F478409

General Info

Members Datasets Scaffolds Average Seq Length
738 310 738 431

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0184752|Ga0496115_0184752_35_1294
Length 419
Sequence VVAGVRTPFARSGTTLKSLSAIELGKRCVAELIQRSDIDPALVEAVVYGTVVPSVVAPNIAREVSLMPMLPKGVQAFTVGRACASANQAITDAADQIVLGHMDVAIAGGAESLSNVPILHSRGMSDALVAASRAKSFGGRVRALAAVRPRDLVPITPAIAEPTTGESMGESAEKMAKINHIPRDEQDQFALRSHRLAAAGTADGRLTAEIAALYVPPSFDAMTTDNGIRTETSLEALAALKPVFDRKYGTVTAGNSSPLTDGASAVLLMSEERAKTLGYKPMAYIRSYSYAALDPGEQLLMGPVLAAPVALQRAGLTLEQMDLVEMHEAFAAQVLCNLEGFVSQQWAERAGFPKPVGEVDRAKLNVMGGSIAIGHPFGATGGRILTTLCNELVRRDGTFGLMTVCAAGGMGHAMVVERA

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
193 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
196 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
197 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
198 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
199 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
200 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
201 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
202 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
203 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
208 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
209 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
210 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
212 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
213 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
214 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
215 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
216 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
217 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
218 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
219 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
220 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
221 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
222 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
223 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
224 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
225 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
227 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
228 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
229 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
230 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
231 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
232 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
233 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
234 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
235 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
236 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
237 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
238 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
239 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
240 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
241 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
242 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
243 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
244 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
245 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
248 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
249 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
250 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
251 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
252 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
253 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
254 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
255 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
256 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
257 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
258 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
259 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
260 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
261 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
262 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
263 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
264 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
265 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
266 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
267 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
268 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
269 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
270 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
271 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
272 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
273 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
274 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
275 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
276 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
277 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
278 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
279 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
280 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
281 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
282 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
283 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
284 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
285 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
286 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
292 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
293 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
294 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
296 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
297 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
298 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
299 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
300 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
301 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
302 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
303 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
304 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
305 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
306 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
307 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
308 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
309 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
310 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 1.49
Rhizosphere 98.24
Stem 0
Stem Tuber 0
Unclassified 0.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10106929 3300005290 Bacteria 1906
2 Ga0065715_10092087 3300005293 Bacteria 5343
3 Ga0070658_10000166 3300005327 Bacteria 57497
4 Ga0070658_10036906 3300005327 Bacteria 3938
5 Ga0070658_10060322 3300005327 Bacteria 3089
6 Ga0070676_10002851 3300005328 Bacteria 8926
7 Ga0070676_10013679 3300005328 Bacteria 4447
8 Ga0070676_10136888 3300005328 Bacteria 1555
9 Ga0070683_100000840 3300005329 Bacteria 22798
10 Ga0070683_100001190 3300005329 Bacteria 19778
11 Ga0070683_100003494 3300005329 Bacteria 12776
12 Ga0070683_100011375 3300005329 Bacteria 7690
13 Ga0070683_100018412 3300005329 Bacteria 6186
14 Ga0070683_100020819 3300005329 Bacteria 5843
15 Ga0070683_100024804 3300005329 Bacteria 5377
16 Ga0070683_100029862 3300005329 Bacteria 4942
17 Ga0070683_100030599 3300005329 Bacteria 4889
18 Ga0070683_100040966 3300005329 Bacteria 4259
19 Ga0070683_100043179 3300005329 Bacteria 4155
20 Ga0070683_100059053 3300005329 Bacteria 3563
21 Ga0070683_100064776 3300005329 Bacteria 3403
22 Ga0070690_100001550 3300005330 Bacteria 12056
23 Ga0070690_100006846 3300005330 Bacteria 6486
24 Ga0070690_100019904 3300005330 Bacteria 4083
25 Ga0070670_100002268 3300005331 Bacteria 15822
26 Ga0070670_100004216 3300005331 Bacteria 12033
27 Ga0070670_100007292 3300005331 Bacteria 9378
28 Ga0070670_100013366 3300005331 Bacteria 7032
29 Ga0070677_10000071 3300005333 Bacteria 31922
30 Ga0068869_100000780 3300005334 Bacteria 18149
31 Ga0068869_100002264 3300005334 Bacteria 11583
32 Ga0068869_100062216 3300005334 Bacteria 2739
33 Ga0068869_100187903 3300005334 Unclassified 1623
34 Ga0070666_10000097 3300005335 Bacteria 60322
35 Ga0070666_10055636 3300005335 Bacteria 2671
36 Ga0070680_100000029 3300005336 Bacteria 74849
37 Ga0070680_100001042 3300005336 Bacteria 19845
38 Ga0070680_100007064 3300005336 Bacteria 8559
39 Ga0070680_100033261 3300005336 Bacteria 4154
40 Ga0070680_100101533 3300005336 Bacteria 2388
41 Ga0070680_100135966 3300005336 Bacteria 2059
42 Ga0070680_100213912 3300005336 Bacteria 1626
43 Ga0070682_100000267 3300005337 Bacteria 37543
44 Ga0070682_100005576 3300005337 Bacteria 7012
45 Ga0068868_100005293 3300005338 Bacteria 9067
46 Ga0068868_100020403 3300005338 Bacteria 4978
47 Ga0070660_100000067 3300005339 Bacteria 61507
48 Ga0070689_100003026 3300005340 Bacteria 11069
49 Ga0070691_10013881 3300005341 Bacteria 3698
50 Ga0070691_10029644 3300005341 Bacteria 2561
51 Ga0070687_100000198 3300005343 Bacteria 21075
52 Ga0070687_100034619 3300005343 Bacteria 2501
53 Ga0070661_100000128 3300005344 Bacteria 63056
54 Ga0070661_100005764 3300005344 Bacteria 8525
55 Ga0070661_100049598 3300005344 Bacteria 3073
56 Ga0070692_10003001 3300005345 Bacteria 6720
57 Ga0070692_10003133 3300005345 Bacteria 6633
58 Ga0070692_10004898 3300005345 Bacteria 5638
59 Ga0070692_10033554 3300005345 Bacteria 2587
60 Ga0070668_100000722 3300005347 Bacteria 22643
61 Ga0070668_100033892 3300005347 Bacteria 3891
62 Ga0070669_100002720 3300005353 Bacteria 12756
63 Ga0070669_100020213 3300005353 Bacteria 4756
64 Ga0070675_100004896 3300005354 Bacteria 10216
65 Ga0070675_100028806 3300005354 Bacteria 4473
66 Ga0070675_100044069 3300005354 Bacteria 3648
67 Ga0070671_100000220 3300005355 Bacteria 38135
68 Ga0070671_100017231 3300005355 Bacteria 5849
69 Ga0070671_100083292 3300005355 Bacteria 2674
70 Ga0070674_100000044 3300005356 Bacteria 54252
71 Ga0070674_100027636 3300005356 Bacteria 3719
72 Ga0070673_100003373 3300005364 Bacteria 9941
73 Ga0070673_100063154 3300005364 Bacteria 2946
74 Ga0070673_100064942 3300005364 Bacteria 2909
75 Ga0070673_100145166 3300005364 Bacteria 2005
76 Ga0070688_100000044 3300005365 Bacteria 59408
77 Ga0070688_100068137 3300005365 Bacteria 2269
78 Ga0070688_100074997 3300005365 Bacteria 2173
79 Ga0070659_100000229 3300005366 Bacteria 43553
80 Ga0070659_100015698 3300005366 Bacteria 5673
81 Ga0070659_100046505 3300005366 Bacteria 3401
82 Ga0070659_100051941 3300005366 Bacteria 3223
83 Ga0070659_100150967 3300005366 Bacteria 1895
84 Ga0070667_100004188 3300005367 Bacteria 12177
85 Ga0070667_100070035 3300005367 Bacteria 2985
86 Ga0070667_100088304 3300005367 Bacteria 2662
87 Ga0070709_10001251 3300005434 Bacteria 13900
88 Ga0070709_10003655 3300005434 Bacteria 8255
89 Ga0070709_10007521 3300005434 Bacteria 5975
90 Ga0070709_10093178 3300005434 Unclassified 1991
91 Ga0070714_100004158 3300005435 Bacteria 10882
92 Ga0070714_100004610 3300005435 Bacteria 10394
93 Ga0070714_100113634 3300005435 Bacteria 2401
94 Ga0070713_100000083 3300005436 Bacteria 59579
95 Ga0070713_100022861 3300005436 Bacteria 4840
96 Ga0070713_100083422 3300005436 Bacteria 2732
97 Ga0070710_10007381 3300005437 Bacteria 5323
98 Ga0070701_10007300 3300005438 Bacteria 4709
99 Ga0070701_10036359 3300005438 Bacteria 2481
100 Ga0070711_100065685 3300005439 Bacteria 2539
101 Ga0070705_100000744 3300005440 Bacteria 18503
102 Ga0070700_100000875 3300005441 Bacteria 14828
103 Ga0070694_100017525 3300005444 Bacteria 4527
104 Ga0070708_100000022 3300005445 Bacteria 113297
105 Ga0070708_100000139 3300005445 Bacteria 49545
106 Ga0070708_100008240 3300005445 Bacteria 8367
107 Ga0070663_100000778 3300005455 Bacteria 17375
108 Ga0070663_100010266 3300005455 Bacteria 5833
109 Ga0070663_100021684 3300005455 Bacteria 4278
110 Ga0070678_100006739 3300005456 Bacteria 6766
111 Ga0070662_100000605 3300005457 Bacteria 21915
112 Ga0070662_100002381 3300005457 Bacteria 11551
113 Ga0070662_100006891 3300005457 Bacteria 7353
114 Ga0070662_100024423 3300005457 Bacteria 4164
115 Ga0070662_100042548 3300005457 Bacteria 3245
116 Ga0070681_10002316 3300005458 Bacteria 17414
117 Ga0070681_10012221 3300005458 Bacteria 8513
118 Ga0070681_10030340 3300005458 Bacteria 5425
119 Ga0070681_10035028 3300005458 Bacteria 5042
120 Ga0070681_10042584 3300005458 Bacteria 4550
121 Ga0070681_10067574 3300005458 Bacteria 3542
122 Ga0070681_10087855 3300005458 Bacteria 3061
123 Ga0070681_10198078 3300005458 Bacteria 1927
124 Ga0068867_100000374 3300005459 Bacteria 29764
125 Ga0068867_100021149 3300005459 Bacteria 4640
126 Ga0068867_100066352 3300005459 Bacteria 2688
127 Ga0070685_10001857 3300005466 Bacteria 11023
128 Ga0070685_10057799 3300005466 Bacteria 2258
129 Ga0070685_10060769 3300005466 Bacteria 2210
130 Ga0070706_100010853 3300005467 Bacteria 8457
131 Ga0070706_100114211 3300005467 Bacteria 2514
132 Ga0070706_100118069 3300005467 Bacteria 2471
133 Ga0070706_100149376 3300005467 Bacteria 2181
134 Ga0070707_100005971 3300005468 Bacteria 11359
135 Ga0070707_100017042 3300005468 Bacteria 6823
136 Ga0070707_100110990 3300005468 Bacteria 2659
137 Ga0070698_100006397 3300005471 Bacteria 12786
138 Ga0070699_100026189 3300005518 Bacteria 5031
139 Ga0070679_100003800 3300005530 Bacteria 13856
140 Ga0070679_100004212 3300005530 Bacteria 13270
141 Ga0070679_100009491 3300005530 Bacteria 9203
142 Ga0070679_100036071 3300005530 Bacteria 4907
143 Ga0070679_100091841 3300005530 Bacteria 3023
144 Ga0070684_100000724 3300005535 Bacteria 22861
145 Ga0070684_100009448 3300005535 Bacteria 7681
146 Ga0070684_100011073 3300005535 Bacteria 7174
147 Ga0070684_100021592 3300005535 Bacteria 5361
148 Ga0070684_100035783 3300005535 Bacteria 4252
149 Ga0070684_100036823 3300005535 Bacteria 4194
150 Ga0070684_100087122 3300005535 Bacteria 2772
151 Ga0070684_100250719 3300005535 Bacteria 1618
152 Ga0068853_100002054 3300005539 Bacteria 14918
153 Ga0068853_100004237 3300005539 Bacteria 11073
154 Ga0070672_100001374 3300005543 Bacteria 15030
155 Ga0070672_100002312 3300005543 Bacteria 12033
156 Ga0070672_100100153 3300005543 Bacteria 2350
157 Ga0070672_100105327 3300005543 Bacteria 2293
158 Ga0070686_100000729 3300005544 Bacteria 19130
159 Ga0070686_100025631 3300005544 Bacteria 3550
160 Ga0070695_100003661 3300005545 Bacteria 8954
161 Ga0070695_100004307 3300005545 Bacteria 8336
162 Ga0070695_100005560 3300005545 Bacteria 7421
163 Ga0070695_100057931 3300005545 Unclassified 2504
164 Ga0070696_100007618 3300005546 Bacteria 7233
165 Ga0070696_100078926 3300005546 Bacteria 2328
166 Ga0070693_100001377 3300005547 Bacteria 10950
167 Ga0070693_100004527 3300005547 Bacteria 6584
168 Ga0070693_100007591 3300005547 Bacteria 5308
169 Ga0070693_100021015 3300005547 Bacteria 3452
170 Ga0070665_100013592 3300005548 Bacteria 8189
171 Ga0070665_100023382 3300005548 Bacteria 6222
172 Ga0070665_100066535 3300005548 Bacteria 3615
173 Ga0068855_100022889 3300005563 Bacteria 7488
174 Ga0068855_100024702 3300005563 Bacteria 7189
175 Ga0068855_100044497 3300005563 Bacteria 5253
176 Ga0068855_100154310 3300005563 Bacteria 2610
177 Ga0068855_100299484 3300005563 Bacteria 1781
178 Ga0068855_100402401 3300005563 Bacteria 1500
179 Ga0070664_100000286 3300005564 Bacteria 36492
180 Ga0070664_100001112 3300005564 Bacteria 21281
181 Ga0070664_100021581 3300005564 Bacteria 5310
182 Ga0070664_100087554 3300005564 Bacteria 2693
183 Ga0068857_100000087 3300005577 Bacteria 53140
184 Ga0068857_100002913 3300005577 Bacteria 14100
185 Ga0068857_100012716 3300005577 Bacteria 7336
186 Ga0068854_100000147 3300005578 Bacteria 48950
187 Ga0068854_100017181 3300005578 Bacteria 4837
188 Ga0068856_100003321 3300005614 Bacteria 16345
189 Ga0068856_100018762 3300005614 Bacteria 6707
190 Ga0068856_100024998 3300005614 Bacteria 5820
191 Ga0068856_100128508 3300005614 Bacteria 2538
192 Ga0070702_100016583 3300005615 Bacteria 3781
193 Ga0068852_100000090 3300005616 Bacteria 64065
194 Ga0068852_100011704 3300005616 Bacteria 6620
195 Ga0068852_100041771 3300005616 Bacteria 3878
196 Ga0068859_100008970 3300005617 Bacteria 10101
197 Ga0068859_100009049 3300005617 Bacteria 10061
198 Ga0068859_100031183 3300005617 Bacteria 5351
199 Ga0068859_100077425 3300005617 Bacteria 3366
200 Ga0068864_100001384 3300005618 Bacteria 20120
201 Ga0068864_100006808 3300005618 Bacteria 9363
202 Ga0068866_10000067 3300005718 Bacteria 41179
203 Ga0068861_100001927 3300005719 Bacteria 13360
204 Ga0068861_100018807 3300005719 Bacteria 4925
205 Ga0068851_10000087 3300005834 Bacteria 51670
206 Ga0068870_10000010 3300005840 Bacteria 70177
207 Ga0068863_100003111 3300005841 Bacteria 16374
208 Ga0068863_100089591 3300005841 Bacteria 2917
209 Ga0068858_100029973 3300005842 Bacteria 5053
210 Ga0068858_100153064 3300005842 Bacteria 2169
211 Ga0068858_100176087 3300005842 Bacteria 2018
212 Ga0068860_100001521 3300005843 Bacteria 24972
213 Ga0068860_100004645 3300005843 Bacteria 14025
214 Ga0068860_100006973 3300005843 Bacteria 11323
215 Ga0068860_100023389 3300005843 Bacteria 5971
216 Ga0068862_100004857 3300005844 Bacteria 11314
217 Ga0068862_100005088 3300005844 Bacteria 11069
218 Ga0081540_1000028 3300005983 Bacteria 150331
219 Ga0081540_1004263 3300005983 Bacteria 10978
220 Ga0081540_1004897 3300005983 Bacteria 10084
221 Ga0081539_10000117 3300005985 Bacteria 185868
222 Ga0070717_10001145 3300006028 Bacteria 17915
223 Ga0070717_10126897 3300006028 Bacteria 2191
224 Ga0070716_100029020 3300006173 Bacteria 2986
225 Ga0070712_100002713 3300006175 Bacteria 10929
226 Ga0070712_100010127 3300006175 Bacteria 5941
227 Ga0070712_100040466 3300006175 Unclassified 3195
228 Ga0070712_100090032 3300006175 Bacteria 2246
229 Ga0097621_100146682 3300006237 Unclassified 2021
230 Ga0068871_100000372 3300006358 Bacteria 31379
231 Ga0068871_100008233 3300006358 Bacteria 7493
232 Ga0075428_100033012 3300006844 Bacteria 5716
233 Ga0075430_100001641 3300006846 Bacteria 18285
234 Ga0075430_100068240 3300006846 Bacteria 2983
235 Ga0075430_100102745 3300006846 Bacteria 2386
236 Ga0075431_100017519 3300006847 Bacteria 7281
237 Ga0075431_100030727 3300006847 Bacteria 5533
238 Ga0075431_100030750 3300006847 Bacteria 5532
239 Ga0075431_100041568 3300006847 Bacteria 4740
240 Ga0075431_100050283 3300006847 Bacteria 4298
241 Ga0075431_100075870 3300006847 Bacteria 3469
242 Ga0075433_10013413 3300006852 Bacteria 6663
243 Ga0075434_100001742 3300006871 Bacteria 18691
244 Ga0075434_100154325 3300006871 Bacteria 2316
245 Ga0075429_100047795 3300006880 Bacteria 3722
246 Ga0075429_100065757 3300006880 Bacteria 3157
247 Ga0068865_100000443 3300006881 Bacteria 23029
248 Ga0068865_100002092 3300006881 Bacteria 11787
249 Ga0068865_100022320 3300006881 Bacteria 4127
250 Ga0097620_100008970 3300006931 Bacteria 10101
251 Ga0097620_100009047 3300006931 Bacteria 10061
252 Ga0097620_100031183 3300006931 Bacteria 5351
253 Ga0097620_100077427 3300006931 Bacteria 3366
254 Ga0075435_100062423 3300007076 Bacteria 3024
255 Ga0099794_10000055 3300007265 Bacteria 43614
256 Ga0105240_10001500 3300009093 Bacteria 39754
257 Ga0105240_10016511 3300009093 Bacteria 9993
258 Ga0105240_10084403 3300009093 Bacteria 3894
259 Ga0105240_10084709 3300009093 Bacteria 3886
260 Ga0111539_10038786 3300009094 Bacteria 5746
261 Ga0111539_10120122 3300009094 Bacteria 3079
262 Ga0105245_10001175 3300009098 Bacteria 23707
263 Ga0105245_10003387 3300009098 Bacteria 14280
264 Ga0105245_10037458 3300009098 Bacteria 4312
265 Ga0105245_10052940 3300009098 Bacteria 3642
266 Ga0105245_10148712 3300009098 Bacteria 2213
267 Ga0105247_10000294 3300009101 Bacteria 45240
268 Ga0114129_10002595 3300009147 Bacteria 25118
269 Ga0114129_10018361 3300009147 Bacteria 9961
270 Ga0114129_10078991 3300009147 Bacteria 4575
271 Ga0105243_10024991 3300009148 Bacteria 4561
272 Ga0105241_10000018 3300009174 Bacteria 155940
273 Ga0105241_10000385 3300009174 Bacteria 33441
274 Ga0105241_10037086 3300009174 Bacteria 3672
275 Ga0105242_10002033 3300009176 Bacteria 15923
276 Ga0105242_10036907 3300009176 Bacteria 3923
277 Ga0105248_10000906 3300009177 Bacteria 33083
278 Ga0105248_10002626 3300009177 Bacteria 19982
279 Ga0105248_10142827 3300009177 Bacteria 2701
280 Ga0105248_10162262 3300009177 Bacteria 2520
281 Ga0105248_10185923 3300009177 Bacteria 2341
282 Ga0105237_10000241 3300009545 Bacteria 77735
283 Ga0105237_10009918 3300009545 Bacteria 10162
284 Ga0105238_10001527 3300009551 Bacteria 23199
285 Ga0105238_10019853 3300009551 Bacteria 6840
286 Ga0105249_10000108 3300009553 Bacteria 113842
287 Ga0105249_10000576 3300009553 Bacteria 33690
288 Ga0105249_10006080 3300009553 Bacteria 10463
289 Ga0105239_10000460 3300010375 Bacteria 59533
290 Ga0105239_10012217 3300010375 Bacteria 9572
291 Ga0105239_10033237 3300010375 Bacteria 5664
292 Ga0105246_10000362 3300011119 Bacteria 24403
293 Ga0157373_10000334 3300013100 Bacteria 38219
294 Ga0157373_10005590 3300013100 Bacteria 9424
295 Ga0157373_10075780 3300013100 Bacteria 2373
296 Ga0157371_10000339 3300013102 Bacteria 60061
297 Ga0157371_10008832 3300013102 Bacteria 7981
298 Ga0157371_10019506 3300013102 Bacteria 4999
299 Ga0157371_10030748 3300013102 Bacteria 3871
300 Ga0157370_10001811 3300013104 Bacteria 26356
301 Ga0157370_10012404 3300013104 Bacteria 8838
302 Ga0157370_10023867 3300013104 Bacteria 6065
303 Ga0157370_10086115 3300013104 Bacteria 2952
304 Ga0157370_10118707 3300013104 Bacteria 2470
305 Ga0157370_10184276 3300013104 Bacteria 1939
306 Ga0157369_10003465 3300013105 Bacteria 18721
307 Ga0157369_10043883 3300013105 Bacteria 4870
308 Ga0157369_10065912 3300013105 Bacteria 3897
309 Ga0157369_10072384 3300013105 Bacteria 3699
310 Ga0157369_10115535 3300013105 Bacteria 2850
311 Ga0157369_10174232 3300013105 Bacteria 2265
312 Ga0157369_10384568 3300013105 Bacteria 1456
313 Ga0157374_10004438 3300013296 Bacteria 11791
314 Ga0157374_10010816 3300013296 Bacteria 7872
315 Ga0157374_10191604 3300013296 Bacteria 2000
316 Ga0157378_10008775 3300013297 Bacteria 8801
317 Ga0157378_10018637 3300013297 Bacteria 6102
318 Ga0157378_10029981 3300013297 Bacteria 4803
319 Ga0163162_10001852 3300013306 Bacteria 19911
320 Ga0163162_10019726 3300013306 Bacteria 6620
321 Ga0163162_10073275 3300013306 Bacteria 3480
322 Ga0163162_10158783 3300013306 Unclassified 2382
323 Ga0157372_10001985 3300013307 Bacteria 22233
324 Ga0157372_10005124 3300013307 Bacteria 13925
325 Ga0157372_10008965 3300013307 Bacteria 10632
326 Ga0157372_10024235 3300013307 Bacteria 6588
327 Ga0157372_10034247 3300013307 Bacteria 5583
328 Ga0157372_10034585 3300013307 Bacteria 5556
329 Ga0157372_10042288 3300013307 Bacteria 5039
330 Ga0157372_10042326 3300013307 Bacteria 5038
331 Ga0157372_10153341 3300013307 Bacteria 2660
332 Ga0157375_10007017 3300013308 Bacteria 9836
333 Ga0157375_10012614 3300013308 Bacteria 7499
334 Ga0157375_10027943 3300013308 Bacteria 5279
335 Ga0157375_10194506 3300013308 Unclassified 2183
336 Ga0163163_10001552 3300014325 Bacteria 19365
337 Ga0163163_10042858 3300014325 Bacteria 4434
338 Ga0157380_10005438 3300014326 Bacteria 8900
339 Ga0157380_10025069 3300014326 Bacteria 4520
340 Ga0157377_10000943 3300014745 Bacteria 12169
341 Ga0157377_10025254 3300014745 Bacteria 3167
342 Ga0157379_10004488 3300014968 Bacteria 11966
343 Ga0157379_10006486 3300014968 Bacteria 10084
344 Ga0157376_10000302 3300014969 Bacteria 33130
345 Ga0206353_11875486 3300020082 Bacteria 2234
346 Ga0207697_10000031 3300025315 Bacteria 51045
347 Ga0207697_10002027 3300025315 Bacteria 10710
348 Ga0207656_10000229 3300025321 Bacteria 20056
349 Ga0207682_10000628 3300025893 Bacteria 16424
350 Ga0207692_10091775 3300025898 Bacteria 1648
351 Ga0207642_10001538 3300025899 Bacteria 7092
352 Ga0207688_10000133 3300025901 Bacteria 31512
353 Ga0207680_10000498 3300025903 Bacteria 18697
354 Ga0207680_10040808 3300025903 Bacteria 2704
355 Ga0207647_10000946 3300025904 Bacteria 22438
356 Ga0207647_10055156 3300025904 Bacteria 2443
357 Ga0207699_10004378 3300025906 Bacteria 6754
358 Ga0207645_10000018 3300025907 Bacteria 110913
359 Ga0207645_10007146 3300025907 Bacteria 7923
360 Ga0207645_10018407 3300025907 Bacteria 4595
361 Ga0207645_10021302 3300025907 Bacteria 4228
362 Ga0207645_10131894 3300025907 Bacteria 1626
363 Ga0207643_10000016 3300025908 Bacteria 121792
364 Ga0207705_10009377 3300025909 Bacteria 7117
365 Ga0207684_10009627 3300025910 Bacteria 8524
366 Ga0207684_10098021 3300025910 Bacteria 2503
367 Ga0207684_10099242 3300025910 Bacteria 2487
368 Ga0207654_10000116 3300025911 Bacteria 51644
369 Ga0207654_10003392 3300025911 Bacteria 8059
370 Ga0207707_10000801 3300025912 Bacteria 30832
371 Ga0207707_10005137 3300025912 Bacteria 11475
372 Ga0207707_10005977 3300025912 Bacteria 10650
373 Ga0207707_10031573 3300025912 Bacteria 4635
374 Ga0207707_10062758 3300025912 Bacteria 3233
375 Ga0207695_10002148 3300025913 Bacteria 29879
376 Ga0207695_10006902 3300025913 Bacteria 14604
377 Ga0207695_10009399 3300025913 Bacteria 12093
378 Ga0207695_10027659 3300025913 Bacteria 6311
379 Ga0207695_10116683 3300025913 Bacteria 2643
380 Ga0207671_10048057 3300025914 Bacteria 3158
381 Ga0207693_10006217 3300025915 Bacteria 9907
382 Ga0207693_10026008 3300025915 Bacteria 4635
383 Ga0207663_10023330 3300025916 Bacteria 3549
384 Ga0207663_10067721 3300025916 Bacteria 2290
385 Ga0207660_10000129 3300025917 Bacteria 44676
386 Ga0207660_10009073 3300025917 Bacteria 6441
387 Ga0207660_10016232 3300025917 Bacteria 4928
388 Ga0207660_10087582 3300025917 Bacteria 2301
389 Ga0207660_10099085 3300025917 Bacteria 2174
390 Ga0207660_10109066 3300025917 Bacteria 2080
391 Ga0207662_10000003 3300025918 Bacteria 148717
392 Ga0207662_10164173 3300025918 Bacteria 1421
393 Ga0207657_10000009 3300025919 Bacteria 187503
394 Ga0207657_10009903 3300025919 Bacteria 9542
395 Ga0207657_10023864 3300025919 Bacteria 5682
396 Ga0207649_10003124 3300025920 Bacteria 9086
397 Ga0207649_10005920 3300025920 Bacteria 6628
398 Ga0207649_10025027 3300025920 Bacteria 3476
399 Ga0207649_10138074 3300025920 Bacteria 1664
400 Ga0207652_10004436 3300025921 Bacteria 11437
401 Ga0207652_10010020 3300025921 Bacteria 7634
402 Ga0207652_10015304 3300025921 Bacteria 6229
403 Ga0207652_10022984 3300025921 Bacteria 5165
404 Ga0207652_10032860 3300025921 Bacteria 4366
405 Ga0207652_10036232 3300025921 Bacteria 4171
406 Ga0207652_10096122 3300025921 Bacteria 2610
407 Ga0207646_10002972 3300025922 Bacteria 19619
408 Ga0207681_10001341 3300025923 Bacteria 15891
409 Ga0207681_10008385 3300025923 Bacteria 6319
410 Ga0207681_10028393 3300025923 Bacteria 3623
411 Ga0207681_10035375 3300025923 Bacteria 3291
412 Ga0207694_10098704 3300025924 Bacteria 2313
413 Ga0207650_10000753 3300025925 Bacteria 24962
414 Ga0207659_10000475 3300025926 Bacteria 24107
415 Ga0207659_10006307 3300025926 Bacteria 7257
416 Ga0207687_10009050 3300025927 Bacteria 6510
417 Ga0207687_10018208 3300025927 Bacteria 4633
418 Ga0207687_10020911 3300025927 Bacteria 4343
419 Ga0207687_10024394 3300025927 Bacteria 4041
420 Ga0207700_10000760 3300025928 Bacteria 18589
421 Ga0207700_10068231 3300025928 Bacteria 2725
422 Ga0207664_10014424 3300025929 Bacteria 5706
423 Ga0207664_10015083 3300025929 Bacteria 5597
424 Ga0207664_10028641 3300025929 Bacteria 4235
425 Ga0207644_10000263 3300025931 Bacteria 35326
426 Ga0207644_10040293 3300025931 Bacteria 3301
427 Ga0207644_10059595 3300025931 Bacteria 2761
428 Ga0207690_10014702 3300025932 Bacteria 4733
429 Ga0207690_10032163 3300025932 Bacteria 3364
430 Ga0207690_10033296 3300025932 Bacteria 3313
431 Ga0207690_10045735 3300025932 Bacteria 2894
432 Ga0207706_10000060 3300025933 Bacteria 110912
433 Ga0207706_10000478 3300025933 Bacteria 42804
434 Ga0207706_10005311 3300025933 Bacteria 12008
435 Ga0207706_10024342 3300025933 Bacteria 5428
436 Ga0207706_10049860 3300025933 Bacteria 3699
437 Ga0207686_10021964 3300025934 Bacteria 3670
438 Ga0207686_10072883 3300025934 Bacteria 2214
439 Ga0207686_10131864 3300025934 Bacteria 1715
440 Ga0207709_10002843 3300025935 Bacteria 10636
441 Ga0207670_10000415 3300025936 Bacteria 24212
442 Ga0207670_10171476 3300025936 Bacteria 1627
443 Ga0207669_10000464 3300025937 Bacteria 17694
444 Ga0207669_10016031 3300025937 Bacteria 3796
445 Ga0207669_10050863 3300025937 Unclassified 2480
446 Ga0207704_10000030 3300025938 Bacteria 115240
447 Ga0207704_10008447 3300025938 Bacteria 4927
448 Ga0207704_10060293 3300025938 Unclassified 2347
449 Ga0207704_10114820 3300025938 Bacteria 1829
450 Ga0207665_10000354 3300025939 Bacteria 31781
451 Ga0207691_10000259 3300025940 Bacteria 52644
452 Ga0207691_10000730 3300025940 Bacteria 32487
453 Ga0207691_10002431 3300025940 Bacteria 18216
454 Ga0207711_10000070 3300025941 Bacteria 114551
455 Ga0207711_10002627 3300025941 Bacteria 15910
456 Ga0207711_10109899 3300025941 Bacteria 2450
457 Ga0207689_10000010 3300025942 Bacteria 124704
458 Ga0207689_10001483 3300025942 Bacteria 22453
459 Ga0207689_10004032 3300025942 Bacteria 13349
460 Ga0207689_10023570 3300025942 Bacteria 5163
461 Ga0207661_10000893 3300025944 Bacteria 19588
462 Ga0207661_10001424 3300025944 Bacteria 16124
463 Ga0207661_10007259 3300025944 Bacteria 7882
464 Ga0207661_10008737 3300025944 Bacteria 7247
465 Ga0207661_10013561 3300025944 Bacteria 5952
466 Ga0207661_10055177 3300025944 Bacteria 3186
467 Ga0207661_10111930 3300025944 Bacteria 2310
468 Ga0207679_10000437 3300025945 Bacteria 29428
469 Ga0207679_10000556 3300025945 Bacteria 25043
470 Ga0207679_10000797 3300025945 Bacteria 20587
471 Ga0207679_10001062 3300025945 Bacteria 17471
472 Ga0207667_10000724 3300025949 Bacteria 42850
473 Ga0207667_10032458 3300025949 Bacteria 5626
474 Ga0207667_10040834 3300025949 Bacteria 4937
475 Ga0207667_10047041 3300025949 Bacteria 4567
476 Ga0207667_10068597 3300025949 Bacteria 3692
477 Ga0207667_10127569 3300025949 Bacteria 2621
478 Ga0207667_10212591 3300025949 Bacteria 1982
479 Ga0207651_10000030 3300025960 Bacteria 67091
480 Ga0207712_10003196 3300025961 Bacteria 10420
481 Ga0207712_10005187 3300025961 Bacteria 8240
482 Ga0207668_10119940 3300025972 Unclassified 1990
483 Ga0207640_10000534 3300025981 Bacteria 22781
484 Ga0207658_10000141 3300025986 Bacteria 75673
485 Ga0207658_10045838 3300025986 Bacteria 3189
486 Ga0207677_10000028 3300026023 Bacteria 125165
487 Ga0207677_10025961 3300026023 Bacteria 3664
488 Ga0207677_10026588 3300026023 Bacteria 3633
489 Ga0207677_10049265 3300026023 Bacteria 2841
490 Ga0207677_10117185 3300026023 Unclassified 1996
491 Ga0207703_10000398 3300026035 Bacteria 46686
492 Ga0207703_10070389 3300026035 Bacteria 2887
493 Ga0207703_10075055 3300026035 Bacteria 2801
494 Ga0207639_10023700 3300026041 Bacteria 4433
495 Ga0207639_10090618 3300026041 Bacteria 2446
496 Ga0207678_10000569 3300026067 Bacteria 33786
497 Ga0207678_10001207 3300026067 Bacteria 23746
498 Ga0207678_10115160 3300026067 Bacteria 2293
499 Ga0207678_10266764 3300026067 Bacteria 1468
500 Ga0207708_10002792 3300026075 Bacteria 12837
501 Ga0207708_10048373 3300026075 Bacteria 3237
502 Ga0207702_10038901 3300026078 Bacteria 3985
503 Ga0207702_10059924 3300026078 Bacteria 3244
504 Ga0207702_10102066 3300026078 Bacteria 2534
505 Ga0207641_10007555 3300026088 Bacteria 9041
506 Ga0207641_10008391 3300026088 Bacteria 8535
507 Ga0207641_10026382 3300026088 Bacteria 4794
508 Ga0207648_10000035 3300026089 Bacteria 124704
509 Ga0207648_10006464 3300026089 Bacteria 11641
510 Ga0207648_10010137 3300026089 Bacteria 8959
511 Ga0207648_10106533 3300026089 Bacteria 2460
512 Ga0207676_10001507 3300026095 Bacteria 17190
513 Ga0207676_10003424 3300026095 Bacteria 11218
514 Ga0207674_10000103 3300026116 Bacteria 97454
515 Ga0207674_10000662 3300026116 Bacteria 44758
516 Ga0207674_10002356 3300026116 Bacteria 23892
517 Ga0207674_10069167 3300026116 Bacteria 3551
518 Ga0207675_100000044 3300026118 Bacteria 88380
519 Ga0207675_100000899 3300026118 Bacteria 29725
520 Ga0207675_100236831 3300026118 Bacteria 1763
521 Ga0207683_10000609 3300026121 Bacteria 33004
522 Ga0207683_10032678 3300026121 Bacteria 4520
523 Ga0207698_10002469 3300026142 Bacteria 10967
524 Ga0207698_10139752 3300026142 Bacteria 2084
525 Ga0209588_1000012 3300027671 Bacteria 141363
526 Ga0209971_1019878 3300027682 Bacteria 1595
527 Ga0207428_10164271 3300027907 Bacteria 1684
528 Ga0268266_10000155 3300028379 Bacteria 129145
529 Ga0268265_10000411 3300028380 Bacteria 45912
530 Ga0268265_10002112 3300028380 Bacteria 15419
531 Ga0268265_10010210 3300028380 Bacteria 6339
532 Ga0268265_10013433 3300028380 Bacteria 5564
533 Ga0268264_10000173 3300028381 Bacteria 138426
534 Ga0268264_10001170 3300028381 Bacteria 25490
535 Ga0265332_10035190 3300031238 Bacteria 2175
536 Ga0265340_10029319 3300031247 Bacteria 2764
537 Ga0307408_100004891 3300031548 Bacteria 9022
538 Ga0307408_100006250 3300031548 Bacteria 7906
539 Ga0307408_100080130 3300031548 Bacteria 2438
540 Ga0265314_10005069 3300031711 Bacteria 12004
541 Ga0265342_10027219 3300031712 Bacteria 3576
542 Ga0307405_10002753 3300031731 Bacteria 7876
543 Ga0307405_10004716 3300031731 Bacteria 6487
544 Ga0307405_10048532 3300031731 Bacteria 2618
545 Ga0307413_10008666 3300031824 Bacteria 4818
546 Ga0307413_10034053 3300031824 Bacteria 2907
547 Ga0307410_10000190 3300031852 Bacteria 22747
548 Ga0307410_10010167 3300031852 Bacteria 5319
549 Ga0307410_10053853 3300031852 Bacteria 2724
550 Ga0307410_10161609 3300031852 Bacteria 1679
551 Ga0307406_10008057 3300031901 Bacteria 5868
552 Ga0307406_10009755 3300031901 Bacteria 5399
553 Ga0307406_10017928 3300031901 Bacteria 4130
554 Ga0307406_10076174 3300031901 Bacteria 2215
555 Ga0307407_10002572 3300031903 Bacteria 7145
556 Ga0307407_10031371 3300031903 Bacteria 2877
557 Ga0307407_10035979 3300031903 Bacteria 2724
558 Ga0307407_10076771 3300031903 Bacteria 2007
559 Ga0307412_10003215 3300031911 Bacteria 9085
560 Ga0307412_10004260 3300031911 Bacteria 7976
561 Ga0307412_10209151 3300031911 Bacteria 1487
562 Ga0307409_100002218 3300031995 Bacteria 10043
563 Ga0307409_100009419 3300031995 Bacteria 5997
564 Ga0307409_100247778 3300031995 Bacteria 1627
565 Ga0307416_100003674 3300032002 Bacteria 9082
566 Ga0307416_100049150 3300032002 Bacteria 3351
567 Ga0307416_100083562 3300032002 Bacteria 2710
568 Ga0307416_100114753 3300032002 Bacteria 2384
569 Ga0307416_100170264 3300032002 Bacteria 2026
570 Ga0307416_100254044 3300032002 Bacteria 1713
571 Ga0307414_10011379 3300032004 Bacteria 5214
572 Ga0307414_10035511 3300032004 Bacteria 3318
573 Ga0307411_10002083 3300032005 Bacteria 8617
574 Ga0307411_10020673 3300032005 Bacteria 3834
575 Ga0307411_10141457 3300032005 Bacteria 1775
576 Ga0307411_10147336 3300032005 Bacteria 1744
577 Ga0307411_10178268 3300032005 Bacteria 1610
578 Ga0307411_10214341 3300032005 Bacteria 1489
579 Ga0307415_100028608 3300032126 Bacteria 3548
580 Ga0307415_100038385 3300032126 Bacteria 3155
581 Ga0307415_100089308 3300032126 Bacteria 2226
582 Ga0373934_0000406 3300035086 Bacteria 15082
583 Ga0373934_0005683 3300035086 Bacteria 4617
584 Ga0373944_0000786 3300035089 Bacteria 7741
585 Ga0373923_0037835 3300035111 Bacteria 1974
586 Ga0373941_0001212 3300035115 Bacteria 5405
587 Ga0373945_0019809 3300035116 Unclassified 2298
588 Ga0373953_0020877 3300035117 Bacteria 2451
589 Ga0373956_0001700 3300035119 Bacteria 9070
590 Ga0373957_0020572 3300035120 Bacteria 2332
591 Ga0373943_0000721 3300035170 Bacteria 14463
592 Ga0373943_0016784 3300035170 Bacteria 3345
593 Ga0373946_0001214 3300035171 Bacteria 8916
594 Ga0373955_0000275 3300035172 Bacteria 21509
595 Ga0373955_0003192 3300035172 Bacteria 7179
596 Ga0373924_0017161 3300035410 Bacteria 2773
597 Ga0373931_0107117 3300035691 Unclassified 1580
598 Ga0373935_0001458 3300035692 Bacteria 13120
599 Ga0373935_0071480 3300035692 Bacteria 2239
600 Ga0373935_0079171 3300035692 Bacteria 2133
601 Ga0373927_0009458 3300035695 Bacteria 6535
602 Ga0373927_0010218 3300035695 Bacteria 6270
603 Ga0373933_0000048 3300035724 Bacteria 74138
604 Ga0373933_0000927 3300035724 Bacteria 17880
605 Ga0373947_0000223 3300035725 Bacteria 31691
606 Ga0373947_0006114 3300035725 Bacteria 7008
607 Ga0373937_0000209 3300036401 Bacteria 56604
608 Ga0373937_0000417 3300036401 Bacteria 39718
609 Ga0373925_0000664 3300037068 Bacteria 32303
610 Ga0373925_0003037 3300037068 Bacteria 13205
611 Ga0373925_0006996 3300037068 Bacteria 8240
612 Ga0373925_0032095 3300037068 Bacteria 3864
613 Ga0436363_1007604 3300039450 Bacteria 4224
614 Ga0439461_0003194 3300041410 Bacteria 2682
615 Ga0439445_0004371 3300042004 Bacteria 3202
616 Ga0439448_0004144 3300042005 Bacteria 4083
617 Ga0466969_0024106 3300044656 Bacteria 3130
618 Ga0466966_0034702 3300044684 Bacteria 3261
619 Ga0466963_0109730 3300044694 Bacteria 1893
620 Ga0453684_0106312 3300044712 Bacteria 3420
621 Ga0466959_0016889 3300045049 Bacteria 5341
622 Ga0466959_0022027 3300045049 Bacteria 4706
623 Ga0451576_0017396 3300045051 Bacteria 7905
624 Ga0451576_0230264 3300045051 Bacteria 1935
625 Ga0466958_0012289 3300045836 Bacteria 4848
626 Ga0495592_0059430 3300046454 Bacteria 2815
627 Ga0495603_0012900 3300046455 Bacteria 5052
628 Ga0495629_0002789 3300046459 Bacteria 13332
629 Ga0495629_0006310 3300046459 Bacteria 8798
630 Ga0495629_0010889 3300046459 Bacteria 6614
631 Ga0495629_0186524 3300046459 Bacteria 1436
632 Ga0495641_0060067 3300046461 Unclassified 1718
633 Ga0495651_0003268 3300046462 Bacteria 12444
634 Ga0495653_0000050 3300046463 Bacteria 106233
635 Ga0495580_0000935 3300046472 Bacteria 25503
636 Ga0495582_0000796 3300046473 Bacteria 17477
637 Ga0495582_0003621 3300046473 Bacteria 8700
638 Ga0495639_0002003 3300046475 Bacteria 9018
639 Ga0495664_0157435 3300046477 Bacteria 1378
640 Ga0495594_0016379 3300046499 Bacteria 3905
641 Ga0495608_0000216 3300046511 Bacteria 41647
642 Ga0495618_0053917 3300046514 Bacteria 2543
643 Ga0495628_0000654 3300046516 Bacteria 31712
644 Ga0495630_0001528 3300046517 Bacteria 16036
645 Ga0495630_0002012 3300046517 Bacteria 14133
646 Ga0495630_0002364 3300046517 Bacteria 13087
647 Ga0495630_0171116 3300046517 Bacteria 1655
648 Ga0495663_0001361 3300046525 Bacteria 7704
649 Ga0495652_0001059 3300046529 Bacteria 31241
650 Ga0495665_0000260 3300046531 Bacteria 26673
651 Ga0495665_0038683 3300046531 Bacteria 2543
652 Ga0495665_0048766 3300046531 Bacteria 2245
653 Ga0495586_0002347 3300046535 Bacteria 10304
654 Ga0495586_0013632 3300046535 Bacteria 4312
655 Ga0495587_0000660 3300046536 Bacteria 23102
656 Ga0495587_0001321 3300046536 Bacteria 16474
657 Ga0495645_0000066 3300046543 Bacteria 73132
658 Ga0495645_0000292 3300046543 Bacteria 36760
659 Ga0495667_0000609 3300046559 Bacteria 22859
660 Ga0495667_0024532 3300046559 Bacteria 4061
661 Ga0495656_0000632 3300046615 Bacteria 11276
662 Ga0495635_0003779 3300046663 Bacteria 10519
663 Ga0495588_0001715 3300046674 Bacteria 9336
664 Ga0495588_0032806 3300046674 Bacteria 2619
665 Ga0495588_0057952 3300046674 Bacteria 2002
666 Ga0495657_0000053 3300046675 Bacteria 100979
667 Ga0495599_0000708 3300046678 Bacteria 18830
668 Ga0495599_0058559 3300046678 Bacteria 2410
669 Ga0495623_0000158 3300046679 Bacteria 42253
670 Ga0495623_0007589 3300046679 Bacteria 7041
671 Ga0495646_0001991 3300046680 Bacteria 12339
672 Ga0495658_0000162 3300046683 Bacteria 37342
673 Ga0495658_0029677 3300046683 Bacteria 2963
674 Ga0495658_0058822 3300046683 Bacteria 2199
675 Ga0495613_0012235 3300046689 Bacteria 6378
676 Ga0495613_0069379 3300046689 Bacteria 2570
677 Ga0495600_0000032 3300046809 Bacteria 85490
678 Ga0495581_0003113 3300047315 Bacteria 9499
679 Ga0495581_0019350 3300047315 Bacteria 3952
680 Ga0495604_0000051 3300047317 Bacteria 103371
681 Ga0495674_0023758 3300047319 Bacteria 5644
682 Ga0495680_0004862 3300047322 Bacteria 12728
683 Ga0495675_0000738 3300047444 Bacteria 20387
684 Ga0495675_0006656 3300047444 Bacteria 7077
685 Ga0495684_0000929 3300047471 Bacteria 23788
686 Ga0495684_0111389 3300047471 Bacteria 2065
687 Ga0495593_0000232 3300047673 Bacteria 29743
688 Ga0495593_0054395 3300047673 Bacteria 2110
689 Ga0495602_0000361 3300048088 Bacteria 42478
690 Ga0495614_0000185 3300048089 Bacteria 23397
691 Ga0495615_0001183 3300048090 Bacteria 3789
692 Ga0496102_0001910 3300048905 Bacteria 17949
693 Ga0496106_0005452 3300048909 Bacteria 9416
694 Ga0496109_0009339 3300048912 Bacteria 8356
695 Ga0496109_0021650 3300048912 Bacteria 5689
696 Ga0496109_0244671 3300048912 Bacteria 1689
697 Ga0496112_0001136 3300048915 Bacteria 19817
698 Ga0496112_0005795 3300048915 Bacteria 10745
699 Ga0496112_0011843 3300048915 Bacteria 7986
700 Ga0496113_0006829 3300048916 Bacteria 7278
701 Ga0496113_0020657 3300048916 Bacteria 4635
702 Ga0496115_0184752 3300048918 Bacteria 1723
703 Ga0501033_0018633 3300049570 Bacteria 5246
704 Ga0501034_0381210 3300049571 Bacteria 1335
705 Ga0501037_0116661 3300049573 Bacteria 1921
706 Ga0501046_0074544 3300049580 Bacteria 2633
707 Ga0501047_0072317 3300049581 Bacteria 3319
708 Ga0501047_0091808 3300049581 Bacteria 2915
709 Ga0501075_0010770 3300049591 Bacteria 6442
710 Ga0501077_0072984 3300049593 Bacteria 2174
711 Ga0501261_005347 3300049690 Bacteria 1611
712 Ga0501035_0055433 3300049822 Bacteria 3539
713 Ga0501044_0034237 3300049823 Bacteria 5330
714 Ga0501044_0293987 3300049823 Bacteria 1555
715 nmdc:mga05p37_22428_c1 3300050507 Bacteria 7657
716 nmdc:mga05p37_58743_c1 3300050507 Bacteria 4737
717 nmdc:mga0qj67_10966_c1 3300050509 Bacteria 6783
718 nmdc:mga0qj67_37316_c1 3300050509 Bacteria 3806
719 nmdc:mga06r32_133178_c1 3300050510 Bacteria 2459
720 nmdc:mga06r32_18647_c1 3300050510 Bacteria 6356
721 nmdc:mga06r32_297056_c1 3300050510 Bacteria 1601
722 nmdc:mga06r32_68602_c1 3300050510 Bacteria 3426
723 nmdc:mga08y16_127125_c1 3300050511 Bacteria 2651
724 nmdc:mga0n895_169826_c1 3300050512 Bacteria 2213
725 nmdc:mga0n895_32137_c1 3300050512 Bacteria 5035
726 nmdc:mga0n895_9347_c1 3300050512 Bacteria 8570
727 nmdc:mga0rr50_73923_c1 3300050513 Bacteria 2607
728 nmdc:mga0rr50_88619_c1 3300050513 Bacteria 2404
729 nmdc:mga08x19_101446_c1 3300050514 Bacteria 1910
730 nmdc:mga0a205_10119_c1 3300050515 Bacteria 8656
731 nmdc:mga0a205_9691_c1 3300050515 Bacteria 8820
732 Ga0495601_0006239 3300053077 Bacteria 6960
733 Ga0495612_0002646 3300053078 Bacteria 7388
734 Ga0495595_0013214 3300053084 Bacteria 3485
735 Ga0495619_0011346 3300053085 Bacteria 5610
736 Ga0500618_000173 3300053125 Bacteria 53346
737 Ga0501084_0077436 3300054114 Bacteria 2788
738 Ga0501082_0038557 3300060353 Bacteria 4123

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005545 Ga0070695_100057931 Ga0070695_1000579313 350
2 3300049823 Ga0501044_0293987 Ga0501044_0293987_14_1111 365
3 3300047471 Ga0495684_0111389 Ga0495684_0111389_26_1195 389
4 3300005355 Ga0070671_100083292 Ga0070671_1000832922 391
5 3300005459 Ga0068867_100066352 Ga0068867_1000663522 391
6 3300013297 Ga0157378_10018637 Ga0157378_100186372 391
7 3300025931 Ga0207644_10059595 Ga0207644_100595953 391
8 3300026089 Ga0207648_10006464 Ga0207648_100064648 391
9 3300046525 Ga0495663_0001361 Ga0495663_0001361_1930_3132 391
10 3300046615 Ga0495656_0000632 Ga0495656_0000632_5503_6705 391
11 3300048090 Ga0495615_0001183 Ga0495615_0001183_2431_3633 391
12 3300053125 Ga0500618_000173 Ga0500618_000173_21223_22428 391
13 3300026121 Ga0207683_10032678 Ga0207683_100326782 397
14 3300009545 Ga0105237_10009918 Ga0105237_100099183 402
15 3300009098 Ga0105245_10052940 Ga0105245_100529402 405
16 3300046689 Ga0495613_0069379 Ga0495613_0069379_21_1238 405
17 3300005467 Ga0070706_100118069 Ga0070706_1001180691 409
18 3300025910 Ga0207684_10099242 Ga0207684_100992421 409
19 3300009098 Ga0105245_10003387 Ga0105245_100033878 411
20 3300009174 Ga0105241_10037086 Ga0105241_100370863 411
21 3300009177 Ga0105248_10000906 Ga0105248_1000090617 411
22 3300010375 Ga0105239_10033237 Ga0105239_100332372 411
23 3300011119 Ga0105246_10000362 Ga0105246_100003629 411
24 3300013100 Ga0157373_10005590 Ga0157373_100055906 411
25 3300013102 Ga0157371_10008832 Ga0157371_100088325 411
26 3300013307 Ga0157372_10001985 Ga0157372_1000198517 411
27 3300031852 Ga0307410_10053853 Ga0307410_100538532 413
28 3300031911 Ga0307412_10209151 Ga0307412_102091511 413
29 3300032004 Ga0307414_10035511 Ga0307414_100355112 413
30 3300032005 Ga0307411_10147336 Ga0307411_101473361 413
31 3300035086 Ga0373934_0005683 Ga0373934_0005683_510_1760 416
32 3300035172 Ga0373955_0003192 Ga0373955_0003192_4908_6158 416
33 3300035691 Ga0373931_0107117 Ga0373931_0107117_12_1262 416
34 3300035724 Ga0373933_0000927 Ga0373933_0000927_12678_13928 416
35 3300036401 Ga0373937_0000417 Ga0373937_0000417_11529_12779 416
36 3300046517 Ga0495630_0171116 Ga0495630_0171116_219_1469 416
37 3300046536 Ga0495587_0001321 Ga0495587_0001321_9549_10799 416
38 3300046543 Ga0495645_0000066 Ga0495645_0000066_59501_60751 416
39 3300046559 Ga0495667_0024532 Ga0495667_0024532_2207_3457 416
40 3300046678 Ga0495599_0058559 Ga0495599_0058559_1122_2372 416
41 3300046679 Ga0495623_0007589 Ga0495623_0007589_3933_5183 416
42 3300047444 Ga0495675_0006656 Ga0495675_0006656_5664_6914 416
43 3300046461 Ga0495641_0060067 Ga0495641_0060067_420_1682 419
44 3300048918 Ga0496115_0184752 Ga0496115_0184752_35_1294 419
45 3300039450 Ga0436363_1007604 Ga0436363_1007604_536_1843 420
46 3300035692 Ga0373935_0079171 Ga0373935_0079171_202_1473 421
47 3300035695 Ga0373927_0010218 Ga0373927_0010218_1257_2528 421
48 3300037068 Ga0373925_0003037 Ga0373925_0003037_10069_11340 421
49 3300007265 Ga0099794_10000055 Ga0099794_100000553 425
50 3300027671 Ga0209588_1000012 Ga0209588_1000012128 425
51 3300026067 Ga0207678_10266764 Ga0207678_102667641 426
52 3300005341 Ga0070691_10013881 Ga0070691_100138812 429
53 3300005843 Ga0068860_100001521 Ga0068860_1000015217 429
54 3300028381 Ga0268264_10001170 Ga0268264_100011708 429
55 3300049822 Ga0501035_0055433 Ga0501035_0055433_674_1963 429
56 3300006847 Ga0075431_100075870 Ga0075431_1000758701 430
57 3300041410 Ga0439461_0003194 Ga0439461_0003194_792_2090 430
58 3300050510 nmdc:mga06r32_133178_c1 nmdc:mga06r32_133178_c1_108_1400 430
59 3300005293 Ga0065715_10092087 Ga0065715_100920874 431
60 3300005327 Ga0070658_10036906 Ga0070658_100369062 431
61 3300005327 Ga0070658_10060322 Ga0070658_100603221 431
62 3300005328 Ga0070676_10013679 Ga0070676_100136792 431
63 3300005328 Ga0070676_10136888 Ga0070676_101368881 431
64 3300005329 Ga0070683_100029862 Ga0070683_1000298622 431
65 3300005329 Ga0070683_100030599 Ga0070683_1000305993 431
66 3300005329 Ga0070683_100040966 Ga0070683_1000409662 431
67 3300005329 Ga0070683_100059053 Ga0070683_1000590533 431
68 3300005329 Ga0070683_100064776 Ga0070683_1000647761 431
69 3300005331 Ga0070670_100007292 Ga0070670_1000072926 431
70 3300005331 Ga0070670_100013366 Ga0070670_1000133663 431
71 3300005334 Ga0068869_100062216 Ga0068869_1000622162 431
72 3300005336 Ga0070680_100001042 Ga0070680_1000010426 431
73 3300005336 Ga0070680_100033261 Ga0070680_1000332612 431
74 3300005336 Ga0070680_100101533 Ga0070680_1001015332 431
75 3300005336 Ga0070680_100135966 Ga0070680_1001359662 431
76 3300005336 Ga0070680_100213912 Ga0070680_1002139122 431
77 3300005337 Ga0070682_100000267 Ga0070682_1000002676 431
78 3300005337 Ga0070682_100005576 Ga0070682_1000055764 431
79 3300005338 Ga0068868_100020403 Ga0068868_1000204033 431
80 3300005341 Ga0070691_10029644 Ga0070691_100296442 431
81 3300005344 Ga0070661_100049598 Ga0070661_1000495982 431
82 3300005345 Ga0070692_10003001 Ga0070692_100030014 431
83 3300005345 Ga0070692_10033554 Ga0070692_100335542 431
84 3300005347 Ga0070668_100033892 Ga0070668_1000338922 431
85 3300005353 Ga0070669_100020213 Ga0070669_1000202133 431
86 3300005354 Ga0070675_100044069 Ga0070675_1000440692 431
87 3300005355 Ga0070671_100017231 Ga0070671_1000172316 431
88 3300005356 Ga0070674_100027636 Ga0070674_1000276362 431
89 3300005364 Ga0070673_100064942 Ga0070673_1000649423 431
90 3300005364 Ga0070673_100145166 Ga0070673_1001451662 431
91 3300005365 Ga0070688_100068137 Ga0070688_1000681372 431
92 3300005366 Ga0070659_100015698 Ga0070659_1000156987 431
93 3300005366 Ga0070659_100046505 Ga0070659_1000465053 431
94 3300005366 Ga0070659_100150967 Ga0070659_1001509672 431
95 3300005367 Ga0070667_100070035 Ga0070667_1000700352 431
96 3300005434 Ga0070709_10007521 Ga0070709_100075213 431
97 3300005435 Ga0070714_100004158 Ga0070714_10000415810 431
98 3300005437 Ga0070710_10007381 Ga0070710_100073814 431
99 3300005438 Ga0070701_10036359 Ga0070701_100363592 431
100 3300005444 Ga0070694_100017525 Ga0070694_1000175252 431
101 3300005445 Ga0070708_100000139 Ga0070708_10000013930 431
102 3300005445 Ga0070708_100008240 Ga0070708_1000082402 431
103 3300005455 Ga0070663_100010266 Ga0070663_1000102662 431
104 3300005455 Ga0070663_100021684 Ga0070663_1000216842 431
105 3300005457 Ga0070662_100002381 Ga0070662_1000023813 431
106 3300005457 Ga0070662_100006891 Ga0070662_1000068912 431
107 3300005457 Ga0070662_100042548 Ga0070662_1000425482 431
108 3300005458 Ga0070681_10012221 Ga0070681_100122212 431
109 3300005458 Ga0070681_10030340 Ga0070681_100303402 431
110 3300005458 Ga0070681_10198078 Ga0070681_101980782 431
111 3300005459 Ga0068867_100021149 Ga0068867_1000211492 431
112 3300005466 Ga0070685_10057799 Ga0070685_100577992 431
113 3300005467 Ga0070706_100010853 Ga0070706_1000108535 431
114 3300005467 Ga0070706_100114211 Ga0070706_1001142112 431
115 3300005467 Ga0070706_100149376 Ga0070706_1001493762 431
116 3300005468 Ga0070707_100005971 Ga0070707_1000059712 431
117 3300005468 Ga0070707_100017042 Ga0070707_1000170422 431
118 3300005468 Ga0070707_100110990 Ga0070707_1001109902 431
119 3300005518 Ga0070699_100026189 Ga0070699_1000261893 431
120 3300005530 Ga0070679_100004212 Ga0070679_1000042126 431
121 3300005535 Ga0070684_100021592 Ga0070684_1000215922 431
122 3300005535 Ga0070684_100035783 Ga0070684_1000357833 431
123 3300005535 Ga0070684_100087122 Ga0070684_1000871222 431
124 3300005535 Ga0070684_100250719 Ga0070684_1002507192 431
125 3300005539 Ga0068853_100002054 Ga0068853_10000205413 431
126 3300005543 Ga0070672_100001374 Ga0070672_1000013745 431
127 3300005543 Ga0070672_100100153 Ga0070672_1001001532 431
128 3300005544 Ga0070686_100025631 Ga0070686_1000256312 431
129 3300005545 Ga0070695_100004307 Ga0070695_1000043073 431
130 3300005546 Ga0070696_100078926 Ga0070696_1000789262 431
131 3300005547 Ga0070693_100001377 Ga0070693_1000013774 431
132 3300005548 Ga0070665_100023382 Ga0070665_1000233822 431
133 3300005548 Ga0070665_100066535 Ga0070665_1000665355 431
134 3300005563 Ga0068855_100154310 Ga0068855_1001543102 431
135 3300005563 Ga0068855_100299484 Ga0068855_1002994842 431
136 3300005563 Ga0068855_100402401 Ga0068855_1004024012 431
137 3300005564 Ga0070664_100087554 Ga0070664_1000875542 431
138 3300005577 Ga0068857_100012716 Ga0068857_1000127163 431
139 3300005578 Ga0068854_100017181 Ga0068854_1000171814 431
140 3300005614 Ga0068856_100128508 Ga0068856_1001285082 431
141 3300005617 Ga0068859_100031183 Ga0068859_1000311834 431
142 3300005719 Ga0068861_100018807 Ga0068861_1000188075 431
143 3300005842 Ga0068858_100176087 Ga0068858_1001760871 431
144 3300005843 Ga0068860_100023389 Ga0068860_1000233892 431
145 3300005844 Ga0068862_100004857 Ga0068862_1000048577 431
146 3300006173 Ga0070716_100029020 Ga0070716_1000290202 431
147 3300006175 Ga0070712_100010127 Ga0070712_1000101272 431
148 3300006844 Ga0075428_100033012 Ga0075428_1000330125 431
149 3300006846 Ga0075430_100001641 Ga0075430_10000164114 431
150 3300006846 Ga0075430_100068240 Ga0075430_1000682402 431
151 3300006846 Ga0075430_100102745 Ga0075430_1001027452 431
152 3300006847 Ga0075431_100017519 Ga0075431_1000175197 431
153 3300006847 Ga0075431_100030727 Ga0075431_1000307274 431
154 3300006847 Ga0075431_100030750 Ga0075431_1000307503 431
155 3300006847 Ga0075431_100041568 Ga0075431_1000415683 431
156 3300006847 Ga0075431_100050283 Ga0075431_1000502832 431
157 3300006852 Ga0075433_10013413 Ga0075433_100134136 431
158 3300006871 Ga0075434_100001742 Ga0075434_1000017426 431
159 3300006871 Ga0075434_100154325 Ga0075434_1001543253 431
160 3300006880 Ga0075429_100047795 Ga0075429_1000477952 431
161 3300006880 Ga0075429_100065757 Ga0075429_1000657571 431
162 3300006881 Ga0068865_100002092 Ga0068865_1000020923 431
163 3300006881 Ga0068865_100022320 Ga0068865_1000223203 431
164 3300006931 Ga0097620_100031183 Ga0097620_1000311834 431
165 3300007076 Ga0075435_100062423 Ga0075435_1000624234 431
166 3300009093 Ga0105240_10016511 Ga0105240_100165118 431
167 3300009093 Ga0105240_10084403 Ga0105240_100844032 431
168 3300009094 Ga0111539_10038786 Ga0111539_100387865 431
169 3300009094 Ga0111539_10120122 Ga0111539_101201221 431
170 3300009098 Ga0105245_10037458 Ga0105245_100374582 431
171 3300009098 Ga0105245_10148712 Ga0105245_101487122 431
172 3300009147 Ga0114129_10002595 Ga0114129_100025957 431
173 3300009147 Ga0114129_10018361 Ga0114129_100183614 431
174 3300009147 Ga0114129_10078991 Ga0114129_100789912 431
175 3300009174 Ga0105241_10000018 Ga0105241_1000001858 431
176 3300009177 Ga0105248_10162262 Ga0105248_101622622 431
177 3300009177 Ga0105248_10185923 Ga0105248_101859233 431
178 3300009551 Ga0105238_10019853 Ga0105238_100198534 431
179 3300009553 Ga0105249_10000576 Ga0105249_1000057621 431
180 3300009553 Ga0105249_10006080 Ga0105249_100060803 431
181 3300010375 Ga0105239_10012217 Ga0105239_100122174 431
182 3300013100 Ga0157373_10075780 Ga0157373_100757802 431
183 3300013102 Ga0157371_10019506 Ga0157371_100195065 431
184 3300013102 Ga0157371_10030748 Ga0157371_100307484 431
185 3300013104 Ga0157370_10023867 Ga0157370_100238672 431
186 3300013104 Ga0157370_10184276 Ga0157370_101842762 431
187 3300013105 Ga0157369_10043883 Ga0157369_100438833 431
188 3300013105 Ga0157369_10072384 Ga0157369_100723841 431
189 3300013105 Ga0157369_10115535 Ga0157369_101155353 431
190 3300013105 Ga0157369_10174232 Ga0157369_101742322 431
191 3300013296 Ga0157374_10191604 Ga0157374_101916042 431
192 3300013297 Ga0157378_10029981 Ga0157378_100299812 431
193 3300013306 Ga0163162_10019726 Ga0163162_100197261 431
194 3300013306 Ga0163162_10073275 Ga0163162_100732752 431
195 3300013307 Ga0157372_10034247 Ga0157372_100342476 431
196 3300013307 Ga0157372_10042288 Ga0157372_100422884 431
197 3300013308 Ga0157375_10027943 Ga0157375_100279433 431
198 3300014325 Ga0163163_10042858 Ga0163163_100428584 431
199 3300014326 Ga0157380_10005438 Ga0157380_100054383 431
200 3300014326 Ga0157380_10025069 Ga0157380_100250693 431
201 3300014745 Ga0157377_10025254 Ga0157377_100252543 431
202 3300014968 Ga0157379_10004488 Ga0157379_100044882 431
203 3300020082 Ga0206353_11875486 Ga0206353_118754862 431
204 3300025315 Ga0207697_10002027 Ga0207697_100020274 431
205 3300025898 Ga0207692_10091775 Ga0207692_100917752 431
206 3300025904 Ga0207647_10055156 Ga0207647_100551562 431
207 3300025907 Ga0207645_10007146 Ga0207645_100071464 431
208 3300025907 Ga0207645_10021302 Ga0207645_100213022 431
209 3300025907 Ga0207645_10131894 Ga0207645_101318941 431
210 3300025909 Ga0207705_10009377 Ga0207705_100093773 431
211 3300025910 Ga0207684_10009627 Ga0207684_100096271 431
212 3300025910 Ga0207684_10098021 Ga0207684_100980212 431
213 3300025911 Ga0207654_10000116 Ga0207654_1000011637 431
214 3300025912 Ga0207707_10000801 Ga0207707_100008013 431
215 3300025912 Ga0207707_10062758 Ga0207707_100627581 431
216 3300025913 Ga0207695_10116683 Ga0207695_101166832 431
217 3300025914 Ga0207671_10048057 Ga0207671_100480572 431
218 3300025916 Ga0207663_10067721 Ga0207663_100677212 431
219 3300025917 Ga0207660_10087582 Ga0207660_100875822 431
220 3300025917 Ga0207660_10099085 Ga0207660_100990852 431
221 3300025917 Ga0207660_10109066 Ga0207660_101090662 431
222 3300025919 Ga0207657_10009903 Ga0207657_100099035 431
223 3300025919 Ga0207657_10023864 Ga0207657_100238645 431
224 3300025920 Ga0207649_10025027 Ga0207649_100250272 431
225 3300025920 Ga0207649_10138074 Ga0207649_101380742 431
226 3300025921 Ga0207652_10022984 Ga0207652_100229845 431
227 3300025921 Ga0207652_10036232 Ga0207652_100362323 431
228 3300025922 Ga0207646_10002972 Ga0207646_1000297212 431
229 3300025923 Ga0207681_10008385 Ga0207681_100083853 431
230 3300025923 Ga0207681_10028393 Ga0207681_100283932 431
231 3300025923 Ga0207681_10035375 Ga0207681_100353752 431
232 3300025927 Ga0207687_10020911 Ga0207687_100209112 431
233 3300025929 Ga0207664_10015083 Ga0207664_100150835 431
234 3300025931 Ga0207644_10040293 Ga0207644_100402932 431
235 3300025932 Ga0207690_10032163 Ga0207690_100321633 431
236 3300025932 Ga0207690_10033296 Ga0207690_100332962 431
237 3300025932 Ga0207690_10045735 Ga0207690_100457352 431
238 3300025933 Ga0207706_10000478 Ga0207706_1000047821 431
239 3300025933 Ga0207706_10005311 Ga0207706_100053116 431
240 3300025933 Ga0207706_10049860 Ga0207706_100498602 431
241 3300025936 Ga0207670_10171476 Ga0207670_101714762 431
242 3300025937 Ga0207669_10016031 Ga0207669_100160312 431
243 3300025938 Ga0207704_10008447 Ga0207704_100084473 431
244 3300025938 Ga0207704_10114820 Ga0207704_101148201 431
245 3300025939 Ga0207665_10000354 Ga0207665_100003544 431
246 3300025940 Ga0207691_10000259 Ga0207691_1000025922 431
247 3300025940 Ga0207691_10002431 Ga0207691_1000243113 431
248 3300025941 Ga0207711_10109899 Ga0207711_101098993 431
249 3300025942 Ga0207689_10004032 Ga0207689_100040329 431
250 3300025944 Ga0207661_10007259 Ga0207661_100072595 431
251 3300025945 Ga0207679_10001062 Ga0207679_1000106220 431
252 3300025949 Ga0207667_10032458 Ga0207667_100324586 431
253 3300025949 Ga0207667_10047041 Ga0207667_100470413 431
254 3300025949 Ga0207667_10068597 Ga0207667_100685971 431
255 3300025949 Ga0207667_10127569 Ga0207667_101275692 431
256 3300025949 Ga0207667_10212591 Ga0207667_102125912 431
257 3300025961 Ga0207712_10005187 Ga0207712_100051878 431
258 3300025986 Ga0207658_10045838 Ga0207658_100458382 431
259 3300026023 Ga0207677_10025961 Ga0207677_100259612 431
260 3300026023 Ga0207677_10026588 Ga0207677_100265884 431
261 3300026023 Ga0207677_10049265 Ga0207677_100492652 431
262 3300026035 Ga0207703_10070389 Ga0207703_100703892 431
263 3300026041 Ga0207639_10023700 Ga0207639_100237002 431
264 3300026041 Ga0207639_10090618 Ga0207639_100906183 431
265 3300026067 Ga0207678_10001207 Ga0207678_100012075 431
266 3300026067 Ga0207678_10115160 Ga0207678_101151602 431
267 3300026075 Ga0207708_10002792 Ga0207708_100027923 431
268 3300026075 Ga0207708_10048373 Ga0207708_100483733 431
269 3300026088 Ga0207641_10026382 Ga0207641_100263821 431
270 3300026089 Ga0207648_10010137 Ga0207648_100101376 431
271 3300026116 Ga0207674_10002356 Ga0207674_100023562 431
272 3300026118 Ga0207675_100000044 Ga0207675_10000004459 431
273 3300026118 Ga0207675_100236831 Ga0207675_1002368312 431
274 3300026142 Ga0207698_10139752 Ga0207698_101397522 431
275 3300027682 Ga0209971_1019878 Ga0209971_10198781 431
276 3300027907 Ga0207428_10164271 Ga0207428_101642712 431
277 3300028380 Ga0268265_10002112 Ga0268265_1000211213 431
278 3300028380 Ga0268265_10010210 Ga0268265_100102103 431
279 3300031238 Ga0265332_10035190 Ga0265332_100351901 431
280 3300031247 Ga0265340_10029319 Ga0265340_100293192 431
281 3300031548 Ga0307408_100004891 Ga0307408_1000048913 431
282 3300031548 Ga0307408_100080130 Ga0307408_1000801302 431
283 3300031711 Ga0265314_10005069 Ga0265314_100050698 431
284 3300031712 Ga0265342_10027219 Ga0265342_100272192 431
285 3300031731 Ga0307405_10002753 Ga0307405_100027532 431
286 3300031731 Ga0307405_10048532 Ga0307405_100485322 431
287 3300031824 Ga0307413_10008666 Ga0307413_100086662 431
288 3300031824 Ga0307413_10034053 Ga0307413_100340532 431
289 3300031852 Ga0307410_10000190 Ga0307410_100001905 431
290 3300031852 Ga0307410_10161609 Ga0307410_101616092 431
291 3300031901 Ga0307406_10008057 Ga0307406_100080573 431
292 3300031901 Ga0307406_10009755 Ga0307406_100097554 431
293 3300031901 Ga0307406_10017928 Ga0307406_100179281 431
294 3300031903 Ga0307407_10031371 Ga0307407_100313712 431
295 3300031903 Ga0307407_10035979 Ga0307407_100359792 431
296 3300031903 Ga0307407_10076771 Ga0307407_100767712 431
297 3300031911 Ga0307412_10004260 Ga0307412_100042602 431
298 3300031995 Ga0307409_100002218 Ga0307409_1000022183 431
299 3300032002 Ga0307416_100003674 Ga0307416_1000036744 431
300 3300032002 Ga0307416_100049150 Ga0307416_1000491502 431
301 3300032002 Ga0307416_100083562 Ga0307416_1000835622 431
302 3300032002 Ga0307416_100114753 Ga0307416_1001147532 431
303 3300032002 Ga0307416_100170264 Ga0307416_1001702642 431
304 3300032005 Ga0307411_10002083 Ga0307411_100020835 431
305 3300032005 Ga0307411_10178268 Ga0307411_101782682 431
306 3300032005 Ga0307411_10214341 Ga0307411_102143411 431
307 3300032126 Ga0307415_100028608 Ga0307415_1000286082 431
308 3300032126 Ga0307415_100089308 Ga0307415_1000893082 431
309 3300035115 Ga0373941_0001212 Ga0373941_0001212_3192_4490 431
310 3300035692 Ga0373935_0071480 Ga0373935_0071480_490_1788 431
311 3300042004 Ga0439445_0004371 Ga0439445_0004371_64_1377 431
312 3300044656 Ga0466969_0024106 Ga0466969_0024106_106_1404 431
313 3300044712 Ga0453684_0106312 Ga0453684_0106312_837_2132 431
314 3300045049 Ga0466959_0016889 Ga0466959_0016889_1926_3224 431
315 3300045051 Ga0451576_0230264 Ga0451576_0230264_514_1809 431
316 3300046459 Ga0495629_0186524 Ga0495629_0186524_41_1336 431
317 3300046674 Ga0495588_0032806 Ga0495588_0032806_296_1594 431
318 3300046683 Ga0495658_0058822 Ga0495658_0058822_860_2155 431
319 3300048912 Ga0496109_0244671 Ga0496109_0244671_19_1314 431
320 3300048915 Ga0496112_0011843 Ga0496112_0011843_5870_7168 431
321 3300049571 Ga0501034_0381210 Ga0501034_0381210_18_1313 431
322 3300049573 Ga0501037_0116661 Ga0501037_0116661_552_1847 431
323 3300049580 Ga0501046_0074544 Ga0501046_0074544_824_2119 431
324 3300049581 Ga0501047_0072317 Ga0501047_0072317_1861_3156 431
325 3300049591 Ga0501075_0010770 Ga0501075_0010770_1399_2697 431
326 3300049593 Ga0501077_0072984 Ga0501077_0072984_531_1829 431
327 3300049690 Ga0501261_005347 Ga0501261_005347_229_1524 431
328 3300050507 nmdc:mga05p37_22428_c1 nmdc:mga05p37_22428_c1_1749_3044 431
329 3300050507 nmdc:mga05p37_58743_c1 nmdc:mga05p37_58743_c1_1134_2429 431
330 3300050509 nmdc:mga0qj67_10966_c1 nmdc:mga0qj67_10966_c1_2560_3855 431
331 3300050509 nmdc:mga0qj67_37316_c1 nmdc:mga0qj67_37316_c1_886_2184 431
332 3300050510 nmdc:mga06r32_18647_c1 nmdc:mga06r32_18647_c1_3597_4901 431
333 3300050510 nmdc:mga06r32_297056_c1 nmdc:mga06r32_297056_c1_130_1425 431
334 3300050510 nmdc:mga06r32_68602_c1 nmdc:mga06r32_68602_c1_1478_2773 431
335 3300050511 nmdc:mga08y16_127125_c1 nmdc:mga08y16_127125_c1_254_1549 431
336 3300050512 nmdc:mga0n895_169826_c1 nmdc:mga0n895_169826_c1_179_1474 431
337 3300050512 nmdc:mga0n895_32137_c1 nmdc:mga0n895_32137_c1_3052_4350 431
338 3300050512 nmdc:mga0n895_9347_c1 nmdc:mga0n895_9347_c1_3882_5177 431
339 3300050513 nmdc:mga0rr50_73923_c1 nmdc:mga0rr50_73923_c1_1236_2531 431
340 3300050515 nmdc:mga0a205_10119_c1 nmdc:mga0a205_10119_c1_5424_6722 431
341 3300050515 nmdc:mga0a205_9691_c1 nmdc:mga0a205_9691_c1_4607_5902 431
342 3300054114 Ga0501084_0077436 Ga0501084_0077436_131_1429 431
343 3300060353 Ga0501082_0038557 Ga0501082_0038557_2264_3562 431
344 3300005290 Ga0065712_10106929 Ga0065712_101069292 432
345 3300005327 Ga0070658_10000166 Ga0070658_1000016644 432
346 3300005328 Ga0070676_10002851 Ga0070676_100028514 432
347 3300005329 Ga0070683_100000840 Ga0070683_1000008408 432
348 3300005329 Ga0070683_100001190 Ga0070683_1000011903 432
349 3300005329 Ga0070683_100003494 Ga0070683_1000034944 432
350 3300005329 Ga0070683_100011375 Ga0070683_1000113755 432
351 3300005329 Ga0070683_100018412 Ga0070683_1000184122 432
352 3300005329 Ga0070683_100020819 Ga0070683_1000208192 432
353 3300005329 Ga0070683_100024804 Ga0070683_1000248042 432
354 3300005329 Ga0070683_100043179 Ga0070683_1000431792 432
355 3300005330 Ga0070690_100001550 Ga0070690_1000015505 432
356 3300005330 Ga0070690_100006846 Ga0070690_1000068464 432
357 3300005330 Ga0070690_100019904 Ga0070690_1000199042 432
358 3300005331 Ga0070670_100002268 Ga0070670_1000022686 432
359 3300005331 Ga0070670_100004216 Ga0070670_1000042165 432
360 3300005333 Ga0070677_10000071 Ga0070677_1000007114 432
361 3300005334 Ga0068869_100000780 Ga0068869_10000078012 432
362 3300005334 Ga0068869_100002264 Ga0068869_1000022649 432
363 3300005334 Ga0068869_100187903 Ga0068869_1001879031 432
364 3300005335 Ga0070666_10000097 Ga0070666_1000009749 432
365 3300005335 Ga0070666_10055636 Ga0070666_100556362 432
366 3300005336 Ga0070680_100000029 Ga0070680_10000002932 432
367 3300005336 Ga0070680_100007064 Ga0070680_1000070643 432
368 3300005338 Ga0068868_100005293 Ga0068868_1000052931 432
369 3300005339 Ga0070660_100000067 Ga0070660_10000006741 432
370 3300005340 Ga0070689_100003026 Ga0070689_1000030267 432
371 3300005343 Ga0070687_100000198 Ga0070687_1000001985 432
372 3300005343 Ga0070687_100034619 Ga0070687_1000346192 432
373 3300005344 Ga0070661_100000128 Ga0070661_10000012856 432
374 3300005344 Ga0070661_100005764 Ga0070661_1000057646 432
375 3300005345 Ga0070692_10003133 Ga0070692_100031332 432
376 3300005345 Ga0070692_10004898 Ga0070692_100048982 432
377 3300005347 Ga0070668_100000722 Ga0070668_10000072212 432
378 3300005353 Ga0070669_100002720 Ga0070669_1000027202 432
379 3300005354 Ga0070675_100004896 Ga0070675_1000048962 432
380 3300005354 Ga0070675_100028806 Ga0070675_1000288064 432
381 3300005355 Ga0070671_100000220 Ga0070671_10000022029 432
382 3300005356 Ga0070674_100000044 Ga0070674_10000004420 432
383 3300005364 Ga0070673_100003373 Ga0070673_1000033732 432
384 3300005364 Ga0070673_100063154 Ga0070673_1000631542 432
385 3300005365 Ga0070688_100000044 Ga0070688_10000004440 432
386 3300005365 Ga0070688_100074997 Ga0070688_1000749972 432
387 3300005366 Ga0070659_100000229 Ga0070659_10000022914 432
388 3300005366 Ga0070659_100051941 Ga0070659_1000519412 432
389 3300005367 Ga0070667_100004188 Ga0070667_1000041885 432
390 3300005367 Ga0070667_100088304 Ga0070667_1000883042 432
391 3300005434 Ga0070709_10001251 Ga0070709_1000125111 432
392 3300005434 Ga0070709_10003655 Ga0070709_100036556 432
393 3300005434 Ga0070709_10093178 Ga0070709_100931782 432
394 3300005435 Ga0070714_100004610 Ga0070714_1000046107 432
395 3300005435 Ga0070714_100113634 Ga0070714_1001136342 432
396 3300005436 Ga0070713_100000083 Ga0070713_10000008347 432
397 3300005436 Ga0070713_100022861 Ga0070713_1000228613 432
398 3300005436 Ga0070713_100083422 Ga0070713_1000834222 432
399 3300005438 Ga0070701_10007300 Ga0070701_100073004 432
400 3300005439 Ga0070711_100065685 Ga0070711_1000656852 432
401 3300005440 Ga0070705_100000744 Ga0070705_1000007441 432
402 3300005441 Ga0070700_100000875 Ga0070700_10000087516 432
403 3300005445 Ga0070708_100000022 Ga0070708_10000002264 432
404 3300005455 Ga0070663_100000778 Ga0070663_1000007789 432
405 3300005456 Ga0070678_100006739 Ga0070678_1000067392 432
406 3300005457 Ga0070662_100000605 Ga0070662_1000006053 432
407 3300005457 Ga0070662_100024423 Ga0070662_1000244232 432
408 3300005458 Ga0070681_10002316 Ga0070681_100023163 432
409 3300005458 Ga0070681_10035028 Ga0070681_100350282 432
410 3300005458 Ga0070681_10042584 Ga0070681_100425843 432
411 3300005458 Ga0070681_10067574 Ga0070681_100675741 432
412 3300005458 Ga0070681_10087855 Ga0070681_100878552 432
413 3300005459 Ga0068867_100000374 Ga0068867_10000037418 432
414 3300005466 Ga0070685_10001857 Ga0070685_100018575 432
415 3300005466 Ga0070685_10060769 Ga0070685_100607692 432
416 3300005471 Ga0070698_100006397 Ga0070698_10000639712 432
417 3300005530 Ga0070679_100003800 Ga0070679_1000038006 432
418 3300005530 Ga0070679_100009491 Ga0070679_1000094912 432
419 3300005530 Ga0070679_100036071 Ga0070679_1000360712 432
420 3300005530 Ga0070679_100091841 Ga0070679_1000918412 432
421 3300005535 Ga0070684_100000724 Ga0070684_1000007242 432
422 3300005535 Ga0070684_100009448 Ga0070684_1000094485 432
423 3300005535 Ga0070684_100011073 Ga0070684_1000110735 432
424 3300005535 Ga0070684_100036823 Ga0070684_1000368233 432
425 3300005539 Ga0068853_100004237 Ga0068853_1000042377 432
426 3300005543 Ga0070672_100002312 Ga0070672_1000023125 432
427 3300005543 Ga0070672_100105327 Ga0070672_1001053272 432
428 3300005544 Ga0070686_100000729 Ga0070686_1000007293 432
429 3300005545 Ga0070695_100003661 Ga0070695_1000036613 432
430 3300005545 Ga0070695_100005560 Ga0070695_1000055608 432
431 3300005546 Ga0070696_100007618 Ga0070696_1000076186 432
432 3300005547 Ga0070693_100004527 Ga0070693_1000045272 432
433 3300005547 Ga0070693_100007591 Ga0070693_1000075912 432
434 3300005547 Ga0070693_100021015 Ga0070693_1000210152 432
435 3300005548 Ga0070665_100013592 Ga0070665_1000135925 432
436 3300005563 Ga0068855_100022889 Ga0068855_1000228895 432
437 3300005563 Ga0068855_100024702 Ga0068855_1000247022 432
438 3300005563 Ga0068855_100044497 Ga0068855_1000444972 432
439 3300005564 Ga0070664_100000286 Ga0070664_10000028629 432
440 3300005564 Ga0070664_100001112 Ga0070664_1000011126 432
441 3300005564 Ga0070664_100021581 Ga0070664_1000215812 432
442 3300005577 Ga0068857_100000087 Ga0068857_10000008732 432
443 3300005577 Ga0068857_100002913 Ga0068857_10000291314 432
444 3300005578 Ga0068854_100000147 Ga0068854_10000014714 432
445 3300005614 Ga0068856_100003321 Ga0068856_1000033215 432
446 3300005614 Ga0068856_100018762 Ga0068856_1000187623 432
447 3300005614 Ga0068856_100024998 Ga0068856_1000249984 432
448 3300005615 Ga0070702_100016583 Ga0070702_1000165832 432
449 3300005616 Ga0068852_100000090 Ga0068852_10000009012 432
450 3300005616 Ga0068852_100011704 Ga0068852_1000117043 432
451 3300005616 Ga0068852_100041771 Ga0068852_1000417712 432
452 3300005617 Ga0068859_100008970 Ga0068859_1000089706 432
453 3300005617 Ga0068859_100009049 Ga0068859_1000090493 432
454 3300005617 Ga0068859_100077425 Ga0068859_1000774252 432
455 3300005618 Ga0068864_100001384 Ga0068864_10000138414 432
456 3300005618 Ga0068864_100006808 Ga0068864_1000068086 432
457 3300005718 Ga0068866_10000067 Ga0068866_1000006717 432
458 3300005719 Ga0068861_100001927 Ga0068861_1000019272 432
459 3300005834 Ga0068851_10000087 Ga0068851_1000008725 432
460 3300005840 Ga0068870_10000010 Ga0068870_1000001041 432
461 3300005841 Ga0068863_100003111 Ga0068863_1000031112 432
462 3300005841 Ga0068863_100089591 Ga0068863_1000895912 432
463 3300005842 Ga0068858_100029973 Ga0068858_1000299732 432
464 3300005842 Ga0068858_100153064 Ga0068858_1001530642 432
465 3300005843 Ga0068860_100004645 Ga0068860_1000046459 432
466 3300005843 Ga0068860_100006973 Ga0068860_1000069736 432
467 3300005844 Ga0068862_100005088 Ga0068862_1000050887 432
468 3300005983 Ga0081540_1000028 Ga0081540_100002835 432
469 3300005983 Ga0081540_1004263 Ga0081540_10042638 432
470 3300005983 Ga0081540_1004897 Ga0081540_10048974 432
471 3300005985 Ga0081539_10000117 Ga0081539_1000011780 432
472 3300006028 Ga0070717_10001145 Ga0070717_1000114513 432
473 3300006028 Ga0070717_10126897 Ga0070717_101268972 432
474 3300006175 Ga0070712_100002713 Ga0070712_1000027133 432
475 3300006175 Ga0070712_100040466 Ga0070712_1000404663 432
476 3300006175 Ga0070712_100090032 Ga0070712_1000900322 432
477 3300006237 Ga0097621_100146682 Ga0097621_1001466822 432
478 3300006358 Ga0068871_100000372 Ga0068871_10000037226 432
479 3300006358 Ga0068871_100008233 Ga0068871_1000082333 432
480 3300006881 Ga0068865_100000443 Ga0068865_1000004435 432
481 3300006931 Ga0097620_100008970 Ga0097620_1000089703 432
482 3300006931 Ga0097620_100009047 Ga0097620_1000090473 432
483 3300006931 Ga0097620_100077427 Ga0097620_1000774272 432
484 3300009093 Ga0105240_10001500 Ga0105240_1000150028 432
485 3300009093 Ga0105240_10084709 Ga0105240_100847092 432
486 3300009098 Ga0105245_10001175 Ga0105245_1000117514 432
487 3300009101 Ga0105247_10000294 Ga0105247_1000029412 432
488 3300009148 Ga0105243_10024991 Ga0105243_100249915 432
489 3300009174 Ga0105241_10000385 Ga0105241_1000038516 432
490 3300009176 Ga0105242_10002033 Ga0105242_100020336 432
491 3300009176 Ga0105242_10036907 Ga0105242_100369073 432
492 3300009177 Ga0105248_10002626 Ga0105248_1000262614 432
493 3300009177 Ga0105248_10142827 Ga0105248_101428272 432
494 3300009545 Ga0105237_10000241 Ga0105237_1000024123 432
495 3300009551 Ga0105238_10001527 Ga0105238_1000152717 432
496 3300009553 Ga0105249_10000108 Ga0105249_1000010840 432
497 3300010375 Ga0105239_10000460 Ga0105239_100004603 432
498 3300013100 Ga0157373_10000334 Ga0157373_100003348 432
499 3300013102 Ga0157371_10000339 Ga0157371_1000033918 432
500 3300013104 Ga0157370_10001811 Ga0157370_1000181111 432
501 3300013104 Ga0157370_10012404 Ga0157370_100124046 432
502 3300013104 Ga0157370_10086115 Ga0157370_100861152 432
503 3300013104 Ga0157370_10118707 Ga0157370_101187072 432
504 3300013105 Ga0157369_10003465 Ga0157369_100034654 432
505 3300013105 Ga0157369_10065912 Ga0157369_100659124 432
506 3300013105 Ga0157369_10384568 Ga0157369_103845681 432
507 3300013296 Ga0157374_10004438 Ga0157374_100044386 432
508 3300013296 Ga0157374_10010816 Ga0157374_100108164 432
509 3300013297 Ga0157378_10008775 Ga0157378_100087754 432
510 3300013306 Ga0163162_10001852 Ga0163162_1000185214 432
511 3300013306 Ga0163162_10158783 Ga0163162_101587832 432
512 3300013307 Ga0157372_10005124 Ga0157372_100051247 432
513 3300013307 Ga0157372_10008965 Ga0157372_100089656 432
514 3300013307 Ga0157372_10024235 Ga0157372_100242356 432
515 3300013307 Ga0157372_10034585 Ga0157372_100345855 432
516 3300013307 Ga0157372_10042326 Ga0157372_100423262 432
517 3300013307 Ga0157372_10153341 Ga0157372_101533412 432
518 3300013308 Ga0157375_10007017 Ga0157375_100070177 432
519 3300013308 Ga0157375_10012614 Ga0157375_100126145 432
520 3300013308 Ga0157375_10194506 Ga0157375_101945062 432
521 3300014325 Ga0163163_10001552 Ga0163163_1000155213 432
522 3300014745 Ga0157377_10000943 Ga0157377_100009439 432
523 3300014968 Ga0157379_10006486 Ga0157379_100064866 432
524 3300014969 Ga0157376_10000302 Ga0157376_100003024 432
525 3300025315 Ga0207697_10000031 Ga0207697_100000319 432
526 3300025321 Ga0207656_10000229 Ga0207656_100002294 432
527 3300025893 Ga0207682_10000628 Ga0207682_1000062817 432
528 3300025899 Ga0207642_10001538 Ga0207642_100015385 432
529 3300025901 Ga0207688_10000133 Ga0207688_1000013322 432
530 3300025903 Ga0207680_10000498 Ga0207680_1000049813 432
531 3300025903 Ga0207680_10040808 Ga0207680_100408082 432
532 3300025904 Ga0207647_10000946 Ga0207647_1000094618 432
533 3300025906 Ga0207699_10004378 Ga0207699_100043783 432
534 3300025907 Ga0207645_10000018 Ga0207645_1000001892 432
535 3300025907 Ga0207645_10018407 Ga0207645_100184073 432
536 3300025908 Ga0207643_10000016 Ga0207643_1000001682 432
537 3300025911 Ga0207654_10003392 Ga0207654_100033922 432
538 3300025912 Ga0207707_10005137 Ga0207707_100051378 432
539 3300025912 Ga0207707_10005977 Ga0207707_100059772 432
540 3300025912 Ga0207707_10031573 Ga0207707_100315732 432
541 3300025913 Ga0207695_10002148 Ga0207695_1000214828 432
542 3300025913 Ga0207695_10006902 Ga0207695_100069026 432
543 3300025913 Ga0207695_10009399 Ga0207695_100093999 432
544 3300025913 Ga0207695_10027659 Ga0207695_100276596 432
545 3300025915 Ga0207693_10006217 Ga0207693_100062176 432
546 3300025915 Ga0207693_10026008 Ga0207693_100260083 432
547 3300025916 Ga0207663_10023330 Ga0207663_100233302 432
548 3300025917 Ga0207660_10000129 Ga0207660_100001292 432
549 3300025917 Ga0207660_10009073 Ga0207660_100090733 432
550 3300025917 Ga0207660_10016232 Ga0207660_100162322 432
551 3300025918 Ga0207662_10000003 Ga0207662_1000000314 432
552 3300025918 Ga0207662_10164173 Ga0207662_101641731 432
553 3300025919 Ga0207657_10000009 Ga0207657_10000009107 432
554 3300025920 Ga0207649_10003124 Ga0207649_100031242 432
555 3300025920 Ga0207649_10005920 Ga0207649_100059203 432
556 3300025921 Ga0207652_10004436 Ga0207652_100044366 432
557 3300025921 Ga0207652_10010020 Ga0207652_100100206 432
558 3300025921 Ga0207652_10015304 Ga0207652_100153042 432
559 3300025921 Ga0207652_10032860 Ga0207652_100328604 432
560 3300025921 Ga0207652_10096122 Ga0207652_100961222 432
561 3300025923 Ga0207681_10001341 Ga0207681_100013415 432
562 3300025924 Ga0207694_10098704 Ga0207694_100987042 432
563 3300025925 Ga0207650_10000753 Ga0207650_1000075314 432
564 3300025926 Ga0207659_10000475 Ga0207659_1000047514 432
565 3300025926 Ga0207659_10006307 Ga0207659_100063072 432
566 3300025927 Ga0207687_10009050 Ga0207687_100090505 432
567 3300025927 Ga0207687_10018208 Ga0207687_100182082 432
568 3300025927 Ga0207687_10024394 Ga0207687_100243943 432
569 3300025928 Ga0207700_10000760 Ga0207700_1000076010 432
570 3300025928 Ga0207700_10068231 Ga0207700_100682311 432
571 3300025929 Ga0207664_10014424 Ga0207664_100144243 432
572 3300025929 Ga0207664_10028641 Ga0207664_100286413 432
573 3300025931 Ga0207644_10000263 Ga0207644_1000026323 432
574 3300025932 Ga0207690_10014702 Ga0207690_100147023 432
575 3300025933 Ga0207706_10000060 Ga0207706_100000603 432
576 3300025933 Ga0207706_10024342 Ga0207706_100243423 432
577 3300025934 Ga0207686_10021964 Ga0207686_100219642 432
578 3300025934 Ga0207686_10072883 Ga0207686_100728832 432
579 3300025934 Ga0207686_10131864 Ga0207686_101318642 432
580 3300025935 Ga0207709_10002843 Ga0207709_100028436 432
581 3300025936 Ga0207670_10000415 Ga0207670_1000041510 432
582 3300025937 Ga0207669_10000464 Ga0207669_1000046414 432
583 3300025937 Ga0207669_10050863 Ga0207669_100508632 432
584 3300025938 Ga0207704_10000030 Ga0207704_1000003092 432
585 3300025938 Ga0207704_10060293 Ga0207704_100602932 432
586 3300025940 Ga0207691_10000730 Ga0207691_1000073028 432
587 3300025941 Ga0207711_10000070 Ga0207711_1000007040 432
588 3300025941 Ga0207711_10002627 Ga0207711_100026279 432
589 3300025942 Ga0207689_10000010 Ga0207689_10000010106 432
590 3300025942 Ga0207689_10001483 Ga0207689_100014833 432
591 3300025942 Ga0207689_10023570 Ga0207689_100235704 432
592 3300025944 Ga0207661_10000893 Ga0207661_1000089317 432
593 3300025944 Ga0207661_10001424 Ga0207661_100014246 432
594 3300025944 Ga0207661_10008737 Ga0207661_100087375 432
595 3300025944 Ga0207661_10013561 Ga0207661_100135612 432
596 3300025944 Ga0207661_10055177 Ga0207661_100551771 432
597 3300025944 Ga0207661_10111930 Ga0207661_101119302 432
598 3300025945 Ga0207679_10000437 Ga0207679_1000043714 432
599 3300025945 Ga0207679_10000556 Ga0207679_1000055610 432
600 3300025945 Ga0207679_10000797 Ga0207679_100007975 432
601 3300025949 Ga0207667_10000724 Ga0207667_100007243 432
602 3300025949 Ga0207667_10040834 Ga0207667_100408342 432
603 3300025960 Ga0207651_10000030 Ga0207651_1000003020 432
604 3300025961 Ga0207712_10003196 Ga0207712_100031966 432
605 3300025972 Ga0207668_10119940 Ga0207668_101199402 432
606 3300025981 Ga0207640_10000534 Ga0207640_1000053418 432
607 3300025986 Ga0207658_10000141 Ga0207658_1000014155 432
608 3300026023 Ga0207677_10000028 Ga0207677_1000002837 432
609 3300026023 Ga0207677_10117185 Ga0207677_101171852 432
610 3300026035 Ga0207703_10000398 Ga0207703_100003985 432
611 3300026035 Ga0207703_10075055 Ga0207703_100750552 432
612 3300026067 Ga0207678_10000569 Ga0207678_1000056929 432
613 3300026078 Ga0207702_10038901 Ga0207702_100389013 432
614 3300026078 Ga0207702_10059924 Ga0207702_100599242 432
615 3300026078 Ga0207702_10102066 Ga0207702_101020662 432
616 3300026088 Ga0207641_10007555 Ga0207641_100075557 432
617 3300026088 Ga0207641_10008391 Ga0207641_100083912 432
618 3300026089 Ga0207648_10000035 Ga0207648_10000035106 432
619 3300026089 Ga0207648_10106533 Ga0207648_101065332 432
620 3300026095 Ga0207676_10001507 Ga0207676_1000150712 432
621 3300026095 Ga0207676_10003424 Ga0207676_100034245 432
622 3300026116 Ga0207674_10000103 Ga0207674_1000010318 432
623 3300026116 Ga0207674_10000662 Ga0207674_1000066227 432
624 3300026116 Ga0207674_10069167 Ga0207674_100691672 432
625 3300026118 Ga0207675_100000899 Ga0207675_10000089920 432
626 3300026121 Ga0207683_10000609 Ga0207683_1000060922 432
627 3300026142 Ga0207698_10002469 Ga0207698_100024696 432
628 3300028379 Ga0268266_10000155 Ga0268266_100001559 432
629 3300028380 Ga0268265_10000411 Ga0268265_100004114 432
630 3300028380 Ga0268265_10013433 Ga0268265_100134332 432
631 3300028381 Ga0268264_10000173 Ga0268264_1000017364 432
632 3300031548 Ga0307408_100006250 Ga0307408_1000062504 432
633 3300031731 Ga0307405_10004716 Ga0307405_100047164 432
634 3300031852 Ga0307410_10010167 Ga0307410_100101672 432
635 3300031901 Ga0307406_10076174 Ga0307406_100761742 432
636 3300031903 Ga0307407_10002572 Ga0307407_100025724 432
637 3300031911 Ga0307412_10003215 Ga0307412_100032154 432
638 3300031995 Ga0307409_100009419 Ga0307409_1000094194 432
639 3300031995 Ga0307409_100247778 Ga0307409_1002477782 432
640 3300032002 Ga0307416_100254044 Ga0307416_1002540442 432
641 3300032004 Ga0307414_10011379 Ga0307414_100113793 432
642 3300032005 Ga0307411_10020673 Ga0307411_100206731 432
643 3300032005 Ga0307411_10141457 Ga0307411_101414572 432
644 3300032126 Ga0307415_100038385 Ga0307415_1000383852 432
645 3300035086 Ga0373934_0000406 Ga0373934_0000406_2695_3993 432
646 3300035089 Ga0373944_0000786 Ga0373944_0000786_5050_6351 432
647 3300035111 Ga0373923_0037835 Ga0373923_0037835_413_1711 432
648 3300035116 Ga0373945_0019809 Ga0373945_0019809_336_1637 432
649 3300035117 Ga0373953_0020877 Ga0373953_0020877_1141_2439 432
650 3300035119 Ga0373956_0001700 Ga0373956_0001700_3385_4683 432
651 3300035120 Ga0373957_0020572 Ga0373957_0020572_379_1677 432
652 3300035170 Ga0373943_0000721 Ga0373943_0000721_7285_8586 432
653 3300035170 Ga0373943_0016784 Ga0373943_0016784_1385_2683 432
654 3300035171 Ga0373946_0001214 Ga0373946_0001214_3577_4878 432
655 3300035172 Ga0373955_0000275 Ga0373955_0000275_1681_2979 432
656 3300035410 Ga0373924_0017161 Ga0373924_0017161_1138_2436 432
657 3300035692 Ga0373935_0001458 Ga0373935_0001458_5725_7026 432
658 3300035695 Ga0373927_0009458 Ga0373927_0009458_1355_2656 432
659 3300035724 Ga0373933_0000048 Ga0373933_0000048_52868_54166 432
660 3300035725 Ga0373947_0000223 Ga0373947_0000223_22063_23364 432
661 3300035725 Ga0373947_0006114 Ga0373947_0006114_3169_4467 432
662 3300036401 Ga0373937_0000209 Ga0373937_0000209_44790_46088 432
663 3300037068 Ga0373925_0000664 Ga0373925_0000664_25665_26966 432
664 3300037068 Ga0373925_0006996 Ga0373925_0006996_5970_7268 432
665 3300037068 Ga0373925_0032095 Ga0373925_0032095_1118_2428 432
666 3300042005 Ga0439448_0004144 Ga0439448_0004144_1359_2666 432
667 3300044684 Ga0466966_0034702 Ga0466966_0034702_1826_3127 432
668 3300044694 Ga0466963_0109730 Ga0466963_0109730_404_1705 432
669 3300045049 Ga0466959_0022027 Ga0466959_0022027_3353_4654 432
670 3300045051 Ga0451576_0017396 Ga0451576_0017396_3185_4489 432
671 3300045836 Ga0466958_0012289 Ga0466958_0012289_3076_4377 432
672 3300046454 Ga0495592_0059430 Ga0495592_0059430_713_2011 432
673 3300046455 Ga0495603_0012900 Ga0495603_0012900_2603_3904 432
674 3300046459 Ga0495629_0002789 Ga0495629_0002789_5439_6740 432
675 3300046459 Ga0495629_0006310 Ga0495629_0006310_4866_6164 432
676 3300046459 Ga0495629_0010889 Ga0495629_0010889_1202_2500 432
677 3300046462 Ga0495651_0003268 Ga0495651_0003268_8225_9523 432
678 3300046463 Ga0495653_0000050 Ga0495653_0000050_7972_9270 432
679 3300046472 Ga0495580_0000935 Ga0495580_0000935_17045_18346 432
680 3300046473 Ga0495582_0000796 Ga0495582_0000796_5214_6515 432
681 3300046473 Ga0495582_0003621 Ga0495582_0003621_4470_5768 432
682 3300046475 Ga0495639_0002003 Ga0495639_0002003_1430_2731 432
683 3300046477 Ga0495664_0157435 Ga0495664_0157435_35_1333 432
684 3300046499 Ga0495594_0016379 Ga0495594_0016379_2457_3755 432
685 3300046511 Ga0495608_0000216 Ga0495608_0000216_36860_38158 432
686 3300046514 Ga0495618_0053917 Ga0495618_0053917_195_1493 432
687 3300046516 Ga0495628_0000654 Ga0495628_0000654_5619_6917 432
688 3300046517 Ga0495630_0001528 Ga0495630_0001528_11141_12442 432
689 3300046517 Ga0495630_0002012 Ga0495630_0002012_11890_13188 432
690 3300046517 Ga0495630_0002364 Ga0495630_0002364_8243_9541 432
691 3300046529 Ga0495652_0001059 Ga0495652_0001059_28860_30158 432
692 3300046531 Ga0495665_0000260 Ga0495665_0000260_8328_9629 432
693 3300046531 Ga0495665_0038683 Ga0495665_0038683_328_1626 432
694 3300046531 Ga0495665_0048766 Ga0495665_0048766_15_1313 432
695 3300046535 Ga0495586_0002347 Ga0495586_0002347_3395_4693 432
696 3300046535 Ga0495586_0013632 Ga0495586_0013632_1121_2419 432
697 3300046536 Ga0495587_0000660 Ga0495587_0000660_4041_5339 432
698 3300046543 Ga0495645_0000292 Ga0495645_0000292_11733_13031 432
699 3300046559 Ga0495667_0000609 Ga0495667_0000609_6867_8165 432
700 3300046663 Ga0495635_0003779 Ga0495635_0003779_6831_8129 432
701 3300046674 Ga0495588_0001715 Ga0495588_0001715_6728_8029 432
702 3300046674 Ga0495588_0057952 Ga0495588_0057952_498_1796 432
703 3300046675 Ga0495657_0000053 Ga0495657_0000053_68361_69659 432
704 3300046678 Ga0495599_0000708 Ga0495599_0000708_1091_2389 432
705 3300046679 Ga0495623_0000158 Ga0495623_0000158_37989_39287 432
706 3300046680 Ga0495646_0001991 Ga0495646_0001991_6099_7397 432
707 3300046683 Ga0495658_0000162 Ga0495658_0000162_21073_22374 432
708 3300046683 Ga0495658_0029677 Ga0495658_0029677_1501_2799 432
709 3300046689 Ga0495613_0012235 Ga0495613_0012235_4224_5525 432
710 3300046809 Ga0495600_0000032 Ga0495600_0000032_67417_68715 432
711 3300047315 Ga0495581_0003113 Ga0495581_0003113_6768_8069 432
712 3300047315 Ga0495581_0019350 Ga0495581_0019350_1834_3132 432
713 3300047317 Ga0495604_0000051 Ga0495604_0000051_90468_91766 432
714 3300047319 Ga0495674_0023758 Ga0495674_0023758_3778_5079 432
715 3300047322 Ga0495680_0004862 Ga0495680_0004862_4564_5862 432
716 3300047444 Ga0495675_0000738 Ga0495675_0000738_4230_5528 432
717 3300047471 Ga0495684_0000929 Ga0495684_0000929_7911_9209 432
718 3300047673 Ga0495593_0000232 Ga0495593_0000232_6381_7682 432
719 3300047673 Ga0495593_0054395 Ga0495593_0054395_784_2082 432
720 3300048088 Ga0495602_0000361 Ga0495602_0000361_23871_25169 432
721 3300048089 Ga0495614_0000185 Ga0495614_0000185_5340_6641 432
722 3300048905 Ga0496102_0001910 Ga0496102_0001910_10368_11675 432
723 3300048909 Ga0496106_0005452 Ga0496106_0005452_2897_4204 432
724 3300048912 Ga0496109_0009339 Ga0496109_0009339_6149_7456 432
725 3300048912 Ga0496109_0021650 Ga0496109_0021650_3454_4752 432
726 3300048915 Ga0496112_0001136 Ga0496112_0001136_16083_17390 432
727 3300048915 Ga0496112_0005795 Ga0496112_0005795_2478_3776 432
728 3300048916 Ga0496113_0006829 Ga0496113_0006829_871_2169 432
729 3300048916 Ga0496113_0020657 Ga0496113_0020657_2439_3746 432
730 3300049570 Ga0501033_0018633 Ga0501033_0018633_1746_3044 432
731 3300049581 Ga0501047_0091808 Ga0501047_0091808_1203_2501 432
732 3300049823 Ga0501044_0034237 Ga0501044_0034237_2203_3501 432
733 3300050513 nmdc:mga0rr50_88619_c1 nmdc:mga0rr50_88619_c1_995_2296 432
734 3300050514 nmdc:mga08x19_101446_c1 nmdc:mga08x19_101446_c1_16_1317 432
735 3300053077 Ga0495601_0006239 Ga0495601_0006239_789_2087 432
736 3300053078 Ga0495612_0002646 Ga0495612_0002646_3883_5181 432
737 3300053084 Ga0495595_0013214 Ga0495595_0013214_1663_2961 432
738 3300053085 Ga0495619_0011346 Ga0495619_0011346_1753_3051 432

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02803

Thiolase_C

Thiolase, C-terminal domain

279

418

0.97

PF00108

Thiolase_N

Thiolase, N-terminal domain

1

272

0.93

PF00109

ketoacyl-synt

Beta-ketoacyl synthase, N-terminal domain

28

143

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4e1l-assembly1.cif.gz_C crystal structure of acetoacetyl-coa thiolase (thla2) from clostridium difficile 0.937 9 431
7n7z-assembly1.cif.gz_A-2 structure of acetyl-coa acetyltransferase from syntrophomonas wolfei 0.9361 9 431
5f38-assembly1.cif.gz_B x-ray crystal structure of a thiolase from escherichia coli at 1.8 a resolution 0.9359 8 432
4n45-assembly1.cif.gz_A crystal structure of reduced form of thiolase from clostridium acetobutylicum 0.9356 8 432
7ei4-assembly1.cif.gz_C crystal structure of masl in complex with a novel covalent inhibitor, collimonin c 0.9347 10 432
ID Description Score Start End Superfamily
5lp7C01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9418 9 298 3.40.47.10
af_P76503_7_435_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9382 8 430 3.40.47.10
5lp7C01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9373 9 298 3.40.47.10
af_A0A096MJY8_281_393_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9326 300 427 3.40.47.10
1dluC01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9318 11 295 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A377LXS3-F1-model_v4 3-ketoacyl-CoA thiolase (EC 2.3.1.16) 0.977 282 430 GO:0003988
GO:0005829
GO:0044281
AF-A0A7S2U634-F1-model_v4 Thiolase N-terminal domain-containing protein 0.9766 5 127 GO:0003985
GO:0005739
GO:0006635
AF-A0A2T2TGQ5-F1-model_v4 acetyl-CoA C-acyltransferase (EC 2.3.1.16) 0.9716 292 432 GO:0003985
GO:0006635
AF-A0A4C3Q699-F1-model_v4 deleted 0.9688 188 432
AF-A0A7V6FD01-F1-model_v4 acetyl-CoA C-acetyltransferase (EC 2.3.1.9) (Acetoacetyl-CoA thiolase) 0.968 13 129 GO:0003985

Feature Viewer

pLDDT pTM Quality
90.29 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map