 12276
641 Ga0495682_0002821 3300049460 Bacteria 8016
642 Ga0495682_0007293 3300049460 Bacteria 4409
643 Ga0495682_0007711 3300049460 Bacteria 4268
644 Ga0495682_0053429 3300049460 Bacteria 1467
645 Ga0501240_000795 3300049673 Bacteria 2804
646 Ga0501241_000245 3300049758 Bacteria 12157
647 Ga0501269_002785 3300049766 Bacteria 2131
648 nmdc:mga00v17_14617_c2 3300050491 Bacteria 2909
649 Ga0500572_000413 3300053111 Bacteria 15022
650 Ga0500634_0000868 3300053161 Bacteria 10758
651 2511292119 2511231010 Bacteria 6373152
652 2511294789 2511231011 Bacteria 6149768
653 2511359992 2511231021 Bacteria 7302637
654 2511367155 2511231023 Bacteria 6808468
655 2511413821 2511231031 Bacteria 6558529
656 2555667643 2554235341 Bacteria 6867980
657 2597867601 2597489889 Bacteria 6297495
658 2599356862 2599185160 Bacteria 6844013
659 2599363108 2599185161 Bacteria 6960462
660 2599369940 2599185162 Bacteria 6957254
661 2599376217 2599185163 Bacteria 6995158
662 2599381967 2599185164 Bacteria 6841688
663 2599387889 2599185165 Bacteria 6843250
664 2599395585 2599185166 Bacteria 6959206
665 2599402187 2599185167 Bacteria 6353609
666 2599407350 2599185168 Bacteria 6997636
667 2599454605 2599185179 Bacteria 6611171
668 2599463695 2599185181 Bacteria 6844519
669 2599468957 2599185182 Bacteria 6883168
670 2599492714 2599185186 Bacteria 6831633
671 2599516013 2599185190 Bacteria 6285678
672 2599521812 2599185191 Bacteria 6297582
673 2599882870 2599185288 Bacteria 6666191
674 2599895391 2599185290 Bacteria 6289611
675 2599950989 2599185303 Bacteria 6512725
676 2600216324 2599185356 Bacteria 6843884
677 2601776491 2600255313 Bacteria 6842543
678 2601798054 2600255318 Bacteria 6383414
679 2606076463 2603880185 Bacteria 6379190
680 2606129123 2603880199 Bacteria 6377649
681 2624478452 2623620443 Bacteria 6427864
682 2643841211 2643221565 Bacteria 6216018
683 2643872416 2643221571 Bacteria 6228673
684 2644190015 2643221633 Bacteria 6733554
685 2671099749 2667528171 Bacteria 6900659
686 2677899555 2675903420 Bacteria 6247433
687 2715753913 2713897148 Bacteria 5883533
688 2715759571 2713897149 Bacteria 6506249
689 2718632380 2718217725 Bacteria 5758958
690 2738807692 2738541294 Bacteria 6925949
691 2738895052 2738541309 Bacteria 6926455
692 2739316818 2738543025 Bacteria 6600348
693 2774134964 2773857673 Bacteria 6513460
694 2784260814 2784132063 Bacteria 6262788
695 2809218194 2808606445 Bacteria 6057339
696 2819657459 2818991456 Bacteria 6123676
697 2819705435 2818991464 Bacteria 6907494
698 2834032011 2834028612 Bacteria 6354979
699 2842834381 2842832357 Bacteria 5959113
700 2842846141 2842843487 Bacteria 6004777
701 2852660219 2852657418 Bacteria 6472974
702 2860345629 2860339153 Bacteria 6846989
703 2878030387 2878029506 Bacteria 6418441
704 2880231342 2880230671 Bacteria 6140320
705 2904519798 2904518522 Bacteria 6068986
706 2908447238 2908446538 Bacteria 6829095
707 2917071396 2917070673 Bacteria 6868303
708 2919065921 2919063839 Bacteria 6302690
709 2919389549 2919385768 Bacteria 5897293
710 2919460210 2919456309 Bacteria 6586567
711 2919488481 2919487758 Bacteria 5929766
712 2929190496 2929189879 Bacteria 5930554
713 2931391590 2931390751 Bacteria 6273349
714 2931399065 2931396565 Bacteria 7251677
715 2935359222 2935353572 Unclassified 6955622
716 2945929957 2945928738 Bacteria 6053221
717 2945967810 2945961074 Bacteria 7342064
718 2946012290 2946006987 Bacteria 6705746
719 2946028845 2946027586 Bacteria 6049274
720 2947235380 2947233263 Bacteria 6439278
721 2969305183 2969304461 Bacteria 6601805
722 2974293127 2974289157 Bacteria 6080362
723 2998140685 2998139840 Bacteria 6073514
724 3007399836 3007395558 Bacteria 6755444
725 3007617533 3007614139 Bacteria 6053559
726 3007620889 3007619802 Bacteria 6411688
727 3007722144 3007718800 Bacteria 5971527
728 3007859914 3007855910 Bacteria 5637581
729 3007864106 3007861166 Bacteria 6045338
730 637318035 637000220 Bacteria 7074893
731 8019770514 8019769354 Bacteria 6924660
732 8030000054 8029995093 Bacteria 5990776
733 8054286356 8054285046 Bacteria 6919322
734 8055818608 8055817908 Bacteria 6609162
735 8056152682 8056148874 Bacteria 6479865
736 8056161622 8056161164 Bacteria 6106669
737 8056170361 8056166840 Bacteria 5820959
738 8056176488 8056172158 Bacteria 6133900
739 8056182820 8056177738 Bacteria 6748268
740 8056573521 8056569372 Bacteria 5997322
741 8057802921 8057798959 Bacteria 6713499
742 Ga0450902_000126
743 JGI25162J39368_1000195
744 JGI25163J39215_1000123
745 JGI25164J39214_1000225
746 JGI25165J46597_1000291
747 Ga0055536_1000299
748 Ga0055536_1002690
749 Ga0055530_10000340
750 Ga0055540_1000162
751 Ga0055531_10000734
752 Ga0065714_10005355
753 Ga0065714_10064550
754 Ga0065714_10095920
755 Ga0065704_10101121
756 Ga0065712_10091402
757 Ga0070670_100001980
758 Ga0070669_100000487
759 Ga0070669_100000956
760 Ga0070662_100000137
761 Ga0070662_100014133
762 Ga0068853_100003083
763 Ga0070665_100044833
764 Ga0070665_100180913
765 Ga0070664_100004017
766 Ga0068854_100052077
767 Ga0068851_10000004
768 Ga0075363_100195622
769 Ga0075364_10023533
770 Ga0075432_10001534
771 Ga0079104_1008163
772 Ga0105251_10000378
773 Ga0105251_10001590
774 Ga0105251_10002232
775 Ga0105251_10002448
776 Ga0105251_10004027
777 Ga0105251_10005274
778 Ga0105251_10011087
779 Ga0105251_10011613
780 Ga0105251_10025992
781 Ga0105251_10195102
782 Ga0105244_10001726
783 Ga0105244_10003786
784 Ga0105244_10012893
785 Ga0105244_10029320
786 Ga0105244_10134580
787 Ga0105250_10001060
788 Ga0105250_10001756
789 Ga0105250_10002278
790 Ga0105250_10015196
791 Ga0105250_10015343
792 Ga0105250_10015500
793 Ga0105243_10000225
794 Ga0105243_10001399
795 Ga0105243_10051250
796 Ga0105248_10013078
797 Ga0105239_10367155
798 Ga0105246_10000388
799 Ga0105246_10001581
800 Ga0105246_10005439
801 Ga0157345_1000032
802 Ga0157373_10000478
803 Ga0157373_10000520
804 Ga0157373_10000957
805 Ga0157373_10001143
806 Ga0157373_10003846
807 Ga0157373_10004155
808 Ga0157373_10041792
809 Ga0157373_10063759
810 Ga0157371_10001273
811 Ga0157371_10002656
812 Ga0157371_10004342
813 Ga0157371_10012005
814 Ga0157370_10056395
815 Ga0157370_10124707
816 Ga0157370_10252986
817 Ga0157370_10297740
818 Ga0157369_10001544
819 Ga0157369_10002672
820 Ga0157369_10009425
821 Ga0157369_10025492
822 Ga0157369_10089566
823 Ga0157369_10093228
824 Ga0163162_10000902
825 Ga0163162_10001902
826 Ga0163162_10027322
827 Ga0163162_10079639
828 Ga0163162_10109707
829 Ga0157372_10001315
830 Ga0157375_10030722
831 Ga0157375_10421181
832 Ga0182008_10000453
833 Ga0182008_10002063
834 Ga0182008_10002202
835 Ga0182008_10003707
836 Ga0182008_10003797
837 Ga0182006_1000793
838 Ga0182006_1001453
839 Ga0182006_1019703
840 Ga0182006_1062786
841 Ga0182006_1089673
842 Ga0182006_1089847
843 Ga0182006_1098899
844 Ga0182007_10000283
845 Ga0182007_10056599
846 Ga0182005_1014025
847 Ga0182005_1053790
848 Ga0182005_1055009
849 Ga0163161_10002587
850 Ga0163161_10002849
851 Ga0163161_10004085
852 Ga0163161_10006965
853 Ga0163161_10010903
854 Ga0163161_10018631
855 Ga0163161_10037911
856 Ga0163161_10234423
857 Ga0163161_10281818
858 Ga0163161_10292061
859 Ga0209760_100031
860 Ga0209563_101022
861 Ga0207427_100067
862 Ga0209437_100016
863 Ga0209233_1000156
864 Ga0209675_1008238
865 Ga0209676_1000025
866 Ga0209676_1000426
867 Ga0209050_1000500
868 Ga0209051_1000089
869 Ga0209257_1000034
870 Ga0207656_10000007
871 Ga0207696_1000085
872 Ga0207696_1000494
873 Ga0207696_1002204
874 Ga0207696_1014255
875 Ga0207696_1022429
876 Ga0207655_1000946
877 Ga0207655_1002034
878 Ga0207655_1002631
879 Ga0207655_1013895
880 Ga0207713_1000323
881 Ga0207713_1000494
882 Ga0207713_1000540
883 Ga0207713_1001743
884 Ga0207713_1001804
885 Ga0207713_1002389
886 Ga0207713_1004120
887 Ga0207713_1007421
888 Ga0207713_1057402
889 Ga0207681_10001305
890 Ga0207681_10002871
891 Ga0207650_10000073
892 Ga0207706_10000178
893 Ga0207706_10024333
894 Ga0207709_10000022
895 Ga0207709_10000634
896 Ga0207711_10102403
897 Ga0207679_10031482
898 Ga0207640_10249701
899 Ga0207639_10014912
900 Ga0209281_1006417
901 Ga0207428_10111887
902 Ga0268266_10084356
903 Ga0268266_10223068
904 Ga0268266_10287500
905 Ga0307517_10024989
906 Ga0307515_10373416
907 Ga0307511_10142496
908 Ga0316178_1157834
909 Ga0307509_10025355
910 Ga0307408_100009264
911 Ga0307516_10280580
912 Ga0307405_10000102
913 Ga0307412_10006331
914 Ga0307412_10087703
915 Ga0307414_10317061
916 Ga0307411_10055804
917 Ga0307510_10001007
918 Ga0439438_000202
919 Ga0439438_000461
920 Ga0439447_001229
921 Ga0439445_0002057
922 Ga0439432_002878
923 Ga0439432_003172
924 Ga0439451_000325
925 Ga0439451_000367
926 Ga0439451_000406
927 Ga0439451_003273
928 Ga0439451_026996
929 Ga0439452_000251
930 Ga0439452_000279
931 Ga0439452_005026
932 Ga0439452_025736
933 Ga0439456_003808
934 Ga0439463_013773
935 Ga0450911_000222
936 Ga0450923_065373
937 Ga0450892_007631
938 Ga0450894_004725
939 Ga0450896_007777
940 Ga0450898_000500
941 Ga0450899_003279
942 Ga0450903_000290
943 Ga0450903_001109
944 Ga0450904_000401
945 Ga0450905_000016
946 Ga0450906_000142
947 Ga0450908_015984
948 Ga0450918_004664
949 Ga0450893_0001166
950 Ga0450893_0012758
951 Ga0495617_003955
952 Ga0495617_008190
953 Ga0495617_008301
954 Ga0495617_008758
955 Ga0495617_009272
956 Ga0495617_012325
957 Ga0495617_013075
958 Ga0495617_013134
959 Ga0495617_024895
960 Ga0495617_055170
961 Ga0495627_000147
962 Ga0495627_000549
963 Ga0495627_000859
964 Ga0495627_001809
965 Ga0495627_006732
966 Ga0495627_009104
967 Ga0495627_026082
968 Ga0495627_058420
969 Ga0495627_116131
970 Ga0495592_0014254
971 Ga0495590_0001031
972 Ga0495590_0001766
973 Ga0495590_0010833
974 Ga0495590_0012641
975 Ga0495591_000620
976 Ga0495591_000927
977 Ga0495591_000952
978 Ga0495591_004093
979 Ga0495591_004366
980 Ga0495591_005039
981 Ga0495591_010535
982 Ga0495591_010610
983 Ga0495591_016064
984 Ga0495638_0000542
985 Ga0495638_0000910
986 Ga0495638_0002355
987 Ga0495638_0003401
988 Ga0495638_0004095
989 Ga0495638_0011875
990 Ga0495638_0023083
991 Ga0495638_0035370
992 Ga0495638_0057641
993 Ga0495653_0001932
994 Ga0495653_0112087
995 Ga0495653_0156194
996 Ga0495650_0001112
997 Ga0495650_0003482
998 Ga0495650_0007130
999 Ga0495650_0021904
1000 Ga0495650_0032901
1001 Ga0495605_0003210
1002 Ga0495605_0008531
1003 Ga0495605_0009602
1004 Ga0495605_0012283
1005 Ga0495605_0013957
1006 Ga0495605_0014740
1007 Ga0495605_0014927
1008 Ga0495584_0001647
1009 Ga0495584_0006548
1010 Ga0495584_0013026
1011 Ga0495584_0051294
1012 Ga0495584_0077911
1013 Ga0495584_0098344
1014 Ga0495585_0000748
1015 Ga0495585_0001333
1016 Ga0495585_0001365
1017 Ga0495585_0002530
1018 Ga0495585_0002556
1019 Ga0495585_0013168
1020 Ga0495585_0015297
1021 Ga0495585_0016751
1022 Ga0495596_0002694
1023 Ga0495607_0000550
1024 Ga0495607_0003006
1025 Ga0495607_0004334
1026 Ga0495607_0004810
1027 Ga0495607_0014080
1028 Ga0495607_0015682
1029 Ga0495607_0017469
1030 Ga0495607_0023361
1031 Ga0495607_0030624
1032 Ga0495607_0032769
1033 Ga0495607_0035585
1034 Ga0495607_0097371
1035 Ga0495583_0001460
1036 Ga0495583_0002079
1037 Ga0495606_0001304
1038 Ga0495606_0001668
1039 Ga0495606_0002205
1040 Ga0495606_0003653
1041 Ga0495606_0006071
1042 Ga0495606_0006248
1043 Ga0495606_0011154
1044 Ga0495606_0027041
1045 Ga0495606_0041587
1046 Ga0495606_0081022
1047 Ga0495610_0001179
1048 Ga0495610_0001556
1049 Ga0495610_0001951
1050 Ga0495610_0005126
1051 Ga0495610_0008970
1052 Ga0495610_0009308
1053 Ga0495610_0009680
1054 Ga0495610_0010659
1055 Ga0495610_0018408
1056 Ga0495610_0041445
1057 Ga0495616_0000505
1058 Ga0495616_0000511
1059 Ga0495616_0000706
1060 Ga0495616_0001350
1061 Ga0495616_0009378
1062 Ga0495616_0014433
1063 Ga0495616_0031845
1064 Ga0495616_0034389
1065 Ga0495616_0042765
1066 Ga0495620_0000355
1067 Ga0495620_0001051
1068 Ga0495620_0003252
1069 Ga0495620_0006617
1070 Ga0495620_0008488
1071 Ga0495620_0021596
1072 Ga0495631_0000286
1073 Ga0495631_0000532
1074 Ga0495631_0001328
1075 Ga0495631_0003875
1076 Ga0495631_0014785
1077 Ga0495631_0038245
1078 Ga0495632_0000497
1079 Ga0495632_0001765
1080 Ga0495632_0014476
1081 Ga0495632_0015046
1082 Ga0495632_0019015
1083 Ga0495632_0020606
1084 Ga0495632_0020770
1085 Ga0495632_0024211
1086 Ga0495632_0024436
1087 Ga0495632_0026375
1088 Ga0495632_0058350
1089 Ga0495632_0064957
1090 Ga0495632_0083436
1091 Ga0495637_0000655
1092 Ga0495637_0001364
1093 Ga0495637_0002550
1094 Ga0495637_0003412
1095 Ga0495637_0014090
1096 Ga0495637_0030428
1097 Ga0495637_0045023
1098 Ga0495637_0063916
1099 Ga0495637_0201306
1100 Ga0495643_0002882
1101 Ga0495643_0021217
1102 Ga0495643_0043048
1103 Ga0495643_0131278
1104 Ga0495644_0000278
1105 Ga0495644_0000335
1106 Ga0495648_0000215
1107 Ga0495648_0000735
1108 Ga0495648_0001320
1109 Ga0495648_0006966
1110 Ga0495648_0012221
1111 Ga0495648_0026658
1112 Ga0495648_0041652
1113 Ga0495648_0053914
1114 Ga0495648_0070908
1115 Ga0495666_0001177
1116 Ga0495666_0159970
1117 Ga0495654_0000412
1118 Ga0495654_0000786
1119 Ga0495654_0000951
1120 Ga0495654_0002256
1121 Ga0495654_0002723
1122 Ga0495654_0003741
1123 Ga0495654_0004154
1124 Ga0495654_0022278
1125 Ga0495654_0032070
1126 Ga0495654_0033459
1127 Ga0495654_0039929
1128 Ga0495654_0078461
1129 Ga0495654_0081115
1130 Ga0495654_0118955
1131 Ga0495587_0012305
1132 Ga0495587_0023022
1133 Ga0495609_0000505
1134 Ga0495609_0012433
1135 Ga0495609_0014930
1136 Ga0495609_0020787
1137 Ga0495609_0049260
1138 Ga0495597_0000659
1139 Ga0495597_0004542
1140 Ga0495597_0006301
1141 Ga0495597_0025178
1142 Ga0495597_0026390
1143 Ga0495597_0124827
1144 Ga0495645_0011416
1145 Ga0495622_0000739
1146 Ga0495622_0011990
1147 Ga0495622_0089187
1148 Ga0495633_0001604
1149 Ga0495633_0006087
1150 Ga0495633_0007049
1151 Ga0495633_0144587
1152 Ga0495656_0087346
1153 Ga0495668_0000891
1154 Ga0495668_0028975
1155 Ga0495668_0081667
1156 Ga0495668_0125832
1157 Ga0495634_0000750
1158 Ga0495634_0007094
1159 Ga0495611_0000255
1160 Ga0495611_0014616
1161 Ga0495611_0087104
1162 Ga0495625_0002197
1163 Ga0495625_0009697
1164 Ga0495625_0019920
1165 Ga0495625_0032472
1166 Ga0495625_0038779
1167 Ga0495625_0070957
1168 Ga0495635_0000942
1169 Ga0495661_0000363
1170 Ga0495661_0001713
1171 Ga0495661_0009466
1172 Ga0495661_0015380
1173 Ga0495661_0030675
1174 Ga0495661_0031300
1175 Ga0495661_0082255
1176 Ga0495661_0138151
1177 Ga0495661_0210817
1178 Ga0495588_0010988
1179 Ga0495588_0023567
1180 Ga0495623_0007457
1181 Ga0495623_0008514
1182 Ga0495646_0016256
1183 Ga0495613_0002793
1184 Ga0495613_0036504
1185 Ga0495613_0198749
1186 Ga0495624_0000185
1187 Ga0495670_0000410
1188 Ga0495670_0009802
1189 Ga0495670_0014410
1190 Ga0495670_0137577
1191 Ga0495670_0213317
1192 Ga0495671_0001703
1193 Ga0495671_0004276
1194 Ga0495671_0006964
1195 Ga0495671_0010655
1196 Ga0495671_0013376
1197 Ga0495671_0016278
1198 Ga0495671_0023634
1199 Ga0495671_0029795
1200 Ga0495671_0034411
1201 Ga0495671_0060970
1202 Ga0495649_0001334
1203 Ga0495649_0001421
1204 Ga0495649_0002090
1205 Ga0495649_0002896
1206 Ga0495649_0004480
1207 Ga0495649_0004685
1208 Ga0495649_0004975
1209 Ga0495649_0013193
1210 Ga0495649_0138953
1211 Ga0495589_0000425
1212 Ga0495589_0004022
1213 Ga0495589_0015647
1214 Ga0495589_0019091
1215 Ga0495589_0024165
1216 Ga0495600_0037531
1217 Ga0495600_0046433
1218 Ga0495660_0000504
1219 Ga0495660_0002181
1220 Ga0495660_0005835
1221 Ga0495660_0015245
1222 Ga0495660_0030600
1223 Ga0495660_0052370
1224 Ga0495660_0069640
1225 Ga0495660_0131674
1226 Ga0495660_0243870
1227 Ga0495604_0011205
1228 Ga0495604_0015620
1229 Ga0495674_0020483
1230 Ga0495672_0000726
1231 Ga0495672_0001739
1232 Ga0495672_0002786
1233 Ga0495672_0008066
1234 Ga0495672_0009193
1235 Ga0495672_0014554
1236 Ga0495672_0028260
1237 Ga0495672_0033347
1238 Ga0495672_0071300
1239 Ga0495676_0000884
1240 Ga0495676_0001079
1241 Ga0495680_0001910
1242 Ga0495680_0010782
1243 Ga0495680_0055316
1244 Ga0495680_0099088
1245 Ga0495680_0397819
1246 Ga0495683_0000452
1247 Ga0495683_0001738
1248 Ga0495683_0002619
1249 Ga0495683_0016173
1250 Ga0495683_0027610
1251 Ga0495675_0137170
1252 Ga0495677_0202361
1253 Ga0495679_001297
1254 Ga0495679_001838
1255 Ga0495679_004171
1256 Ga0495679_005915
1257 Ga0495679_011441
1258 Ga0495673_0000759
1259 Ga0495673_0000890
1260 Ga0495673_0001076
1261 Ga0495673_0002437
1262 Ga0495673_0009592
1263 Ga0495673_0026582
1264 Ga0495673_0038735
1265 Ga0495673_0072708
1266 Ga0495681_0000171
1267 Ga0495681_0000457
1268 Ga0495681_0000508
1269 Ga0495681_0000981
1270 Ga0495681_0005014
1271 Ga0495681_0008238
1272 Ga0495681_0008861
1273 Ga0495681_0012190
1274 Ga0495681_0016417
1275 Ga0495681_0027611
1276 Ga0495684_0002673
1277 Ga0495686_0002074
1278 Ga0495686_0011047
1279 Ga0495686_0030379
1280 Ga0495686_0080202
1281 Ga0495593_0003815
1282 Ga0495593_0006571
1283 Ga0495593_0011499
1284 Ga0495593_0024249
1285 Ga0495602_0000848
1286 Ga0495614_0074733
1287 Ga0495626_0000726
1288 Ga0495626_0001495
1289 Ga0495626_0006234
1290 Ga0495626_0010707
1291 Ga0495626_0010974
1292 Ga0495626_0011213
1293 Ga0495626_0015308
1294 Ga0496101_0518212
1295 Ga0496102_0000419
1296 Ga0496103_0001964
1297 Ga0496106_0055543
1298 Ga0496106_0180064
1299 Ga0496110_0080720
1300 Ga0496111_0209034
1301 Ga0496116_0000338
1302 Ga0496116_0001012
1303 Ga0496116_0002599
1304 Ga0496116_0004365
1305 Ga0496116_0012636
1306 Ga0496116_0024608
1307 Ga0496116_0049883
1308 Ga0496116_0109461
1309 Ga0496117_0000712
1310 Ga0496117_0003653
1311 Ga0496117_0005368
1312 Ga0496117_0005706
1313 Ga0496117_0006175
1314 Ga0496117_0006888
1315 Ga0496117_0015564
1316 Ga0496117_0027875
1317 Ga0496117_0046700
1318 Ga0496118_0004004
1319 Ga0496118_0005607
1320 Ga0496118_0028792
1321 Ga0496118_0039993
1322 Ga0496118_0109646
1323 Ga0496119_0003010
1324 Ga0496119_0011059
1325 Ga0496119_0075535
1326 Ga0496119_0104940
1327 Ga0496120_0001345
1328 Ga0496120_0006476
1329 Ga0496120_0020080
1330 Ga0496121_0000713
1331 Ga0496121_0001802
1332 Ga0496121_0005084
1333 Ga0496121_0006906
1334 Ga0496121_0013221
1335 Ga0496121_0029593
1336 Ga0496121_0055549
1337 Ga0496122_0003076
1338 Ga0496122_0004317
1339 Ga0496122_0008121
1340 Ga0496122_0009196
1341 Ga0496122_0009627
1342 Ga0496122_0009764
1343 Ga0496122_0014063
1344 Ga0496122_0033721
1345 Ga0496122_0164034
1346 Ga0496123_0002303
1347 Ga0496123_0004296
1348 Ga0496123_0006317
1349 Ga0496123_0008403
1350 Ga0496123_0010737
1351 Ga0496123_0012181
1352 Ga0496123_0035016
1353 Ga0496123_0072847
1354 Ga0496124_0001071
1355 Ga0496124_0001277
1356 Ga0496124_0003709
1357 Ga0496124_0005979
1358 Ga0496124_0007771
1359 Ga0496124_0029997
1360 Ga0496124_0334065
1361 Ga0496125_0000948
1362 Ga0496125_0002443
1363 Ga0496125_0004226
1364 Ga0496125_0007586
1365 Ga0496125_0011572
1366 Ga0496125_0015480
1367 Ga0496125_0064739
1368 Ga0496125_0146537
1369 Ga0496126_0011442
1370 Ga0495678_000534
1371 Ga0495678_001271
1372 Ga0495678_005619
1373 Ga0495678_006249
1374 Ga0495678_006916
1375 Ga0495678_009530
1376 Ga0495678_015047
1377 Ga0495678_015398
1378 Ga0495678_017139
1379 Ga0495678_046412
1380 Ga0495678_085437
1381 Ga0495682_0001524
1382 Ga0495682_0002821
1383 Ga0495682_0007293
1384 Ga0495682_0007711
1385 Ga0495682_0053429
1386 Ga0501240_000795
1387 Ga0501241_000245
1388 Ga0501269_002785
1389 nmdc:mga00v17_14617_c2
1390 Ga0500572_000413
1391 Ga0500634_0000868
1392 2511292119
1393 2511294789
1394 2511359992
1395 2511367155
1396 2511413821
1397 2555667643
1398 2597867601
1399 2599356862
1400 2599363108
1401 2599369940
1402 2599376217
1403 2599381967
1404 2599387889
1405 2599395585
1406 2599402187
1407 2599407350
1408 2599454605
1409 2599463695
1410 2599468957
1411 2599492714
1412 2599516013
1413 2599521812
1414 2599882870
1415 2599895391
1416 2599950989
1417 2600216324
1418 2601776491
1419 2601798054
1420 2606076463
1421 2606129123
1422 2624478452
1423 2643841211
1424 2643872416
1425 2644190015
1426 2671099749
1427 2677899555
1428 2715753913
1429 2715759571
1430 2718632380
1431 2738807692
1432 2738895052
1433 2739316818
1434 2774134964
1435 2784260814
1436 2809218194
1437 2819657459
1438 2819705435
1439 2834032011
1440 2842834381
1441 2842846141
1442 2852660219
1443 2860345629
1444 2878030387
1445 2880231342
1446 2904519798
1447 2908447238
1448 2917071396
1449 2919065921
1450 2919389549
1451 2919460210
1452 2919488481
1453 2929190496
1454 2931391590
1455 2931399065
1456 2935359222
1457 2945929957
1458 2945967810
1459 2946012290
1460 2946028845
1461 2947235380
1462 2969305183
1463 2974293127
1464 2998140685
1465 3007399836
1466 3007617533
1467 3007620889
1468 3007722144
1469 3007859914
1470 3007864106
1471 637318035
1472 8019770514
1473 8030000054
1474 8054286356
1475 8055818608
1476 8056152682
1477 8056161622
1478 8056170361
1479 8056176488
1480 8056182820
1481 8056573521
1482 8057802921

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13414

TPR_11

TPR repeat

121

161

0.97

PF13181

TPR_8

Tetratricopeptide repeat

114

147

0.93

PF14559

TPR_19

Tetratricopeptide repeat

124

183

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7msn-assembly1.cif.gz_B suns glycosin s-glycosyltransferase 0.8593 102 181
7msp-assembly2.cif.gz_B suns glycosin s-glycosyltransferase 0.7868 102 191
7msn-assembly1.cif.gz_A suns glycosin s-glycosyltransferase 0.7642 102 198
4cgq-assembly1.cif.gz_A full length tah1 bound to hsp90 peptide srmeevd 0.7561 120 197
4uzy-assembly1.cif.gz_A crystal structure of the chlamydomonas ift70 and ift52 complex 0.7521 103 197
ID Description Score Start End Superfamily
af_Q8N394_759_830_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9649 103 169 1.25.40.10
af_Q8IUR5_529_612_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9581 103 181 1.25.40.10
af_Q4DCN5_349_413_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9503 103 164 1.25.40.10
af_M0RBH7_295_374_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9482 102 169 1.25.40.10
af_Q67YJ9_465_551_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9446 107 181 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A0P9VN55-F1-model_v4 Uncharacterized protein 0.8509 113 215
AF-A0A0P9VN55-F1-model_v4 Uncharacterized protein 0.8196 113 215
AF-A0A3M3ZFS6-F1-model_v4 Uncharacterized protein 0.7929 101 220
AF-A0A0P9P984-F1-model_v4 Lipoprotein 0.7844 10 114
AF-A0A7S0MD92-F1-model_v4 Uncharacterized protein 0.7552 102 212 GO:0051087

Map