F478600
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 741 | 286 | 1482 | 230 |
Family's Representative Sequence
| Representative Sequence | 3300042137|Ga0450902_000126|Ga0450902_000126_2101_2853 |
| Length | 250 |
| Sequence | MKMTMAMESDLMKALMVMASLLLLGGCATDGQAPWTTMLAPASCSKLSSEQELSLNLADDLVNDGKLHASLANLQSLPDNLVEVRLRKAKVYRLLGRSEAEPLYRSLLGTCLNADAEHGLGQLYAARGDNGQAQAHLQRAARLAPTNENIRNDLGVVYLNQLRLEDARFEFLTAIELKQNNQLATLNLVTLLLYQNNWQQAAEVVSRAHLTPEQFSDAQERAEKLKSPVRARPVAGNQVAVAIDAQPAIK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 2 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 3 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 4 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 6 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 7 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 8 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 17 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 20 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 21 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 22 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 23 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 24 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 25 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 33 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 41 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 42 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 43 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 44 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 46 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 47 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 49 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 51 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 68 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 69 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 71 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 72 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 73 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 74 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 75 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 76 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 77 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 78 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 79 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 80 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 81 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 82 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 83 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 84 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 85 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 86 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 87 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 88 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 89 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 90 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 91 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 92 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 93 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 94 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 95 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 96 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 97 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 98 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 99 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 100 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 101 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 102 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 103 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 104 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 172 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 173 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 174 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 175 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 176 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 177 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 178 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 179 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 180 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 181 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 182 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 183 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 184 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 185 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 186 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 187 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 188 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 191 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 192 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 193 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 194 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 195 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 196 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 197 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 198 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 199 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 200 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 201 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 202 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 203 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 204 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 205 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 206 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 207 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 208 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 209 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 210 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 211 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 212 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 213 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 214 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 215 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 216 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 217 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 218 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 219 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 220 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 221 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 222 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 223 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 224 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 225 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 226 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 227 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 228 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 229 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 230 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 231 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 232 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 233 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 234 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 235 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 236 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 237 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 238 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 239 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 240 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 241 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 242 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 243 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 244 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 245 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 246 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 247 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 248 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 249 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 250 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 251 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 252 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 253 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 254 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 255 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 256 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 257 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 258 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 259 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 260 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 261 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 262 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 263 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 264 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 265 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 266 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 267 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 268 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 269 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 270 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 271 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 272 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 273 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 274 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 275 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 276 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 277 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 278 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 279 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 280 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 281 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 282 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 283 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 284 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 285 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 286 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.72 |
| Metatranscriptomes | 0 |
| Isolates | 12.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.37 |
| Nodule | 1.08 |
| Rhizoplane | 4.32 |
| Rhizosphere | 78.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0450902_000126 | 3300042137 | Bacteria | 8236 |
| 2 | JGI25162J39368_1000195 | 3300002737 | Bacteria | 63625 |
| 3 | JGI25163J39215_1000123 | 3300002771 | Bacteria | 32339 |
| 4 | JGI25164J39214_1000225 | 3300002772 | Bacteria | 44028 |
| 5 | JGI25165J46597_1000291 | 3300003214 | Bacteria | 63625 |
| 6 | Ga0055536_1000299 | 3300003781 | Bacteria | 37245 |
| 7 | Ga0055536_1002690 | 3300003781 | Bacteria | 9864 |
| 8 | Ga0055530_10000340 | 3300003791 | Bacteria | 42245 |
| 9 | Ga0055540_1000162 | 3300003792 | Bacteria | 66694 |
| 10 | Ga0055531_10000734 | 3300003794 | Bacteria | 27738 |
| 11 | Ga0065714_10005355 | 3300005288 | Bacteria | 4141 |
| 12 | Ga0065714_10064550 | 3300005288 | Bacteria | 37462 |
| 13 | Ga0065714_10095920 | 3300005288 | Bacteria | 1774 |
| 14 | Ga0065704_10101121 | 3300005289 | Bacteria | 2249 |
| 15 | Ga0065712_10091402 | 3300005290 | Bacteria | 2375 |
| 16 | Ga0070670_100001980 | 3300005331 | Bacteria | 16755 |
| 17 | Ga0070669_100000487 | 3300005353 | Bacteria | 30089 |
| 18 | Ga0070669_100000956 | 3300005353 | Bacteria | 21096 |
| 19 | Ga0070662_100000137 | 3300005457 | Bacteria | 41312 |
| 20 | Ga0070662_100014133 | 3300005457 | Bacteria | 5327 |
| 21 | Ga0068853_100003083 | 3300005539 | Bacteria | 12733 |
| 22 | Ga0070665_100044833 | 3300005548 | Bacteria | 4440 |
| 23 | Ga0070665_100180913 | 3300005548 | Bacteria | 2109 |
| 24 | Ga0070664_100004017 | 3300005564 | Bacteria | 11813 |
| 25 | Ga0068854_100052077 | 3300005578 | Bacteria | 2934 |
| 26 | Ga0068851_10000004 | 3300005834 | Bacteria | 269685 |
| 27 | Ga0075363_100195622 | 3300006048 | Bacteria | 1154 |
| 28 | Ga0075364_10023533 | 3300006051 | Bacteria | 3901 |
| 29 | Ga0075432_10001534 | 3300006058 | Bacteria | 7573 |
| 30 | Ga0079104_1008163 | 3300006946 | Bacteria | 3701 |
| 31 | Ga0105251_10000378 | 3300009011 | Bacteria | 43722 |
| 32 | Ga0105251_10001590 | 3300009011 | Bacteria | 19393 |
| 33 | Ga0105251_10002232 | 3300009011 | Bacteria | 15456 |
| 34 | Ga0105251_10002448 | 3300009011 | Bacteria | 14586 |
| 35 | Ga0105251_10004027 | 3300009011 | Bacteria | 10360 |
| 36 | Ga0105251_10005274 | 3300009011 | Bacteria | 8502 |
| 37 | Ga0105251_10011087 | 3300009011 | Bacteria | 5170 |
| 38 | Ga0105251_10011613 | 3300009011 | Bacteria | 5025 |
| 39 | Ga0105251_10025992 | 3300009011 | Bacteria | 2986 |
| 40 | Ga0105251_10195102 | 3300009011 | Bacteria | 912 |
| 41 | Ga0105244_10001726 | 3300009036 | Bacteria | 17210 |
| 42 | Ga0105244_10003786 | 3300009036 | Bacteria | 10673 |
| 43 | Ga0105244_10012893 | 3300009036 | Bacteria | 4919 |
| 44 | Ga0105244_10029320 | 3300009036 | Bacteria | 2943 |
| 45 | Ga0105244_10134580 | 3300009036 | Bacteria | 1191 |
| 46 | Ga0105250_10001060 | 3300009092 | Bacteria | 15713 |
| 47 | Ga0105250_10001756 | 3300009092 | Bacteria | 11420 |
| 48 | Ga0105250_10002278 | 3300009092 | Bacteria | 9754 |
| 49 | Ga0105250_10015196 | 3300009092 | Bacteria | 3154 |
| 50 | Ga0105250_10015343 | 3300009092 | Bacteria | 3137 |
| 51 | Ga0105250_10015500 | 3300009092 | Bacteria | 3121 |
| 52 | Ga0105243_10000225 | 3300009148 | Bacteria | 65179 |
| 53 | Ga0105243_10001399 | 3300009148 | Bacteria | 21339 |
| 54 | Ga0105243_10051250 | 3300009148 | Bacteria | 3264 |
| 55 | Ga0105248_10013078 | 3300009177 | Bacteria | 9140 |
| 56 | Ga0105239_10367155 | 3300010375 | Bacteria | 1626 |
| 57 | Ga0105246_10000388 | 3300011119 | Bacteria | 23524 |
| 58 | Ga0105246_10001581 | 3300011119 | Bacteria | 13546 |
| 59 | Ga0105246_10005439 | 3300011119 | Bacteria | 7759 |
| 60 | Ga0157345_1000032 | 3300012498 | Bacteria | 34992 |
| 61 | Ga0157373_10000478 | 3300013100 | Bacteria | 31776 |
| 62 | Ga0157373_10000520 | 3300013100 | Bacteria | 30210 |
| 63 | Ga0157373_10000957 | 3300013100 | Bacteria | 22395 |
| 64 | Ga0157373_10001143 | 3300013100 | Bacteria | 20374 |
| 65 | Ga0157373_10003846 | 3300013100 | Bacteria | 11351 |
| 66 | Ga0157373_10004155 | 3300013100 | Bacteria | 10919 |
| 67 | Ga0157373_10041792 | 3300013100 | Bacteria | 3279 |
| 68 | Ga0157373_10063759 | 3300013100 | Bacteria | 2609 |
| 69 | Ga0157371_10001273 | 3300013102 | Bacteria | 26580 |
| 70 | Ga0157371_10002656 | 3300013102 | Bacteria | 16922 |
| 71 | Ga0157371_10004342 | 3300013102 | Bacteria | 12430 |
| 72 | Ga0157371_10012005 | 3300013102 | Bacteria | 6640 |
| 73 | Ga0157370_10056395 | 3300013104 | Bacteria | 3739 |
| 74 | Ga0157370_10124707 | 3300013104 | Bacteria | 2404 |
| 75 | Ga0157370_10252986 | 3300013104 | Bacteria | 1629 |
| 76 | Ga0157370_10297740 | 3300013104 | Bacteria | 1489 |
| 77 | Ga0157369_10001544 | 3300013105 | Bacteria | 28184 |
| 78 | Ga0157369_10002672 | 3300013105 | Bacteria | 21260 |
| 79 | Ga0157369_10009425 | 3300013105 | Bacteria | 11160 |
| 80 | Ga0157369_10025492 | 3300013105 | Bacteria | 6566 |
| 81 | Ga0157369_10089566 | 3300013105 | Bacteria | 3285 |
| 82 | Ga0157369_10093228 | 3300013105 | Bacteria | 3215 |
| 83 | Ga0163162_10000902 | 3300013306 | Bacteria | 27672 |
| 84 | Ga0163162_10001902 | 3300013306 | Bacteria | 19672 |
| 85 | Ga0163162_10027322 | 3300013306 | Bacteria | 5643 |
| 86 | Ga0163162_10079639 | 3300013306 | Bacteria | 3342 |
| 87 | Ga0163162_10109707 | 3300013306 | Bacteria | 2856 |
| 88 | Ga0157372_10001315 | 3300013307 | Bacteria | 26899 |
| 89 | Ga0157375_10030722 | 3300013308 | Bacteria | 5069 |
| 90 | Ga0157375_10421181 | 3300013308 | Bacteria | 1501 |
| 91 | Ga0182008_10000453 | 3300014497 | Bacteria | 31306 |
| 92 | Ga0182008_10002063 | 3300014497 | Bacteria | 12875 |
| 93 | Ga0182008_10002202 | 3300014497 | Bacteria | 12361 |
| 94 | Ga0182008_10003707 | 3300014497 | Bacteria | 9113 |
| 95 | Ga0182008_10003797 | 3300014497 | Bacteria | 8976 |
| 96 | Ga0182006_1000793 | 3300015261 | Bacteria | 21248 |
| 97 | Ga0182006_1001453 | 3300015261 | Bacteria | 14278 |
| 98 | Ga0182006_1019703 | 3300015261 | Bacteria | 2837 |
| 99 | Ga0182006_1062786 | 3300015261 | Bacteria | 1397 |
| 100 | Ga0182006_1089673 | 3300015261 | Bacteria | 1108 |
| 101 | Ga0182006_1089847 | 3300015261 | Bacteria | 1107 |
| 102 | Ga0182006_1098899 | 3300015261 | Bacteria | 1038 |
| 103 | Ga0182007_10000283 | 3300015262 | Bacteria | 33739 |
| 104 | Ga0182007_10056599 | 3300015262 | Bacteria | 1288 |
| 105 | Ga0182005_1014025 | 3300015265 | Bacteria | 2248 |
| 106 | Ga0182005_1053790 | 3300015265 | Bacteria | 1096 |
| 107 | Ga0182005_1055009 | 3300015265 | Bacteria | 1084 |
| 108 | Ga0163161_10002587 | 3300017792 | Bacteria | 12909 |
| 109 | Ga0163161_10002849 | 3300017792 | Bacteria | 12268 |
| 110 | Ga0163161_10004085 | 3300017792 | Bacteria | 10210 |
| 111 | Ga0163161_10006965 | 3300017792 | Bacteria | 7815 |
| 112 | Ga0163161_10010903 | 3300017792 | Bacteria | 6301 |
| 113 | Ga0163161_10018631 | 3300017792 | Bacteria | 4866 |
| 114 | Ga0163161_10037911 | 3300017792 | Bacteria | 3455 |
| 115 | Ga0163161_10234423 | 3300017792 | Bacteria | 1425 |
| 116 | Ga0163161_10281818 | 3300017792 | Bacteria | 1304 |
| 117 | Ga0163161_10292061 | 3300017792 | Bacteria | 1282 |
| 118 | Ga0209760_100031 | 3300025207 | Bacteria | 141487 |
| 119 | Ga0209563_101022 | 3300025230 | Bacteria | 8139 |
| 120 | Ga0207427_100067 | 3300025231 | Bacteria | 164839 |
| 121 | Ga0209437_100016 | 3300025233 | Bacteria | 710118 |
| 122 | Ga0209233_1000156 | 3300025261 | Bacteria | 164839 |
| 123 | Ga0209675_1008238 | 3300025291 | Bacteria | 3864 |
| 124 | Ga0209676_1000025 | 3300025292 | Bacteria | 577569 |
| 125 | Ga0209676_1000426 | 3300025292 | Bacteria | 73938 |
| 126 | Ga0209050_1000500 | 3300025298 | Bacteria | 66746 |
| 127 | Ga0209051_1000089 | 3300025303 | Bacteria | 175572 |
| 128 | Ga0209257_1000034 | 3300025304 | Bacteria | 662719 |
| 129 | Ga0207656_10000007 | 3300025321 | Bacteria | 289154 |
| 130 | Ga0207696_1000085 | 3300025711 | Bacteria | 195968 |
| 131 | Ga0207696_1000494 | 3300025711 | Bacteria | 33110 |
| 132 | Ga0207696_1002204 | 3300025711 | Bacteria | 9758 |
| 133 | Ga0207696_1014255 | 3300025711 | Bacteria | 2734 |
| 134 | Ga0207696_1022429 | 3300025711 | Bacteria | 2006 |
| 135 | Ga0207655_1000946 | 3300025728 | Bacteria | 30094 |
| 136 | Ga0207655_1002034 | 3300025728 | Bacteria | 17088 |
| 137 | Ga0207655_1002631 | 3300025728 | Bacteria | 14222 |
| 138 | Ga0207655_1013895 | 3300025728 | Bacteria | 4589 |
| 139 | Ga0207713_1000323 | 3300025735 | Bacteria | 54106 |
| 140 | Ga0207713_1000494 | 3300025735 | Bacteria | 40630 |
| 141 | Ga0207713_1000540 | 3300025735 | Bacteria | 37977 |
| 142 | Ga0207713_1001743 | 3300025735 | Bacteria | 16708 |
| 143 | Ga0207713_1001804 | 3300025735 | Bacteria | 16362 |
| 144 | Ga0207713_1002389 | 3300025735 | Bacteria | 13716 |
| 145 | Ga0207713_1004120 | 3300025735 | Bacteria | 9571 |
| 146 | Ga0207713_1007421 | 3300025735 | Bacteria | 6472 |
| 147 | Ga0207713_1057402 | 3300025735 | Bacteria | 1505 |
| 148 | Ga0207681_10001305 | 3300025923 | Bacteria | 16063 |
| 149 | Ga0207681_10002871 | 3300025923 | Bacteria | 10884 |
| 150 | Ga0207650_10000073 | 3300025925 | Bacteria | 137141 |
| 151 | Ga0207706_10000178 | 3300025933 | Bacteria | 70787 |
| 152 | Ga0207706_10024333 | 3300025933 | Bacteria | 5428 |
| 153 | Ga0207709_10000022 | 3300025935 | Bacteria | 383573 |
| 154 | Ga0207709_10000634 | 3300025935 | Bacteria | 28758 |
| 155 | Ga0207711_10102403 | 3300025941 | Bacteria | 2535 |
| 156 | Ga0207679_10031482 | 3300025945 | Bacteria | 3713 |
| 157 | Ga0207640_10249701 | 3300025981 | Bacteria | 1376 |
| 158 | Ga0207639_10014912 | 3300026041 | Bacteria | 5474 |
| 159 | Ga0209281_1006417 | 3300027111 | Bacteria | 3073 |
| 160 | Ga0207428_10111887 | 3300027907 | Bacteria | 2101 |
| 161 | Ga0268266_10084356 | 3300028379 | Bacteria | 2774 |
| 162 | Ga0268266_10223068 | 3300028379 | Bacteria | 1733 |
| 163 | Ga0268266_10287500 | 3300028379 | Bacteria | 1530 |
| 164 | Ga0307517_10024989 | 3300028786 | Bacteria | 7330 |
| 165 | Ga0307515_10373416 | 3300028794 | Bacteria | 1062 |
| 166 | Ga0307511_10142496 | 3300030521 | Bacteria | 1403 |
| 167 | Ga0316178_1157834 | 3300030735 | Bacteria | 9732 |
| 168 | Ga0307509_10025355 | 3300031507 | Bacteria | 6623 |
| 169 | Ga0307408_100009264 | 3300031548 | Bacteria | 6490 |
| 170 | Ga0307516_10280580 | 3300031730 | Bacteria | 1348 |
| 171 | Ga0307405_10000102 | 3300031731 | Bacteria | 35010 |
| 172 | Ga0307412_10006331 | 3300031911 | Bacteria | 6685 |
| 173 | Ga0307412_10087703 | 3300031911 | Bacteria | 2168 |
| 174 | Ga0307414_10317061 | 3300032004 | Bacteria | 1325 |
| 175 | Ga0307411_10055804 | 3300032005 | Bacteria | 2600 |
| 176 | Ga0307510_10001007 | 3300033180 | Bacteria | 29876 |
| 177 | Ga0439438_000202 | 3300041405 | Bacteria | 27274 |
| 178 | Ga0439438_000461 | 3300041405 | Bacteria | 18366 |
| 179 | Ga0439447_001229 | 3300041407 | Bacteria | 9331 |
| 180 | Ga0439445_0002057 | 3300042004 | Bacteria | 4446 |
| 181 | Ga0439432_002878 | 3300042006 | Bacteria | 6412 |
| 182 | Ga0439432_003172 | 3300042006 | Bacteria | 6115 |
| 183 | Ga0439451_000325 | 3300042009 | Bacteria | 9276 |
| 184 | Ga0439451_000367 | 3300042009 | Bacteria | 8724 |
| 185 | Ga0439451_000406 | 3300042009 | Bacteria | 8401 |
| 186 | Ga0439451_003273 | 3300042009 | Bacteria | 3283 |
| 187 | Ga0439451_026996 | 3300042009 | Bacteria | 1157 |
| 188 | Ga0439452_000251 | 3300042010 | Bacteria | 36945 |
| 189 | Ga0439452_000279 | 3300042010 | Bacteria | 33718 |
| 190 | Ga0439452_005026 | 3300042010 | Bacteria | 4321 |
| 191 | Ga0439452_025736 | 3300042010 | Bacteria | 1491 |
| 192 | Ga0439456_003808 | 3300042013 | Bacteria | 3069 |
| 193 | Ga0439463_013773 | 3300042016 | Bacteria | 1992 |
| 194 | Ga0450911_000222 | 3300042115 | Bacteria | 22157 |
| 195 | Ga0450923_065373 | 3300042125 | Bacteria | 799 |
| 196 | Ga0450892_007631 | 3300042130 | Bacteria | 916 |
| 197 | Ga0450894_004725 | 3300042131 | Bacteria | 1767 |
| 198 | Ga0450896_007777 | 3300042133 | Bacteria | 1480 |
| 199 | Ga0450898_000500 | 3300042134 | Bacteria | 4580 |
| 200 | Ga0450899_003279 | 3300042135 | Bacteria | 1743 |
| 201 | Ga0450903_000290 | 3300042138 | Bacteria | 11087 |
| 202 | Ga0450903_001109 | 3300042138 | Bacteria | 5110 |
| 203 | Ga0450904_000401 | 3300042139 | Bacteria | 8872 |
| 204 | Ga0450905_000016 | 3300042142 | Bacteria | 15938 |
| 205 | Ga0450906_000142 | 3300042145 | Bacteria | 13113 |
| 206 | Ga0450908_015984 | 3300042184 | Bacteria | 1341 |
| 207 | Ga0450918_004664 | 3300042531 | Bacteria | 2486 |
| 208 | Ga0450893_0001166 | 3300042532 | Bacteria | 3963 |
| 209 | Ga0450893_0012758 | 3300042532 | Bacteria | 1396 |
| 210 | Ga0495617_003955 | 3300046452 | Bacteria | 5458 |
| 211 | Ga0495617_008190 | 3300046452 | Bacteria | 3609 |
| 212 | Ga0495617_008301 | 3300046452 | Bacteria | 3583 |
| 213 | Ga0495617_008758 | 3300046452 | Bacteria | 3484 |
| 214 | Ga0495617_009272 | 3300046452 | Bacteria | 3378 |
| 215 | Ga0495617_012325 | 3300046452 | Bacteria | 2912 |
| 216 | Ga0495617_013075 | 3300046452 | Bacteria | 2828 |
| 217 | Ga0495617_013134 | 3300046452 | Bacteria | 2820 |
| 218 | Ga0495617_024895 | 3300046452 | Bacteria | 2018 |
| 219 | Ga0495617_055170 | 3300046452 | Bacteria | 1318 |
| 220 | Ga0495627_000147 | 3300046453 | Bacteria | 84285 |
| 221 | Ga0495627_000549 | 3300046453 | Bacteria | 30961 |
| 222 | Ga0495627_000859 | 3300046453 | Bacteria | 21684 |
| 223 | Ga0495627_001809 | 3300046453 | Bacteria | 11397 |
| 224 | Ga0495627_006732 | 3300046453 | Bacteria | 4472 |
| 225 | Ga0495627_009104 | 3300046453 | Bacteria | 3667 |
| 226 | Ga0495627_026082 | 3300046453 | Bacteria | 1888 |
| 227 | Ga0495627_058420 | 3300046453 | Bacteria | 1145 |
| 228 | Ga0495627_116131 | 3300046453 | Bacteria | 757 |
| 229 | Ga0495592_0014254 | 3300046454 | Bacteria | 6037 |
| 230 | Ga0495590_0001031 | 3300046457 | Bacteria | 12276 |
| 231 | Ga0495590_0001766 | 3300046457 | Bacteria | 9177 |
| 232 | Ga0495590_0010833 | 3300046457 | Bacteria | 3416 |
| 233 | Ga0495590_0012641 | 3300046457 | Bacteria | 3128 |
| 234 | Ga0495591_000620 | 3300046458 | Bacteria | 26619 |
| 235 | Ga0495591_000927 | 3300046458 | Bacteria | 20169 |
| 236 | Ga0495591_000952 | 3300046458 | Bacteria | 19793 |
| 237 | Ga0495591_004093 | 3300046458 | Bacteria | 7259 |
| 238 | Ga0495591_004366 | 3300046458 | Bacteria | 6965 |
| 239 | Ga0495591_005039 | 3300046458 | Bacteria | 6215 |
| 240 | Ga0495591_010535 | 3300046458 | Bacteria | 3575 |
| 241 | Ga0495591_010610 | 3300046458 | Bacteria | 3554 |
| 242 | Ga0495591_016064 | 3300046458 | Bacteria | 2621 |
| 243 | Ga0495638_0000542 | 3300046460 | Bacteria | 43515 |
| 244 | Ga0495638_0000910 | 3300046460 | Bacteria | 30212 |
| 245 | Ga0495638_0002355 | 3300046460 | Bacteria | 15490 |
| 246 | Ga0495638_0003401 | 3300046460 | Bacteria | 12542 |
| 247 | Ga0495638_0004095 | 3300046460 | Bacteria | 11154 |
| 248 | Ga0495638_0011875 | 3300046460 | Bacteria | 5988 |
| 249 | Ga0495638_0023083 | 3300046460 | Bacteria | 4075 |
| 250 | Ga0495638_0035370 | 3300046460 | Bacteria | 3185 |
| 251 | Ga0495638_0057641 | 3300046460 | Bacteria | 2408 |
| 252 | Ga0495653_0001932 | 3300046463 | Bacteria | 16339 |
| 253 | Ga0495653_0112087 | 3300046463 | Bacteria | 1958 |
| 254 | Ga0495653_0156194 | 3300046463 | Bacteria | 1588 |
| 255 | Ga0495650_0001112 | 3300046471 | Bacteria | 29424 |
| 256 | Ga0495650_0003482 | 3300046471 | Bacteria | 11436 |
| 257 | Ga0495650_0007130 | 3300046471 | Bacteria | 6787 |
| 258 | Ga0495650_0021904 | 3300046471 | Bacteria | 3074 |
| 259 | Ga0495650_0032901 | 3300046471 | Bacteria | 2313 |
| 260 | Ga0495605_0003210 | 3300046474 | Bacteria | 9807 |
| 261 | Ga0495605_0008531 | 3300046474 | Bacteria | 5791 |
| 262 | Ga0495605_0009602 | 3300046474 | Bacteria | 5434 |
| 263 | Ga0495605_0012283 | 3300046474 | Bacteria | 4753 |
| 264 | Ga0495605_0013957 | 3300046474 | Bacteria | 4411 |
| 265 | Ga0495605_0014740 | 3300046474 | Bacteria | 4270 |
| 266 | Ga0495605_0014927 | 3300046474 | Bacteria | 4236 |
| 267 | Ga0495584_0001647 | 3300046491 | Bacteria | 13128 |
| 268 | Ga0495584_0006548 | 3300046491 | Bacteria | 6087 |
| 269 | Ga0495584_0013026 | 3300046491 | Bacteria | 4243 |
| 270 | Ga0495584_0051294 | 3300046491 | Bacteria | 2077 |
| 271 | Ga0495584_0077911 | 3300046491 | Bacteria | 1667 |
| 272 | Ga0495584_0098344 | 3300046491 | Bacteria | 1478 |
| 273 | Ga0495585_0000748 | 3300046492 | Bacteria | 28801 |
| 274 | Ga0495585_0001333 | 3300046492 | Bacteria | 19603 |
| 275 | Ga0495585_0001365 | 3300046492 | Bacteria | 19315 |
| 276 | Ga0495585_0002530 | 3300046492 | Bacteria | 12996 |
| 277 | Ga0495585_0002556 | 3300046492 | Bacteria | 12895 |
| 278 | Ga0495585_0013168 | 3300046492 | Bacteria | 4846 |
| 279 | Ga0495585_0015297 | 3300046492 | Bacteria | 4458 |
| 280 | Ga0495585_0016751 | 3300046492 | Bacteria | 4245 |
| 281 | Ga0495596_0002694 | 3300046500 | Bacteria | 9366 |
| 282 | Ga0495607_0000550 | 3300046501 | Bacteria | 36652 |
| 283 | Ga0495607_0003006 | 3300046501 | Bacteria | 13165 |
| 284 | Ga0495607_0004334 | 3300046501 | Bacteria | 10465 |
| 285 | Ga0495607_0004810 | 3300046501 | Bacteria | 9850 |
| 286 | Ga0495607_0014080 | 3300046501 | Bacteria | 5220 |
| 287 | Ga0495607_0015682 | 3300046501 | Bacteria | 4905 |
| 288 | Ga0495607_0017469 | 3300046501 | Bacteria | 4603 |
| 289 | Ga0495607_0023361 | 3300046501 | Bacteria | 3871 |
| 290 | Ga0495607_0030624 | 3300046501 | Bacteria | 3302 |
| 291 | Ga0495607_0032769 | 3300046501 | Bacteria | 3168 |
| 292 | Ga0495607_0035585 | 3300046501 | Bacteria | 3010 |
| 293 | Ga0495607_0097371 | 3300046501 | Bacteria | 1582 |
| 294 | Ga0495583_0001460 | 3300046506 | Bacteria | 23844 |
| 295 | Ga0495583_0002079 | 3300046506 | Bacteria | 18065 |
| 296 | Ga0495606_0001304 | 3300046507 | Bacteria | 34367 |
| 297 | Ga0495606_0001668 | 3300046507 | Bacteria | 28854 |
| 298 | Ga0495606_0002205 | 3300046507 | Bacteria | 23321 |
| 299 | Ga0495606_0003653 | 3300046507 | Bacteria | 16123 |
| 300 | Ga0495606_0006071 | 3300046507 | Bacteria | 11286 |
| 301 | Ga0495606_0006248 | 3300046507 | Bacteria | 11059 |
| 302 | Ga0495606_0011154 | 3300046507 | Bacteria | 7362 |
| 303 | Ga0495606_0027041 | 3300046507 | Bacteria | 4074 |
| 304 | Ga0495606_0041587 | 3300046507 | Bacteria | 3081 |
| 305 | Ga0495606_0081022 | 3300046507 | Bacteria | 2018 |
| 306 | Ga0495610_0001179 | 3300046512 | Bacteria | 23660 |
| 307 | Ga0495610_0001556 | 3300046512 | Bacteria | 20208 |
| 308 | Ga0495610_0001951 | 3300046512 | Bacteria | 17738 |
| 309 | Ga0495610_0005126 | 3300046512 | Bacteria | 9414 |
| 310 | Ga0495610_0008970 | 3300046512 | Bacteria | 6394 |
| 311 | Ga0495610_0009308 | 3300046512 | Bacteria | 6224 |
| 312 | Ga0495610_0009680 | 3300046512 | Bacteria | 6064 |
| 313 | Ga0495610_0010659 | 3300046512 | Bacteria | 5691 |
| 314 | Ga0495610_0018408 | 3300046512 | Bacteria | 3947 |
| 315 | Ga0495610_0041445 | 3300046512 | Bacteria | 2311 |
| 316 | Ga0495616_0000505 | 3300046513 | Bacteria | 29552 |
| 317 | Ga0495616_0000511 | 3300046513 | Bacteria | 29411 |
| 318 | Ga0495616_0000706 | 3300046513 | Bacteria | 24753 |
| 319 | Ga0495616_0001350 | 3300046513 | Bacteria | 17116 |
| 320 | Ga0495616_0009378 | 3300046513 | Bacteria | 5733 |
| 321 | Ga0495616_0014433 | 3300046513 | Bacteria | 4421 |
| 322 | Ga0495616_0031845 | 3300046513 | Bacteria | 2758 |
| 323 | Ga0495616_0034389 | 3300046513 | Bacteria | 2632 |
| 324 | Ga0495616_0042765 | 3300046513 | Bacteria | 2304 |
| 325 | Ga0495620_0000355 | 3300046515 | Bacteria | 31797 |
| 326 | Ga0495620_0001051 | 3300046515 | Bacteria | 16934 |
| 327 | Ga0495620_0003252 | 3300046515 | Bacteria | 9312 |
| 328 | Ga0495620_0006617 | 3300046515 | Bacteria | 6349 |
| 329 | Ga0495620_0008488 | 3300046515 | Bacteria | 5512 |
| 330 | Ga0495620_0021596 | 3300046515 | Bacteria | 3123 |
| 331 | Ga0495631_0000286 | 3300046518 | Bacteria | 35275 |
| 332 | Ga0495631_0000532 | 3300046518 | Bacteria | 25537 |
| 333 | Ga0495631_0001328 | 3300046518 | Bacteria | 15161 |
| 334 | Ga0495631_0003875 | 3300046518 | Bacteria | 8101 |
| 335 | Ga0495631_0014785 | 3300046518 | Bacteria | 3758 |
| 336 | Ga0495631_0038245 | 3300046518 | Bacteria | 2134 |
| 337 | Ga0495632_0000497 | 3300046519 | Bacteria | 37001 |
| 338 | Ga0495632_0001765 | 3300046519 | Bacteria | 17499 |
| 339 | Ga0495632_0014476 | 3300046519 | Bacteria | 4460 |
| 340 | Ga0495632_0015046 | 3300046519 | Bacteria | 4351 |
| 341 | Ga0495632_0019015 | 3300046519 | Bacteria | 3751 |
| 342 | Ga0495632_0020606 | 3300046519 | Bacteria | 3566 |
| 343 | Ga0495632_0020770 | 3300046519 | Bacteria | 3548 |
| 344 | Ga0495632_0024211 | 3300046519 | Bacteria | 3229 |
| 345 | Ga0495632_0024436 | 3300046519 | Bacteria | 3208 |
| 346 | Ga0495632_0026375 | 3300046519 | Bacteria | 3059 |
| 347 | Ga0495632_0058350 | 3300046519 | Bacteria | 1881 |
| 348 | Ga0495632_0064957 | 3300046519 | Bacteria | 1763 |
| 349 | Ga0495632_0083436 | 3300046519 | Bacteria | 1521 |
| 350 | Ga0495637_0000655 | 3300046520 | Bacteria | 24162 |
| 351 | Ga0495637_0001364 | 3300046520 | Bacteria | 14664 |
| 352 | Ga0495637_0002550 | 3300046520 | Bacteria | 10023 |
| 353 | Ga0495637_0003412 | 3300046520 | Bacteria | 8438 |
| 354 | Ga0495637_0014090 | 3300046520 | Bacteria | 3779 |
| 355 | Ga0495637_0030428 | 3300046520 | Bacteria | 2395 |
| 356 | Ga0495637_0045023 | 3300046520 | Bacteria | 1874 |
| 357 | Ga0495637_0063916 | 3300046520 | Bacteria | 1502 |
| 358 | Ga0495637_0201306 | 3300046520 | Bacteria | 731 |
| 359 | Ga0495643_0002882 | 3300046522 | Bacteria | 13041 |
| 360 | Ga0495643_0021217 | 3300046522 | Bacteria | 3730 |
| 361 | Ga0495643_0043048 | 3300046522 | Bacteria | 2458 |
| 362 | Ga0495643_0131278 | 3300046522 | Bacteria | 1257 |
| 363 | Ga0495644_0000278 | 3300046523 | Bacteria | 23512 |
| 364 | Ga0495644_0000335 | 3300046523 | Bacteria | 21541 |
| 365 | Ga0495648_0000215 | 3300046524 | Bacteria | 66028 |
| 366 | Ga0495648_0000735 | 3300046524 | Bacteria | 34912 |
| 367 | Ga0495648_0001320 | 3300046524 | Bacteria | 24586 |
| 368 | Ga0495648_0006966 | 3300046524 | Bacteria | 9117 |
| 369 | Ga0495648_0012221 | 3300046524 | Bacteria | 6417 |
| 370 | Ga0495648_0026658 | 3300046524 | Bacteria | 3886 |
| 371 | Ga0495648_0041652 | 3300046524 | Bacteria | 2897 |
| 372 | Ga0495648_0053914 | 3300046524 | Bacteria | 2432 |
| 373 | Ga0495648_0070908 | 3300046524 | Bacteria | 2022 |
| 374 | Ga0495666_0001177 | 3300046526 | Bacteria | 12580 |
| 375 | Ga0495666_0159970 | 3300046526 | Bacteria | 1044 |
| 376 | Ga0495654_0000412 | 3300046530 | Bacteria | 36467 |
| 377 | Ga0495654_0000786 | 3300046530 | Bacteria | 24451 |
| 378 | Ga0495654_0000951 | 3300046530 | Bacteria | 21452 |
| 379 | Ga0495654_0002256 | 3300046530 | Bacteria | 12476 |
| 380 | Ga0495654_0002723 | 3300046530 | Bacteria | 11158 |
| 381 | Ga0495654_0003741 | 3300046530 | Bacteria | 9214 |
| 382 | Ga0495654_0004154 | 3300046530 | Bacteria | 8688 |
| 383 | Ga0495654_0022278 | 3300046530 | Bacteria | 3291 |
| 384 | Ga0495654_0032070 | 3300046530 | Bacteria | 2664 |
| 385 | Ga0495654_0033459 | 3300046530 | Bacteria | 2601 |
| 386 | Ga0495654_0039929 | 3300046530 | Bacteria | 2340 |
| 387 | Ga0495654_0078461 | 3300046530 | Bacteria | 1552 |
| 388 | Ga0495654_0081115 | 3300046530 | Bacteria | 1521 |
| 389 | Ga0495654_0118955 | 3300046530 | Bacteria | 1197 |
| 390 | Ga0495587_0012305 | 3300046536 | Bacteria | 5393 |
| 391 | Ga0495587_0023022 | 3300046536 | Bacteria | 3830 |
| 392 | Ga0495609_0000505 | 3300046538 | Bacteria | 31398 |
| 393 | Ga0495609_0012433 | 3300046538 | Bacteria | 4038 |
| 394 | Ga0495609_0014930 | 3300046538 | Bacteria | 3643 |
| 395 | Ga0495609_0020787 | 3300046538 | Bacteria | 3029 |
| 396 | Ga0495609_0049260 | 3300046538 | Bacteria | 1880 |
| 397 | Ga0495597_0000659 | 3300046542 | Bacteria | 28075 |
| 398 | Ga0495597_0004542 | 3300046542 | Bacteria | 7594 |
| 399 | Ga0495597_0006301 | 3300046542 | Bacteria | 6146 |
| 400 | Ga0495597_0025178 | 3300046542 | Bacteria | 2740 |
| 401 | Ga0495597_0026390 | 3300046542 | Bacteria | 2668 |
| 402 | Ga0495597_0124827 | 3300046542 | Bacteria | 1070 |
| 403 | Ga0495645_0011416 | 3300046543 | Bacteria | 6250 |
| 404 | Ga0495622_0000739 | 3300046557 | Bacteria | 18390 |
| 405 | Ga0495622_0011990 | 3300046557 | Bacteria | 4008 |
| 406 | Ga0495622_0089187 | 3300046557 | Bacteria | 1417 |
| 407 | Ga0495633_0001604 | 3300046558 | Bacteria | 17147 |
| 408 | Ga0495633_0006087 | 3300046558 | Bacteria | 7228 |
| 409 | Ga0495633_0007049 | 3300046558 | Bacteria | 6544 |
| 410 | Ga0495633_0144587 | 3300046558 | Bacteria | 1099 |
| 411 | Ga0495656_0087346 | 3300046615 | Bacteria | 1420 |
| 412 | Ga0495668_0000891 | 3300046616 | Bacteria | 33605 |
| 413 | Ga0495668_0028975 | 3300046616 | Bacteria | 3129 |
| 414 | Ga0495668_0081667 | 3300046616 | Bacteria | 1773 |
| 415 | Ga0495668_0125832 | 3300046616 | Bacteria | 1403 |
| 416 | Ga0495634_0000750 | 3300046642 | Bacteria | 31392 |
| 417 | Ga0495634_0007094 | 3300046642 | Bacteria | 8450 |
| 418 | Ga0495611_0000255 | 3300046648 | Bacteria | 36899 |
| 419 | Ga0495611_0014616 | 3300046648 | Bacteria | 3356 |
| 420 | Ga0495611_0087104 | 3300046648 | Bacteria | 1441 |
| 421 | Ga0495625_0002197 | 3300046660 | Bacteria | 21607 |
| 422 | Ga0495625_0009697 | 3300046660 | Bacteria | 8019 |
| 423 | Ga0495625_0019920 | 3300046660 | Bacteria | 5190 |
| 424 | Ga0495625_0032472 | 3300046660 | Bacteria | 3869 |
| 425 | Ga0495625_0038779 | 3300046660 | Bacteria | 3484 |
| 426 | Ga0495625_0070957 | 3300046660 | Bacteria | 2445 |
| 427 | Ga0495635_0000942 | 3300046663 | Bacteria | 19194 |
| 428 | Ga0495661_0000363 | 3300046665 | Bacteria | 49099 |
| 429 | Ga0495661_0001713 | 3300046665 | Bacteria | 17741 |
| 430 | Ga0495661_0009466 | 3300046665 | Bacteria | 6687 |
| 431 | Ga0495661_0015380 | 3300046665 | Bacteria | 5107 |
| 432 | Ga0495661_0030675 | 3300046665 | Bacteria | 3420 |
| 433 | Ga0495661_0031300 | 3300046665 | Bacteria | 3379 |
| 434 | Ga0495661_0082255 | 3300046665 | Bacteria | 1854 |
| 435 | Ga0495661_0138151 | 3300046665 | Bacteria | 1328 |
| 436 | Ga0495661_0210817 | 3300046665 | Bacteria | 1011 |
| 437 | Ga0495588_0010988 | 3300046674 | Bacteria | 4236 |
| 438 | Ga0495588_0023567 | 3300046674 | Bacteria | 3049 |
| 439 | Ga0495623_0007457 | 3300046679 | Bacteria | 7102 |
| 440 | Ga0495623_0008514 | 3300046679 | Bacteria | 6662 |
| 441 | Ga0495646_0016256 | 3300046680 | Bacteria | 4723 |
| 442 | Ga0495613_0002793 | 3300046689 | Bacteria | 13111 |
| 443 | Ga0495613_0036504 | 3300046689 | Bacteria | 3644 |
| 444 | Ga0495613_0198749 | 3300046689 | Bacteria | 1414 |
| 445 | Ga0495624_0000185 | 3300046690 | Bacteria | 46826 |
| 446 | Ga0495670_0000410 | 3300046691 | Bacteria | 20521 |
| 447 | Ga0495670_0009802 | 3300046691 | Bacteria | 4708 |
| 448 | Ga0495670_0014410 | 3300046691 | Bacteria | 3886 |
| 449 | Ga0495670_0137577 | 3300046691 | Bacteria | 1276 |
| 450 | Ga0495670_0213317 | 3300046691 | Bacteria | 1024 |
| 451 | Ga0495671_0001703 | 3300046692 | Bacteria | 14350 |
| 452 | Ga0495671_0004276 | 3300046692 | Bacteria | 8580 |
| 453 | Ga0495671_0006964 | 3300046692 | Bacteria | 6484 |
| 454 | Ga0495671_0010655 | 3300046692 | Bacteria | 5085 |
| 455 | Ga0495671_0013376 | 3300046692 | Bacteria | 4447 |
| 456 | Ga0495671_0016278 | 3300046692 | Bacteria | 3973 |
| 457 | Ga0495671_0023634 | 3300046692 | Bacteria | 3210 |
| 458 | Ga0495671_0029795 | 3300046692 | Bacteria | 2799 |
| 459 | Ga0495671_0034411 | 3300046692 | Bacteria | 2575 |
| 460 | Ga0495671_0060970 | 3300046692 | Bacteria | 1861 |
| 461 | Ga0495649_0001334 | 3300046694 | Bacteria | 18764 |
| 462 | Ga0495649_0001421 | 3300046694 | Bacteria | 18097 |
| 463 | Ga0495649_0002090 | 3300046694 | Bacteria | 14348 |
| 464 | Ga0495649_0002896 | 3300046694 | Bacteria | 11884 |
| 465 | Ga0495649_0004480 | 3300046694 | Bacteria | 9118 |
| 466 | Ga0495649_0004685 | 3300046694 | Bacteria | 8880 |
| 467 | Ga0495649_0004975 | 3300046694 | Bacteria | 8552 |
| 468 | Ga0495649_0013193 | 3300046694 | Bacteria | 4772 |
| 469 | Ga0495649_0138953 | 3300046694 | Bacteria | 1279 |
| 470 | Ga0495589_0000425 | 3300046794 | Bacteria | 31317 |
| 471 | Ga0495589_0004022 | 3300046794 | Bacteria | 7878 |
| 472 | Ga0495589_0015647 | 3300046794 | Bacteria | 3900 |
| 473 | Ga0495589_0019091 | 3300046794 | Bacteria | 3517 |
| 474 | Ga0495589_0024165 | 3300046794 | Bacteria | 3089 |
| 475 | Ga0495600_0037531 | 3300046809 | Bacteria | 3150 |
| 476 | Ga0495600_0046433 | 3300046809 | Bacteria | 2833 |
| 477 | Ga0495660_0000504 | 3300046810 | Bacteria | 32167 |
| 478 | Ga0495660_0002181 | 3300046810 | Bacteria | 12603 |
| 479 | Ga0495660_0005835 | 3300046810 | Bacteria | 7345 |
| 480 | Ga0495660_0015245 | 3300046810 | Bacteria | 4441 |
| 481 | Ga0495660_0030600 | 3300046810 | Bacteria | 3031 |
| 482 | Ga0495660_0052370 | 3300046810 | Bacteria | 2217 |
| 483 | Ga0495660_0069640 | 3300046810 | Bacteria | 1869 |
| 484 | Ga0495660_0131674 | 3300046810 | Bacteria | 1254 |
| 485 | Ga0495660_0243870 | 3300046810 | Bacteria | 836 |
| 486 | Ga0495604_0011205 | 3300047317 | Bacteria | 7118 |
| 487 | Ga0495604_0015620 | 3300047317 | Bacteria | 6062 |
| 488 | Ga0495674_0020483 | 3300047319 | Bacteria | 6120 |
| 489 | Ga0495672_0000726 | 3300047320 | Bacteria | 36268 |
| 490 | Ga0495672_0001739 | 3300047320 | Bacteria | 21032 |
| 491 | Ga0495672_0002786 | 3300047320 | Bacteria | 15610 |
| 492 | Ga0495672_0008066 | 3300047320 | Bacteria | 7826 |
| 493 | Ga0495672_0009193 | 3300047320 | Bacteria | 7196 |
| 494 | Ga0495672_0014554 | 3300047320 | Bacteria | 5380 |
| 495 | Ga0495672_0028260 | 3300047320 | Bacteria | 3550 |
| 496 | Ga0495672_0033347 | 3300047320 | Bacteria | 3190 |
| 497 | Ga0495672_0071300 | 3300047320 | Bacteria | 1966 |
| 498 | Ga0495676_0000884 | 3300047321 | Bacteria | 25009 |
| 499 | Ga0495676_0001079 | 3300047321 | Bacteria | 23112 |
| 500 | Ga0495680_0001910 | 3300047322 | Bacteria | 21867 |
| 501 | Ga0495680_0010782 | 3300047322 | Bacteria | 8141 |
| 502 | Ga0495680_0055316 | 3300047322 | Bacteria | 3078 |
| 503 | Ga0495680_0099088 | 3300047322 | Bacteria | 2173 |
| 504 | Ga0495680_0397819 | 3300047322 | Bacteria | 951 |
| 505 | Ga0495683_0000452 | 3300047323 | Bacteria | 32302 |
| 506 | Ga0495683_0001738 | 3300047323 | Bacteria | 13776 |
| 507 | Ga0495683_0002619 | 3300047323 | Bacteria | 10764 |
| 508 | Ga0495683_0016173 | 3300047323 | Bacteria | 3874 |
| 509 | Ga0495683_0027610 | 3300047323 | Bacteria | 2902 |
| 510 | Ga0495675_0137170 | 3300047444 | Bacteria | 1518 |
| 511 | Ga0495677_0202361 | 3300047445 | Bacteria | 772 |
| 512 | Ga0495679_001297 | 3300047446 | Bacteria | 14566 |
| 513 | Ga0495679_001838 | 3300047446 | Bacteria | 11480 |
| 514 | Ga0495679_004171 | 3300047446 | Bacteria | 6748 |
| 515 | Ga0495679_005915 | 3300047446 | Bacteria | 5360 |
| 516 | Ga0495679_011441 | 3300047446 | Bacteria | 3425 |
| 517 | Ga0495673_0000759 | 3300047469 | Bacteria | 30614 |
| 518 | Ga0495673_0000890 | 3300047469 | Bacteria | 27481 |
| 519 | Ga0495673_0001076 | 3300047469 | Bacteria | 23960 |
| 520 | Ga0495673_0002437 | 3300047469 | Bacteria | 13100 |
| 521 | Ga0495673_0009592 | 3300047469 | Bacteria | 5346 |
| 522 | Ga0495673_0026582 | 3300047469 | Bacteria | 2765 |
| 523 | Ga0495673_0038735 | 3300047469 | Bacteria | 2166 |
| 524 | Ga0495673_0072708 | 3300047469 | Bacteria | 1442 |
| 525 | Ga0495681_0000171 | 3300047470 | Bacteria | 54448 |
| 526 | Ga0495681_0000457 | 3300047470 | Bacteria | 31283 |
| 527 | Ga0495681_0000508 | 3300047470 | Bacteria | 29718 |
| 528 | Ga0495681_0000981 | 3300047470 | Bacteria | 21817 |
| 529 | Ga0495681_0005014 | 3300047470 | Bacteria | 8926 |
| 530 | Ga0495681_0008238 | 3300047470 | Bacteria | 6551 |
| 531 | Ga0495681_0008861 | 3300047470 | Bacteria | 6253 |
| 532 | Ga0495681_0012190 | 3300047470 | Bacteria | 5065 |
| 533 | Ga0495681_0016417 | 3300047470 | Bacteria | 4152 |
| 534 | Ga0495681_0027611 | 3300047470 | Bacteria | 2933 |
| 535 | Ga0495684_0002673 | 3300047471 | Bacteria | 14124 |
| 536 | Ga0495686_0002074 | 3300047472 | Bacteria | 19701 |
| 537 | Ga0495686_0011047 | 3300047472 | Bacteria | 6387 |
| 538 | Ga0495686_0030379 | 3300047472 | Bacteria | 3509 |
| 539 | Ga0495686_0080202 | 3300047472 | Bacteria | 1995 |
| 540 | Ga0495593_0003815 | 3300047673 | Bacteria | 9003 |
| 541 | Ga0495593_0006571 | 3300047673 | Bacteria | 6803 |
| 542 | Ga0495593_0011499 | 3300047673 | Bacteria | 5081 |
| 543 | Ga0495593_0024249 | 3300047673 | Bacteria | 3363 |
| 544 | Ga0495602_0000848 | 3300048088 | Bacteria | 29417 |
| 545 | Ga0495614_0074733 | 3300048089 | Bacteria | 1464 |
| 546 | Ga0495626_0000726 | 3300048091 | Bacteria | 30830 |
| 547 | Ga0495626_0001495 | 3300048091 | Bacteria | 18442 |
| 548 | Ga0495626_0006234 | 3300048091 | Bacteria | 6811 |
| 549 | Ga0495626_0010707 | 3300048091 | Bacteria | 4876 |
| 550 | Ga0495626_0010974 | 3300048091 | Bacteria | 4809 |
| 551 | Ga0495626_0011213 | 3300048091 | Bacteria | 4747 |
| 552 | Ga0495626_0015308 | 3300048091 | Bacteria | 3931 |
| 553 | Ga0496101_0518212 | 3300048904 | Bacteria | 942 |
| 554 | Ga0496102_0000419 | 3300048905 | Bacteria | 48952 |
| 555 | Ga0496103_0001964 | 3300048906 | Bacteria | 13296 |
| 556 | Ga0496106_0055543 | 3300048909 | Bacteria | 2993 |
| 557 | Ga0496106_0180064 | 3300048909 | Bacteria | 1678 |
| 558 | Ga0496110_0080720 | 3300048913 | Bacteria | 2899 |
| 559 | Ga0496111_0209034 | 3300048914 | Bacteria | 1450 |
| 560 | Ga0496116_0000338 | 3300048919 | Bacteria | 75100 |
| 561 | Ga0496116_0001012 | 3300048919 | Bacteria | 34285 |
| 562 | Ga0496116_0002599 | 3300048919 | Bacteria | 18786 |
| 563 | Ga0496116_0004365 | 3300048919 | Bacteria | 13523 |
| 564 | Ga0496116_0012636 | 3300048919 | Bacteria | 6877 |
| 565 | Ga0496116_0024608 | 3300048919 | Bacteria | 4447 |
| 566 | Ga0496116_0049883 | 3300048919 | Bacteria | 2794 |
| 567 | Ga0496116_0109461 | 3300048919 | Bacteria | 1628 |
| 568 | Ga0496117_0000712 | 3300048920 | Bacteria | 52613 |
| 569 | Ga0496117_0003653 | 3300048920 | Bacteria | 17695 |
| 570 | Ga0496117_0005368 | 3300048920 | Bacteria | 13500 |
| 571 | Ga0496117_0005706 | 3300048920 | Bacteria | 12956 |
| 572 | Ga0496117_0006175 | 3300048920 | Bacteria | 12236 |
| 573 | Ga0496117_0006888 | 3300048920 | Bacteria | 11278 |
| 574 | Ga0496117_0015564 | 3300048920 | Bacteria | 6475 |
| 575 | Ga0496117_0027875 | 3300048920 | Bacteria | 4386 |
| 576 | Ga0496117_0046700 | 3300048920 | Bacteria | 3113 |
| 577 | Ga0496118_0004004 | 3300048921 | Bacteria | 17933 |
| 578 | Ga0496118_0005607 | 3300048921 | Bacteria | 14179 |
| 579 | Ga0496118_0028792 | 3300048921 | Bacteria | 4670 |
| 580 | Ga0496118_0039993 | 3300048921 | Bacteria | 3733 |
| 581 | Ga0496118_0109646 | 3300048921 | Bacteria | 1836 |
| 582 | Ga0496119_0003010 | 3300048922 | Bacteria | 17854 |
| 583 | Ga0496119_0011059 | 3300048922 | Bacteria | 7521 |
| 584 | Ga0496119_0075535 | 3300048922 | Bacteria | 1958 |
| 585 | Ga0496119_0104940 | 3300048922 | Bacteria | 1579 |
| 586 | Ga0496120_0001345 | 3300048923 | Bacteria | 30280 |
| 587 | Ga0496120_0006476 | 3300048923 | Bacteria | 8983 |
| 588 | Ga0496120_0020080 | 3300048923 | Bacteria | 4257 |
| 589 | Ga0496121_0000713 | 3300048924 | Bacteria | 61654 |
| 590 | Ga0496121_0001802 | 3300048924 | Bacteria | 34607 |
| 591 | Ga0496121_0005084 | 3300048924 | Bacteria | 17154 |
| 592 | Ga0496121_0006906 | 3300048924 | Bacteria | 13851 |
| 593 | Ga0496121_0013221 | 3300048924 | Bacteria | 8894 |
| 594 | Ga0496121_0029593 | 3300048924 | Bacteria | 5058 |
| 595 | Ga0496121_0055549 | 3300048924 | Bacteria | 3298 |
| 596 | Ga0496122_0003076 | 3300048925 | Bacteria | 22461 |
| 597 | Ga0496122_0004317 | 3300048925 | Bacteria | 17801 |
| 598 | Ga0496122_0008121 | 3300048925 | Bacteria | 11434 |
| 599 | Ga0496122_0009196 | 3300048925 | Bacteria | 10464 |
| 600 | Ga0496122_0009627 | 3300048925 | Bacteria | 10121 |
| 601 | Ga0496122_0009764 | 3300048925 | Bacteria | 10024 |
| 602 | Ga0496122_0014063 | 3300048925 | Bacteria | 7768 |
| 603 | Ga0496122_0033721 | 3300048925 | Bacteria | 4204 |
| 604 | Ga0496122_0164034 | 3300048925 | Bacteria | 1350 |
| 605 | Ga0496123_0002303 | 3300048926 | Bacteria | 23972 |
| 606 | Ga0496123_0004296 | 3300048926 | Bacteria | 15141 |
| 607 | Ga0496123_0006317 | 3300048926 | Bacteria | 11517 |
| 608 | Ga0496123_0008403 | 3300048926 | Bacteria | 9488 |
| 609 | Ga0496123_0010737 | 3300048926 | Bacteria | 8047 |
| 610 | Ga0496123_0012181 | 3300048926 | Bacteria | 7360 |
| 611 | Ga0496123_0035016 | 3300048926 | Bacteria | 3586 |
| 612 | Ga0496123_0072847 | 3300048926 | Bacteria | 2134 |
| 613 | Ga0496124_0001071 | 3300048927 | Bacteria | 43253 |
| 614 | Ga0496124_0001277 | 3300048927 | Bacteria | 38265 |
| 615 | Ga0496124_0003709 | 3300048927 | Bacteria | 18440 |
| 616 | Ga0496124_0005979 | 3300048927 | Bacteria | 13435 |
| 617 | Ga0496124_0007771 | 3300048927 | Bacteria | 11328 |
| 618 | Ga0496124_0029997 | 3300048927 | Bacteria | 4835 |
| 619 | Ga0496124_0334065 | 3300048927 | Bacteria | 1079 |
| 620 | Ga0496125_0000948 | 3300048928 | Bacteria | 45536 |
| 621 | Ga0496125_0002443 | 3300048928 | Bacteria | 24133 |
| 622 | Ga0496125_0004226 | 3300048928 | Bacteria | 16728 |
| 623 | Ga0496125_0007586 | 3300048928 | Bacteria | 11522 |
| 624 | Ga0496125_0011572 | 3300048928 | Bacteria | 8814 |
| 625 | Ga0496125_0015480 | 3300048928 | Bacteria | 7372 |
| 626 | Ga0496125_0064739 | 3300048928 | Bacteria | 2902 |
| 627 | Ga0496125_0146537 | 3300048928 | Bacteria | 1630 |
| 628 | Ga0496126_0011442 | 3300048929 | Bacteria | 9183 |
| 629 | Ga0495678_000534 | 3300049459 | Bacteria | 36836 |
| 630 | Ga0495678_001271 | 3300049459 | Bacteria | 20466 |
| 631 | Ga0495678_005619 | 3300049459 | Bacteria | 6860 |
| 632 | Ga0495678_006249 | 3300049459 | Bacteria | 6365 |
| 633 | Ga0495678_006916 | 3300049459 | Bacteria | 5953 |
| 634 | Ga0495678_009530 | 3300049459 | Bacteria | 4797 |
| 635 | Ga0495678_015047 | 3300049459 | Bacteria | 3574 |
| 636 | Ga0495678_015398 | 3300049459 | Bacteria | 3518 |
| 637 | Ga0495678_017139 | 3300049459 | Bacteria | 3290 |
| 638 | Ga0495678_046412 | 3300049459 | Bacteria | 1708 |
| 639 | Ga0495678_085437 | 3300049459 | Bacteria | 1124 |
| 640 | Ga0495682_0001524 | 3300049460 | Bacteria | 12276 |
| 641 | Ga0495682_0002821 | 3300049460 | Bacteria | 8016 |
| 642 | Ga0495682_0007293 | 3300049460 | Bacteria | 4409 |
| 643 | Ga0495682_0007711 | 3300049460 | Bacteria | 4268 |
| 644 | Ga0495682_0053429 | 3300049460 | Bacteria | 1467 |
| 645 | Ga0501240_000795 | 3300049673 | Bacteria | 2804 |
| 646 | Ga0501241_000245 | 3300049758 | Bacteria | 12157 |
| 647 | Ga0501269_002785 | 3300049766 | Bacteria | 2131 |
| 648 | nmdc:mga00v17_14617_c2 | 3300050491 | Bacteria | 2909 |
| 649 | Ga0500572_000413 | 3300053111 | Bacteria | 15022 |
| 650 | Ga0500634_0000868 | 3300053161 | Bacteria | 10758 |
| 651 | 2511292119 | 2511231010 | Bacteria | 6373152 |
| 652 | 2511294789 | 2511231011 | Bacteria | 6149768 |
| 653 | 2511359992 | 2511231021 | Bacteria | 7302637 |
| 654 | 2511367155 | 2511231023 | Bacteria | 6808468 |
| 655 | 2511413821 | 2511231031 | Bacteria | 6558529 |
| 656 | 2555667643 | 2554235341 | Bacteria | 6867980 |
| 657 | 2597867601 | 2597489889 | Bacteria | 6297495 |
| 658 | 2599356862 | 2599185160 | Bacteria | 6844013 |
| 659 | 2599363108 | 2599185161 | Bacteria | 6960462 |
| 660 | 2599369940 | 2599185162 | Bacteria | 6957254 |
| 661 | 2599376217 | 2599185163 | Bacteria | 6995158 |
| 662 | 2599381967 | 2599185164 | Bacteria | 6841688 |
| 663 | 2599387889 | 2599185165 | Bacteria | 6843250 |
| 664 | 2599395585 | 2599185166 | Bacteria | 6959206 |
| 665 | 2599402187 | 2599185167 | Bacteria | 6353609 |
| 666 | 2599407350 | 2599185168 | Bacteria | 6997636 |
| 667 | 2599454605 | 2599185179 | Bacteria | 6611171 |
| 668 | 2599463695 | 2599185181 | Bacteria | 6844519 |
| 669 | 2599468957 | 2599185182 | Bacteria | 6883168 |
| 670 | 2599492714 | 2599185186 | Bacteria | 6831633 |
| 671 | 2599516013 | 2599185190 | Bacteria | 6285678 |
| 672 | 2599521812 | 2599185191 | Bacteria | 6297582 |
| 673 | 2599882870 | 2599185288 | Bacteria | 6666191 |
| 674 | 2599895391 | 2599185290 | Bacteria | 6289611 |
| 675 | 2599950989 | 2599185303 | Bacteria | 6512725 |
| 676 | 2600216324 | 2599185356 | Bacteria | 6843884 |
| 677 | 2601776491 | 2600255313 | Bacteria | 6842543 |
| 678 | 2601798054 | 2600255318 | Bacteria | 6383414 |
| 679 | 2606076463 | 2603880185 | Bacteria | 6379190 |
| 680 | 2606129123 | 2603880199 | Bacteria | 6377649 |
| 681 | 2624478452 | 2623620443 | Bacteria | 6427864 |
| 682 | 2643841211 | 2643221565 | Bacteria | 6216018 |
| 683 | 2643872416 | 2643221571 | Bacteria | 6228673 |
| 684 | 2644190015 | 2643221633 | Bacteria | 6733554 |
| 685 | 2671099749 | 2667528171 | Bacteria | 6900659 |
| 686 | 2677899555 | 2675903420 | Bacteria | 6247433 |
| 687 | 2715753913 | 2713897148 | Bacteria | 5883533 |
| 688 | 2715759571 | 2713897149 | Bacteria | 6506249 |
| 689 | 2718632380 | 2718217725 | Bacteria | 5758958 |
| 690 | 2738807692 | 2738541294 | Bacteria | 6925949 |
| 691 | 2738895052 | 2738541309 | Bacteria | 6926455 |
| 692 | 2739316818 | 2738543025 | Bacteria | 6600348 |
| 693 | 2774134964 | 2773857673 | Bacteria | 6513460 |
| 694 | 2784260814 | 2784132063 | Bacteria | 6262788 |
| 695 | 2809218194 | 2808606445 | Bacteria | 6057339 |
| 696 | 2819657459 | 2818991456 | Bacteria | 6123676 |
| 697 | 2819705435 | 2818991464 | Bacteria | 6907494 |
| 698 | 2834032011 | 2834028612 | Bacteria | 6354979 |
| 699 | 2842834381 | 2842832357 | Bacteria | 5959113 |
| 700 | 2842846141 | 2842843487 | Bacteria | 6004777 |
| 701 | 2852660219 | 2852657418 | Bacteria | 6472974 |
| 702 | 2860345629 | 2860339153 | Bacteria | 6846989 |
| 703 | 2878030387 | 2878029506 | Bacteria | 6418441 |
| 704 | 2880231342 | 2880230671 | Bacteria | 6140320 |
| 705 | 2904519798 | 2904518522 | Bacteria | 6068986 |
| 706 | 2908447238 | 2908446538 | Bacteria | 6829095 |
| 707 | 2917071396 | 2917070673 | Bacteria | 6868303 |
| 708 | 2919065921 | 2919063839 | Bacteria | 6302690 |
| 709 | 2919389549 | 2919385768 | Bacteria | 5897293 |
| 710 | 2919460210 | 2919456309 | Bacteria | 6586567 |
| 711 | 2919488481 | 2919487758 | Bacteria | 5929766 |
| 712 | 2929190496 | 2929189879 | Bacteria | 5930554 |
| 713 | 2931391590 | 2931390751 | Bacteria | 6273349 |
| 714 | 2931399065 | 2931396565 | Bacteria | 7251677 |
| 715 | 2935359222 | 2935353572 | Unclassified | 6955622 |
| 716 | 2945929957 | 2945928738 | Bacteria | 6053221 |
| 717 | 2945967810 | 2945961074 | Bacteria | 7342064 |
| 718 | 2946012290 | 2946006987 | Bacteria | 6705746 |
| 719 | 2946028845 | 2946027586 | Bacteria | 6049274 |
| 720 | 2947235380 | 2947233263 | Bacteria | 6439278 |
| 721 | 2969305183 | 2969304461 | Bacteria | 6601805 |
| 722 | 2974293127 | 2974289157 | Bacteria | 6080362 |
| 723 | 2998140685 | 2998139840 | Bacteria | 6073514 |
| 724 | 3007399836 | 3007395558 | Bacteria | 6755444 |
| 725 | 3007617533 | 3007614139 | Bacteria | 6053559 |
| 726 | 3007620889 | 3007619802 | Bacteria | 6411688 |
| 727 | 3007722144 | 3007718800 | Bacteria | 5971527 |
| 728 | 3007859914 | 3007855910 | Bacteria | 5637581 |
| 729 | 3007864106 | 3007861166 | Bacteria | 6045338 |
| 730 | 637318035 | 637000220 | Bacteria | 7074893 |
| 731 | 8019770514 | 8019769354 | Bacteria | 6924660 |
| 732 | 8030000054 | 8029995093 | Bacteria | 5990776 |
| 733 | 8054286356 | 8054285046 | Bacteria | 6919322 |
| 734 | 8055818608 | 8055817908 | Bacteria | 6609162 |
| 735 | 8056152682 | 8056148874 | Bacteria | 6479865 |
| 736 | 8056161622 | 8056161164 | Bacteria | 6106669 |
| 737 | 8056170361 | 8056166840 | Bacteria | 5820959 |
| 738 | 8056176488 | 8056172158 | Bacteria | 6133900 |
| 739 | 8056182820 | 8056177738 | Bacteria | 6748268 |
| 740 | 8056573521 | 8056569372 | Bacteria | 5997322 |
| 741 | 8057802921 | 8057798959 | Bacteria | 6713499 |
| 742 | Ga0450902_000126 | |||
| 743 | JGI25162J39368_1000195 | |||
| 744 | JGI25163J39215_1000123 | |||
| 745 | JGI25164J39214_1000225 | |||
| 746 | JGI25165J46597_1000291 | |||
| 747 | Ga0055536_1000299 | |||
| 748 | Ga0055536_1002690 | |||
| 749 | Ga0055530_10000340 | |||
| 750 | Ga0055540_1000162 | |||
| 751 | Ga0055531_10000734 | |||
| 752 | Ga0065714_10005355 | |||
| 753 | Ga0065714_10064550 | |||
| 754 | Ga0065714_10095920 | |||
| 755 | Ga0065704_10101121 | |||
| 756 | Ga0065712_10091402 | |||
| 757 | Ga0070670_100001980 | |||
| 758 | Ga0070669_100000487 | |||
| 759 | Ga0070669_100000956 | |||
| 760 | Ga0070662_100000137 | |||
| 761 | Ga0070662_100014133 | |||
| 762 | Ga0068853_100003083 | |||
| 763 | Ga0070665_100044833 | |||
| 764 | Ga0070665_100180913 | |||
| 765 | Ga0070664_100004017 | |||
| 766 | Ga0068854_100052077 | |||
| 767 | Ga0068851_10000004 | |||
| 768 | Ga0075363_100195622 | |||
| 769 | Ga0075364_10023533 | |||
| 770 | Ga0075432_10001534 | |||
| 771 | Ga0079104_1008163 | |||
| 772 | Ga0105251_10000378 | |||
| 773 | Ga0105251_10001590 | |||
| 774 | Ga0105251_10002232 | |||
| 775 | Ga0105251_10002448 | |||
| 776 | Ga0105251_10004027 | |||
| 777 | Ga0105251_10005274 | |||
| 778 | Ga0105251_10011087 | |||
| 779 | Ga0105251_10011613 | |||
| 780 | Ga0105251_10025992 | |||
| 781 | Ga0105251_10195102 | |||
| 782 | Ga0105244_10001726 | |||
| 783 | Ga0105244_10003786 | |||
| 784 | Ga0105244_10012893 | |||
| 785 | Ga0105244_10029320 | |||
| 786 | Ga0105244_10134580 | |||
| 787 | Ga0105250_10001060 | |||
| 788 | Ga0105250_10001756 | |||
| 789 | Ga0105250_10002278 | |||
| 790 | Ga0105250_10015196 | |||
| 791 | Ga0105250_10015343 | |||
| 792 | Ga0105250_10015500 | |||
| 793 | Ga0105243_10000225 | |||
| 794 | Ga0105243_10001399 | |||
| 795 | Ga0105243_10051250 | |||
| 796 | Ga0105248_10013078 | |||
| 797 | Ga0105239_10367155 | |||
| 798 | Ga0105246_10000388 | |||
| 799 | Ga0105246_10001581 | |||
| 800 | Ga0105246_10005439 | |||
| 801 | Ga0157345_1000032 | |||
| 802 | Ga0157373_10000478 | |||
| 803 | Ga0157373_10000520 | |||
| 804 | Ga0157373_10000957 | |||
| 805 | Ga0157373_10001143 | |||
| 806 | Ga0157373_10003846 | |||
| 807 | Ga0157373_10004155 | |||
| 808 | Ga0157373_10041792 | |||
| 809 | Ga0157373_10063759 | |||
| 810 | Ga0157371_10001273 | |||
| 811 | Ga0157371_10002656 | |||
| 812 | Ga0157371_10004342 | |||
| 813 | Ga0157371_10012005 | |||
| 814 | Ga0157370_10056395 | |||
| 815 | Ga0157370_10124707 | |||
| 816 | Ga0157370_10252986 | |||
| 817 | Ga0157370_10297740 | |||
| 818 | Ga0157369_10001544 | |||
| 819 | Ga0157369_10002672 | |||
| 820 | Ga0157369_10009425 | |||
| 821 | Ga0157369_10025492 | |||
| 822 | Ga0157369_10089566 | |||
| 823 | Ga0157369_10093228 | |||
| 824 | Ga0163162_10000902 | |||
| 825 | Ga0163162_10001902 | |||
| 826 | Ga0163162_10027322 | |||
| 827 | Ga0163162_10079639 | |||
| 828 | Ga0163162_10109707 | |||
| 829 | Ga0157372_10001315 | |||
| 830 | Ga0157375_10030722 | |||
| 831 | Ga0157375_10421181 | |||
| 832 | Ga0182008_10000453 | |||
| 833 | Ga0182008_10002063 | |||
| 834 | Ga0182008_10002202 | |||
| 835 | Ga0182008_10003707 | |||
| 836 | Ga0182008_10003797 | |||
| 837 | Ga0182006_1000793 | |||
| 838 | Ga0182006_1001453 | |||
| 839 | Ga0182006_1019703 | |||
| 840 | Ga0182006_1062786 | |||
| 841 | Ga0182006_1089673 | |||
| 842 | Ga0182006_1089847 | |||
| 843 | Ga0182006_1098899 | |||
| 844 | Ga0182007_10000283 | |||
| 845 | Ga0182007_10056599 | |||
| 846 | Ga0182005_1014025 | |||
| 847 | Ga0182005_1053790 | |||
| 848 | Ga0182005_1055009 | |||
| 849 | Ga0163161_10002587 | |||
| 850 | Ga0163161_10002849 | |||
| 851 | Ga0163161_10004085 | |||
| 852 | Ga0163161_10006965 | |||
| 853 | Ga0163161_10010903 | |||
| 854 | Ga0163161_10018631 | |||
| 855 | Ga0163161_10037911 | |||
| 856 | Ga0163161_10234423 | |||
| 857 | Ga0163161_10281818 | |||
| 858 | Ga0163161_10292061 | |||
| 859 | Ga0209760_100031 | |||
| 860 | Ga0209563_101022 | |||
| 861 | Ga0207427_100067 | |||
| 862 | Ga0209437_100016 | |||
| 863 | Ga0209233_1000156 | |||
| 864 | Ga0209675_1008238 | |||
| 865 | Ga0209676_1000025 | |||
| 866 | Ga0209676_1000426 | |||
| 867 | Ga0209050_1000500 | |||
| 868 | Ga0209051_1000089 | |||
| 869 | Ga0209257_1000034 | |||
| 870 | Ga0207656_10000007 | |||
| 871 | Ga0207696_1000085 | |||
| 872 | Ga0207696_1000494 | |||
| 873 | Ga0207696_1002204 | |||
| 874 | Ga0207696_1014255 | |||
| 875 | Ga0207696_1022429 | |||
| 876 | Ga0207655_1000946 | |||
| 877 | Ga0207655_1002034 | |||
| 878 | Ga0207655_1002631 | |||
| 879 | Ga0207655_1013895 | |||
| 880 | Ga0207713_1000323 | |||
| 881 | Ga0207713_1000494 | |||
| 882 | Ga0207713_1000540 | |||
| 883 | Ga0207713_1001743 | |||
| 884 | Ga0207713_1001804 | |||
| 885 | Ga0207713_1002389 | |||
| 886 | Ga0207713_1004120 | |||
| 887 | Ga0207713_1007421 | |||
| 888 | Ga0207713_1057402 | |||
| 889 | Ga0207681_10001305 | |||
| 890 | Ga0207681_10002871 | |||
| 891 | Ga0207650_10000073 | |||
| 892 | Ga0207706_10000178 | |||
| 893 | Ga0207706_10024333 | |||
| 894 | Ga0207709_10000022 | |||
| 895 | Ga0207709_10000634 | |||
| 896 | Ga0207711_10102403 | |||
| 897 | Ga0207679_10031482 | |||
| 898 | Ga0207640_10249701 | |||
| 899 | Ga0207639_10014912 | |||
| 900 | Ga0209281_1006417 | |||
| 901 | Ga0207428_10111887 | |||
| 902 | Ga0268266_10084356 | |||
| 903 | Ga0268266_10223068 | |||
| 904 | Ga0268266_10287500 | |||
| 905 | Ga0307517_10024989 | |||
| 906 | Ga0307515_10373416 | |||
| 907 | Ga0307511_10142496 | |||
| 908 | Ga0316178_1157834 | |||
| 909 | Ga0307509_10025355 | |||
| 910 | Ga0307408_100009264 | |||
| 911 | Ga0307516_10280580 | |||
| 912 | Ga0307405_10000102 | |||
| 913 | Ga0307412_10006331 | |||
| 914 | Ga0307412_10087703 | |||
| 915 | Ga0307414_10317061 | |||
| 916 | Ga0307411_10055804 | |||
| 917 | Ga0307510_10001007 | |||
| 918 | Ga0439438_000202 | |||
| 919 | Ga0439438_000461 | |||
| 920 | Ga0439447_001229 | |||
| 921 | Ga0439445_0002057 | |||
| 922 | Ga0439432_002878 | |||
| 923 | Ga0439432_003172 | |||
| 924 | Ga0439451_000325 | |||
| 925 | Ga0439451_000367 | |||
| 926 | Ga0439451_000406 | |||
| 927 | Ga0439451_003273 | |||
| 928 | Ga0439451_026996 | |||
| 929 | Ga0439452_000251 | |||
| 930 | Ga0439452_000279 | |||
| 931 | Ga0439452_005026 | |||
| 932 | Ga0439452_025736 | |||
| 933 | Ga0439456_003808 | |||
| 934 | Ga0439463_013773 | |||
| 935 | Ga0450911_000222 | |||
| 936 | Ga0450923_065373 | |||
| 937 | Ga0450892_007631 | |||
| 938 | Ga0450894_004725 | |||
| 939 | Ga0450896_007777 | |||
| 940 | Ga0450898_000500 | |||
| 941 | Ga0450899_003279 | |||
| 942 | Ga0450903_000290 | |||
| 943 | Ga0450903_001109 | |||
| 944 | Ga0450904_000401 | |||
| 945 | Ga0450905_000016 | |||
| 946 | Ga0450906_000142 | |||
| 947 | Ga0450908_015984 | |||
| 948 | Ga0450918_004664 | |||
| 949 | Ga0450893_0001166 | |||
| 950 | Ga0450893_0012758 | |||
| 951 | Ga0495617_003955 | |||
| 952 | Ga0495617_008190 | |||
| 953 | Ga0495617_008301 | |||
| 954 | Ga0495617_008758 | |||
| 955 | Ga0495617_009272 | |||
| 956 | Ga0495617_012325 | |||
| 957 | Ga0495617_013075 | |||
| 958 | Ga0495617_013134 | |||
| 959 | Ga0495617_024895 | |||
| 960 | Ga0495617_055170 | |||
| 961 | Ga0495627_000147 | |||
| 962 | Ga0495627_000549 | |||
| 963 | Ga0495627_000859 | |||
| 964 | Ga0495627_001809 | |||
| 965 | Ga0495627_006732 | |||
| 966 | Ga0495627_009104 | |||
| 967 | Ga0495627_026082 | |||
| 968 | Ga0495627_058420 | |||
| 969 | Ga0495627_116131 | |||
| 970 | Ga0495592_0014254 | |||
| 971 | Ga0495590_0001031 | |||
| 972 | Ga0495590_0001766 | |||
| 973 | Ga0495590_0010833 | |||
| 974 | Ga0495590_0012641 | |||
| 975 | Ga0495591_000620 | |||
| 976 | Ga0495591_000927 | |||
| 977 | Ga0495591_000952 | |||
| 978 | Ga0495591_004093 | |||
| 979 | Ga0495591_004366 | |||
| 980 | Ga0495591_005039 | |||
| 981 | Ga0495591_010535 | |||
| 982 | Ga0495591_010610 | |||
| 983 | Ga0495591_016064 | |||
| 984 | Ga0495638_0000542 | |||
| 985 | Ga0495638_0000910 | |||
| 986 | Ga0495638_0002355 | |||
| 987 | Ga0495638_0003401 | |||
| 988 | Ga0495638_0004095 | |||
| 989 | Ga0495638_0011875 | |||
| 990 | Ga0495638_0023083 | |||
| 991 | Ga0495638_0035370 | |||
| 992 | Ga0495638_0057641 | |||
| 993 | Ga0495653_0001932 | |||
| 994 | Ga0495653_0112087 | |||
| 995 | Ga0495653_0156194 | |||
| 996 | Ga0495650_0001112 | |||
| 997 | Ga0495650_0003482 | |||
| 998 | Ga0495650_0007130 | |||
| 999 | Ga0495650_0021904 | |||
| 1000 | Ga0495650_0032901 | |||
| 1001 | Ga0495605_0003210 | |||
| 1002 | Ga0495605_0008531 | |||
| 1003 | Ga0495605_0009602 | |||
| 1004 | Ga0495605_0012283 | |||
| 1005 | Ga0495605_0013957 | |||
| 1006 | Ga0495605_0014740 | |||
| 1007 | Ga0495605_0014927 | |||
| 1008 | Ga0495584_0001647 | |||
| 1009 | Ga0495584_0006548 | |||
| 1010 | Ga0495584_0013026 | |||
| 1011 | Ga0495584_0051294 | |||
| 1012 | Ga0495584_0077911 | |||
| 1013 | Ga0495584_0098344 | |||
| 1014 | Ga0495585_0000748 | |||
| 1015 | Ga0495585_0001333 | |||
| 1016 | Ga0495585_0001365 | |||
| 1017 | Ga0495585_0002530 | |||
| 1018 | Ga0495585_0002556 | |||
| 1019 | Ga0495585_0013168 | |||
| 1020 | Ga0495585_0015297 | |||
| 1021 | Ga0495585_0016751 | |||
| 1022 | Ga0495596_0002694 | |||
| 1023 | Ga0495607_0000550 | |||
| 1024 | Ga0495607_0003006 | |||
| 1025 | Ga0495607_0004334 | |||
| 1026 | Ga0495607_0004810 | |||
| 1027 | Ga0495607_0014080 | |||
| 1028 | Ga0495607_0015682 | |||
| 1029 | Ga0495607_0017469 | |||
| 1030 | Ga0495607_0023361 | |||
| 1031 | Ga0495607_0030624 | |||
| 1032 | Ga0495607_0032769 | |||
| 1033 | Ga0495607_0035585 | |||
| 1034 | Ga0495607_0097371 | |||
| 1035 | Ga0495583_0001460 | |||
| 1036 | Ga0495583_0002079 | |||
| 1037 | Ga0495606_0001304 | |||
| 1038 | Ga0495606_0001668 | |||
| 1039 | Ga0495606_0002205 | |||
| 1040 | Ga0495606_0003653 | |||
| 1041 | Ga0495606_0006071 | |||
| 1042 | Ga0495606_0006248 | |||
| 1043 | Ga0495606_0011154 | |||
| 1044 | Ga0495606_0027041 | |||
| 1045 | Ga0495606_0041587 | |||
| 1046 | Ga0495606_0081022 | |||
| 1047 | Ga0495610_0001179 | |||
| 1048 | Ga0495610_0001556 | |||
| 1049 | Ga0495610_0001951 | |||
| 1050 | Ga0495610_0005126 | |||
| 1051 | Ga0495610_0008970 | |||
| 1052 | Ga0495610_0009308 | |||
| 1053 | Ga0495610_0009680 | |||
| 1054 | Ga0495610_0010659 | |||
| 1055 | Ga0495610_0018408 | |||
| 1056 | Ga0495610_0041445 | |||
| 1057 | Ga0495616_0000505 | |||
| 1058 | Ga0495616_0000511 | |||
| 1059 | Ga0495616_0000706 | |||
| 1060 | Ga0495616_0001350 | |||
| 1061 | Ga0495616_0009378 | |||
| 1062 | Ga0495616_0014433 | |||
| 1063 | Ga0495616_0031845 | |||
| 1064 | Ga0495616_0034389 | |||
| 1065 | Ga0495616_0042765 | |||
| 1066 | Ga0495620_0000355 | |||
| 1067 | Ga0495620_0001051 | |||
| 1068 | Ga0495620_0003252 | |||
| 1069 | Ga0495620_0006617 | |||
| 1070 | Ga0495620_0008488 | |||
| 1071 | Ga0495620_0021596 | |||
| 1072 | Ga0495631_0000286 | |||
| 1073 | Ga0495631_0000532 | |||
| 1074 | Ga0495631_0001328 | |||
| 1075 | Ga0495631_0003875 | |||
| 1076 | Ga0495631_0014785 | |||
| 1077 | Ga0495631_0038245 | |||
| 1078 | Ga0495632_0000497 | |||
| 1079 | Ga0495632_0001765 | |||
| 1080 | Ga0495632_0014476 | |||
| 1081 | Ga0495632_0015046 | |||
| 1082 | Ga0495632_0019015 | |||
| 1083 | Ga0495632_0020606 | |||
| 1084 | Ga0495632_0020770 | |||
| 1085 | Ga0495632_0024211 | |||
| 1086 | Ga0495632_0024436 | |||
| 1087 | Ga0495632_0026375 | |||
| 1088 | Ga0495632_0058350 | |||
| 1089 | Ga0495632_0064957 | |||
| 1090 | Ga0495632_0083436 | |||
| 1091 | Ga0495637_0000655 | |||
| 1092 | Ga0495637_0001364 | |||
| 1093 | Ga0495637_0002550 | |||
| 1094 | Ga0495637_0003412 | |||
| 1095 | Ga0495637_0014090 | |||
| 1096 | Ga0495637_0030428 | |||
| 1097 | Ga0495637_0045023 | |||
| 1098 | Ga0495637_0063916 | |||
| 1099 | Ga0495637_0201306 | |||
| 1100 | Ga0495643_0002882 | |||
| 1101 | Ga0495643_0021217 | |||
| 1102 | Ga0495643_0043048 | |||
| 1103 | Ga0495643_0131278 | |||
| 1104 | Ga0495644_0000278 | |||
| 1105 | Ga0495644_0000335 | |||
| 1106 | Ga0495648_0000215 | |||
| 1107 | Ga0495648_0000735 | |||
| 1108 | Ga0495648_0001320 | |||
| 1109 | Ga0495648_0006966 | |||
| 1110 | Ga0495648_0012221 | |||
| 1111 | Ga0495648_0026658 | |||
| 1112 | Ga0495648_0041652 | |||
| 1113 | Ga0495648_0053914 | |||
| 1114 | Ga0495648_0070908 | |||
| 1115 | Ga0495666_0001177 | |||
| 1116 | Ga0495666_0159970 | |||
| 1117 | Ga0495654_0000412 | |||
| 1118 | Ga0495654_0000786 | |||
| 1119 | Ga0495654_0000951 | |||
| 1120 | Ga0495654_0002256 | |||
| 1121 | Ga0495654_0002723 | |||
| 1122 | Ga0495654_0003741 | |||
| 1123 | Ga0495654_0004154 | |||
| 1124 | Ga0495654_0022278 | |||
| 1125 | Ga0495654_0032070 | |||
| 1126 | Ga0495654_0033459 | |||
| 1127 | Ga0495654_0039929 | |||
| 1128 | Ga0495654_0078461 | |||
| 1129 | Ga0495654_0081115 | |||
| 1130 | Ga0495654_0118955 | |||
| 1131 | Ga0495587_0012305 | |||
| 1132 | Ga0495587_0023022 | |||
| 1133 | Ga0495609_0000505 | |||
| 1134 | Ga0495609_0012433 | |||
| 1135 | Ga0495609_0014930 | |||
| 1136 | Ga0495609_0020787 | |||
| 1137 | Ga0495609_0049260 | |||
| 1138 | Ga0495597_0000659 | |||
| 1139 | Ga0495597_0004542 | |||
| 1140 | Ga0495597_0006301 | |||
| 1141 | Ga0495597_0025178 | |||
| 1142 | Ga0495597_0026390 | |||
| 1143 | Ga0495597_0124827 | |||
| 1144 | Ga0495645_0011416 | |||
| 1145 | Ga0495622_0000739 | |||
| 1146 | Ga0495622_0011990 | |||
| 1147 | Ga0495622_0089187 | |||
| 1148 | Ga0495633_0001604 | |||
| 1149 | Ga0495633_0006087 | |||
| 1150 | Ga0495633_0007049 | |||
| 1151 | Ga0495633_0144587 | |||
| 1152 | Ga0495656_0087346 | |||
| 1153 | Ga0495668_0000891 | |||
| 1154 | Ga0495668_0028975 | |||
| 1155 | Ga0495668_0081667 | |||
| 1156 | Ga0495668_0125832 | |||
| 1157 | Ga0495634_0000750 | |||
| 1158 | Ga0495634_0007094 | |||
| 1159 | Ga0495611_0000255 | |||
| 1160 | Ga0495611_0014616 | |||
| 1161 | Ga0495611_0087104 | |||
| 1162 | Ga0495625_0002197 | |||
| 1163 | Ga0495625_0009697 | |||
| 1164 | Ga0495625_0019920 | |||
| 1165 | Ga0495625_0032472 | |||
| 1166 | Ga0495625_0038779 | |||
| 1167 | Ga0495625_0070957 | |||
| 1168 | Ga0495635_0000942 | |||
| 1169 | Ga0495661_0000363 | |||
| 1170 | Ga0495661_0001713 | |||
| 1171 | Ga0495661_0009466 | |||
| 1172 | Ga0495661_0015380 | |||
| 1173 | Ga0495661_0030675 | |||
| 1174 | Ga0495661_0031300 | |||
| 1175 | Ga0495661_0082255 | |||
| 1176 | Ga0495661_0138151 | |||
| 1177 | Ga0495661_0210817 | |||
| 1178 | Ga0495588_0010988 | |||
| 1179 | Ga0495588_0023567 | |||
| 1180 | Ga0495623_0007457 | |||
| 1181 | Ga0495623_0008514 | |||
| 1182 | Ga0495646_0016256 | |||
| 1183 | Ga0495613_0002793 | |||
| 1184 | Ga0495613_0036504 | |||
| 1185 | Ga0495613_0198749 | |||
| 1186 | Ga0495624_0000185 | |||
| 1187 | Ga0495670_0000410 | |||
| 1188 | Ga0495670_0009802 | |||
| 1189 | Ga0495670_0014410 | |||
| 1190 | Ga0495670_0137577 | |||
| 1191 | Ga0495670_0213317 | |||
| 1192 | Ga0495671_0001703 | |||
| 1193 | Ga0495671_0004276 | |||
| 1194 | Ga0495671_0006964 | |||
| 1195 | Ga0495671_0010655 | |||
| 1196 | Ga0495671_0013376 | |||
| 1197 | Ga0495671_0016278 | |||
| 1198 | Ga0495671_0023634 | |||
| 1199 | Ga0495671_0029795 | |||
| 1200 | Ga0495671_0034411 | |||
| 1201 | Ga0495671_0060970 | |||
| 1202 | Ga0495649_0001334 | |||
| 1203 | Ga0495649_0001421 | |||
| 1204 | Ga0495649_0002090 | |||
| 1205 | Ga0495649_0002896 | |||
| 1206 | Ga0495649_0004480 | |||
| 1207 | Ga0495649_0004685 | |||
| 1208 | Ga0495649_0004975 | |||
| 1209 | Ga0495649_0013193 | |||
| 1210 | Ga0495649_0138953 | |||
| 1211 | Ga0495589_0000425 | |||
| 1212 | Ga0495589_0004022 | |||
| 1213 | Ga0495589_0015647 | |||
| 1214 | Ga0495589_0019091 | |||
| 1215 | Ga0495589_0024165 | |||
| 1216 | Ga0495600_0037531 | |||
| 1217 | Ga0495600_0046433 | |||
| 1218 | Ga0495660_0000504 | |||
| 1219 | Ga0495660_0002181 | |||
| 1220 | Ga0495660_0005835 | |||
| 1221 | Ga0495660_0015245 | |||
| 1222 | Ga0495660_0030600 | |||
| 1223 | Ga0495660_0052370 | |||
| 1224 | Ga0495660_0069640 | |||
| 1225 | Ga0495660_0131674 | |||
| 1226 | Ga0495660_0243870 | |||
| 1227 | Ga0495604_0011205 | |||
| 1228 | Ga0495604_0015620 | |||
| 1229 | Ga0495674_0020483 | |||
| 1230 | Ga0495672_0000726 | |||
| 1231 | Ga0495672_0001739 | |||
| 1232 | Ga0495672_0002786 | |||
| 1233 | Ga0495672_0008066 | |||
| 1234 | Ga0495672_0009193 | |||
| 1235 | Ga0495672_0014554 | |||
| 1236 | Ga0495672_0028260 | |||
| 1237 | Ga0495672_0033347 | |||
| 1238 | Ga0495672_0071300 | |||
| 1239 | Ga0495676_0000884 | |||
| 1240 | Ga0495676_0001079 | |||
| 1241 | Ga0495680_0001910 | |||
| 1242 | Ga0495680_0010782 | |||
| 1243 | Ga0495680_0055316 | |||
| 1244 | Ga0495680_0099088 | |||
| 1245 | Ga0495680_0397819 | |||
| 1246 | Ga0495683_0000452 | |||
| 1247 | Ga0495683_0001738 | |||
| 1248 | Ga0495683_0002619 | |||
| 1249 | Ga0495683_0016173 | |||
| 1250 | Ga0495683_0027610 | |||
| 1251 | Ga0495675_0137170 | |||
| 1252 | Ga0495677_0202361 | |||
| 1253 | Ga0495679_001297 | |||
| 1254 | Ga0495679_001838 | |||
| 1255 | Ga0495679_004171 | |||
| 1256 | Ga0495679_005915 | |||
| 1257 | Ga0495679_011441 | |||
| 1258 | Ga0495673_0000759 | |||
| 1259 | Ga0495673_0000890 | |||
| 1260 | Ga0495673_0001076 | |||
| 1261 | Ga0495673_0002437 | |||
| 1262 | Ga0495673_0009592 | |||
| 1263 | Ga0495673_0026582 | |||
| 1264 | Ga0495673_0038735 | |||
| 1265 | Ga0495673_0072708 | |||
| 1266 | Ga0495681_0000171 | |||
| 1267 | Ga0495681_0000457 | |||
| 1268 | Ga0495681_0000508 | |||
| 1269 | Ga0495681_0000981 | |||
| 1270 | Ga0495681_0005014 | |||
| 1271 | Ga0495681_0008238 | |||
| 1272 | Ga0495681_0008861 | |||
| 1273 | Ga0495681_0012190 | |||
| 1274 | Ga0495681_0016417 | |||
| 1275 | Ga0495681_0027611 | |||
| 1276 | Ga0495684_0002673 | |||
| 1277 | Ga0495686_0002074 | |||
| 1278 | Ga0495686_0011047 | |||
| 1279 | Ga0495686_0030379 | |||
| 1280 | Ga0495686_0080202 | |||
| 1281 | Ga0495593_0003815 | |||
| 1282 | Ga0495593_0006571 | |||
| 1283 | Ga0495593_0011499 | |||
| 1284 | Ga0495593_0024249 | |||
| 1285 | Ga0495602_0000848 | |||
| 1286 | Ga0495614_0074733 | |||
| 1287 | Ga0495626_0000726 | |||
| 1288 | Ga0495626_0001495 | |||
| 1289 | Ga0495626_0006234 | |||
| 1290 | Ga0495626_0010707 | |||
| 1291 | Ga0495626_0010974 | |||
| 1292 | Ga0495626_0011213 | |||
| 1293 | Ga0495626_0015308 | |||
| 1294 | Ga0496101_0518212 | |||
| 1295 | Ga0496102_0000419 | |||
| 1296 | Ga0496103_0001964 | |||
| 1297 | Ga0496106_0055543 | |||
| 1298 | Ga0496106_0180064 | |||
| 1299 | Ga0496110_0080720 | |||
| 1300 | Ga0496111_0209034 | |||
| 1301 | Ga0496116_0000338 | |||
| 1302 | Ga0496116_0001012 | |||
| 1303 | Ga0496116_0002599 | |||
| 1304 | Ga0496116_0004365 | |||
| 1305 | Ga0496116_0012636 | |||
| 1306 | Ga0496116_0024608 | |||
| 1307 | Ga0496116_0049883 | |||
| 1308 | Ga0496116_0109461 | |||
| 1309 | Ga0496117_0000712 | |||
| 1310 | Ga0496117_0003653 | |||
| 1311 | Ga0496117_0005368 | |||
| 1312 | Ga0496117_0005706 | |||
| 1313 | Ga0496117_0006175 | |||
| 1314 | Ga0496117_0006888 | |||
| 1315 | Ga0496117_0015564 | |||
| 1316 | Ga0496117_0027875 | |||
| 1317 | Ga0496117_0046700 | |||
| 1318 | Ga0496118_0004004 | |||
| 1319 | Ga0496118_0005607 | |||
| 1320 | Ga0496118_0028792 | |||
| 1321 | Ga0496118_0039993 | |||
| 1322 | Ga0496118_0109646 | |||
| 1323 | Ga0496119_0003010 | |||
| 1324 | Ga0496119_0011059 | |||
| 1325 | Ga0496119_0075535 | |||
| 1326 | Ga0496119_0104940 | |||
| 1327 | Ga0496120_0001345 | |||
| 1328 | Ga0496120_0006476 | |||
| 1329 | Ga0496120_0020080 | |||
| 1330 | Ga0496121_0000713 | |||
| 1331 | Ga0496121_0001802 | |||
| 1332 | Ga0496121_0005084 | |||
| 1333 | Ga0496121_0006906 | |||
| 1334 | Ga0496121_0013221 | |||
| 1335 | Ga0496121_0029593 | |||
| 1336 | Ga0496121_0055549 | |||
| 1337 | Ga0496122_0003076 | |||
| 1338 | Ga0496122_0004317 | |||
| 1339 | Ga0496122_0008121 | |||
| 1340 | Ga0496122_0009196 | |||
| 1341 | Ga0496122_0009627 | |||
| 1342 | Ga0496122_0009764 | |||
| 1343 | Ga0496122_0014063 | |||
| 1344 | Ga0496122_0033721 | |||
| 1345 | Ga0496122_0164034 | |||
| 1346 | Ga0496123_0002303 | |||
| 1347 | Ga0496123_0004296 | |||
| 1348 | Ga0496123_0006317 | |||
| 1349 | Ga0496123_0008403 | |||
| 1350 | Ga0496123_0010737 | |||
| 1351 | Ga0496123_0012181 | |||
| 1352 | Ga0496123_0035016 | |||
| 1353 | Ga0496123_0072847 | |||
| 1354 | Ga0496124_0001071 | |||
| 1355 | Ga0496124_0001277 | |||
| 1356 | Ga0496124_0003709 | |||
| 1357 | Ga0496124_0005979 | |||
| 1358 | Ga0496124_0007771 | |||
| 1359 | Ga0496124_0029997 | |||
| 1360 | Ga0496124_0334065 | |||
| 1361 | Ga0496125_0000948 | |||
| 1362 | Ga0496125_0002443 | |||
| 1363 | Ga0496125_0004226 | |||
| 1364 | Ga0496125_0007586 | |||
| 1365 | Ga0496125_0011572 | |||
| 1366 | Ga0496125_0015480 | |||
| 1367 | Ga0496125_0064739 | |||
| 1368 | Ga0496125_0146537 | |||
| 1369 | Ga0496126_0011442 | |||
| 1370 | Ga0495678_000534 | |||
| 1371 | Ga0495678_001271 | |||
| 1372 | Ga0495678_005619 | |||
| 1373 | Ga0495678_006249 | |||
| 1374 | Ga0495678_006916 | |||
| 1375 | Ga0495678_009530 | |||
| 1376 | Ga0495678_015047 | |||
| 1377 | Ga0495678_015398 | |||
| 1378 | Ga0495678_017139 | |||
| 1379 | Ga0495678_046412 | |||
| 1380 | Ga0495678_085437 | |||
| 1381 | Ga0495682_0001524 | |||
| 1382 | Ga0495682_0002821 | |||
| 1383 | Ga0495682_0007293 | |||
| 1384 | Ga0495682_0007711 | |||
| 1385 | Ga0495682_0053429 | |||
| 1386 | Ga0501240_000795 | |||
| 1387 | Ga0501241_000245 | |||
| 1388 | Ga0501269_002785 | |||
| 1389 | nmdc:mga00v17_14617_c2 | |||
| 1390 | Ga0500572_000413 | |||
| 1391 | Ga0500634_0000868 | |||
| 1392 | 2511292119 | |||
| 1393 | 2511294789 | |||
| 1394 | 2511359992 | |||
| 1395 | 2511367155 | |||
| 1396 | 2511413821 | |||
| 1397 | 2555667643 | |||
| 1398 | 2597867601 | |||
| 1399 | 2599356862 | |||
| 1400 | 2599363108 | |||
| 1401 | 2599369940 | |||
| 1402 | 2599376217 | |||
| 1403 | 2599381967 | |||
| 1404 | 2599387889 | |||
| 1405 | 2599395585 | |||
| 1406 | 2599402187 | |||
| 1407 | 2599407350 | |||
| 1408 | 2599454605 | |||
| 1409 | 2599463695 | |||
| 1410 | 2599468957 | |||
| 1411 | 2599492714 | |||
| 1412 | 2599516013 | |||
| 1413 | 2599521812 | |||
| 1414 | 2599882870 | |||
| 1415 | 2599895391 | |||
| 1416 | 2599950989 | |||
| 1417 | 2600216324 | |||
| 1418 | 2601776491 | |||
| 1419 | 2601798054 | |||
| 1420 | 2606076463 | |||
| 1421 | 2606129123 | |||
| 1422 | 2624478452 | |||
| 1423 | 2643841211 | |||
| 1424 | 2643872416 | |||
| 1425 | 2644190015 | |||
| 1426 | 2671099749 | |||
| 1427 | 2677899555 | |||
| 1428 | 2715753913 | |||
| 1429 | 2715759571 | |||
| 1430 | 2718632380 | |||
| 1431 | 2738807692 | |||
| 1432 | 2738895052 | |||
| 1433 | 2739316818 | |||
| 1434 | 2774134964 | |||
| 1435 | 2784260814 | |||
| 1436 | 2809218194 | |||
| 1437 | 2819657459 | |||
| 1438 | 2819705435 | |||
| 1439 | 2834032011 | |||
| 1440 | 2842834381 | |||
| 1441 | 2842846141 | |||
| 1442 | 2852660219 | |||
| 1443 | 2860345629 | |||
| 1444 | 2878030387 | |||
| 1445 | 2880231342 | |||
| 1446 | 2904519798 | |||
| 1447 | 2908447238 | |||
| 1448 | 2917071396 | |||
| 1449 | 2919065921 | |||
| 1450 | 2919389549 | |||
| 1451 | 2919460210 | |||
| 1452 | 2919488481 | |||
| 1453 | 2929190496 | |||
| 1454 | 2931391590 | |||
| 1455 | 2931399065 | |||
| 1456 | 2935359222 | |||
| 1457 | 2945929957 | |||
| 1458 | 2945967810 | |||
| 1459 | 2946012290 | |||
| 1460 | 2946028845 | |||
| 1461 | 2947235380 | |||
| 1462 | 2969305183 | |||
| 1463 | 2974293127 | |||
| 1464 | 2998140685 | |||
| 1465 | 3007399836 | |||
| 1466 | 3007617533 | |||
| 1467 | 3007620889 | |||
| 1468 | 3007722144 | |||
| 1469 | 3007859914 | |||
| 1470 | 3007864106 | |||
| 1471 | 637318035 | |||
| 1472 | 8019770514 | |||
| 1473 | 8030000054 | |||
| 1474 | 8054286356 | |||
| 1475 | 8055818608 | |||
| 1476 | 8056152682 | |||
| 1477 | 8056161622 | |||
| 1478 | 8056170361 | |||
| 1479 | 8056176488 | |||
| 1480 | 8056182820 | |||
| 1481 | 8056573521 | |||
| 1482 | 8057802921 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7msn-assembly1.cif.gz_B | suns glycosin s-glycosyltransferase | 0.8593 | 102 | 181 |
| 7msp-assembly2.cif.gz_B | suns glycosin s-glycosyltransferase | 0.7868 | 102 | 191 |
| 7msn-assembly1.cif.gz_A | suns glycosin s-glycosyltransferase | 0.7642 | 102 | 198 |
| 4cgq-assembly1.cif.gz_A | full length tah1 bound to hsp90 peptide srmeevd | 0.7561 | 120 | 197 |
| 4uzy-assembly1.cif.gz_A | crystal structure of the chlamydomonas ift70 and ift52 complex | 0.7521 | 103 | 197 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8N394_759_830_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9649 | 103 | 169 | 1.25.40.10 |
| af_Q8IUR5_529_612_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9581 | 103 | 181 | 1.25.40.10 |
| af_Q4DCN5_349_413_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9503 | 103 | 164 | 1.25.40.10 |
| af_M0RBH7_295_374_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9482 | 102 | 169 | 1.25.40.10 |
| af_Q67YJ9_465_551_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9446 | 107 | 181 | 1.25.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0P9VN55-F1-model_v4 | Uncharacterized protein | 0.8509 | 113 | 215 |
|
| AF-A0A0P9VN55-F1-model_v4 | Uncharacterized protein | 0.8196 | 113 | 215 |
|
| AF-A0A3M3ZFS6-F1-model_v4 | Uncharacterized protein | 0.7929 | 101 | 220 |
|
| AF-A0A0P9P984-F1-model_v4 | Lipoprotein | 0.7844 | 10 | 114 |
|
| AF-A0A7S0MD92-F1-model_v4 | Uncharacterized protein | 0.7552 | 102 | 212 |
GO:0051087
|