F478409
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 738 | 310 | 738 | 431 |
Family's Representative Sequence
| Representative Sequence | 3300048918|Ga0496115_0184752|Ga0496115_0184752_35_1294 |
| Length | 419 |
| Sequence | VVAGVRTPFARSGTTLKSLSAIELGKRCVAELIQRSDIDPALVEAVVYGTVVPSVVAPNIAREVSLMPMLPKGVQAFTVGRACASANQAITDAADQIVLGHMDVAIAGGAESLSNVPILHSRGMSDALVAASRAKSFGGRVRALAAVRPRDLVPITPAIAEPTTGESMGESAEKMAKINHIPRDEQDQFALRSHRLAAAGTADGRLTAEIAALYVPPSFDAMTTDNGIRTETSLEALAALKPVFDRKYGTVTAGNSSPLTDGASAVLLMSEERAKTLGYKPMAYIRSYSYAALDPGEQLLMGPVLAAPVALQRAGLTLEQMDLVEMHEAFAAQVLCNLEGFVSQQWAERAGFPKPVGEVDRAKLNVMGGSIAIGHPFGATGGRILTTLCNELVRRDGTFGLMTVCAAGGMGHAMVVERA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 194 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 195 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 197 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 198 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 199 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 200 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 201 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 202 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 203 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 204 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 205 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 206 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 207 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 208 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 210 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 213 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 214 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 215 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 216 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 217 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 220 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 221 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 222 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 223 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 224 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 225 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 228 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 229 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 230 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 231 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 232 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 233 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 234 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 235 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 236 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 237 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 238 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 281 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 282 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 284 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 285 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 286 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 294 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 309 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.86 |
| Metatranscriptomes | 0.14 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.14 |
| Nodule | 0 |
| Rhizoplane | 1.49 |
| Rhizosphere | 98.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10106929 | 3300005290 | Bacteria | 1906 |
| 2 | Ga0065715_10092087 | 3300005293 | Bacteria | 5343 |
| 3 | Ga0070658_10000166 | 3300005327 | Bacteria | 57497 |
| 4 | Ga0070658_10036906 | 3300005327 | Bacteria | 3938 |
| 5 | Ga0070658_10060322 | 3300005327 | Bacteria | 3089 |
| 6 | Ga0070676_10002851 | 3300005328 | Bacteria | 8926 |
| 7 | Ga0070676_10013679 | 3300005328 | Bacteria | 4447 |
| 8 | Ga0070676_10136888 | 3300005328 | Bacteria | 1555 |
| 9 | Ga0070683_100000840 | 3300005329 | Bacteria | 22798 |
| 10 | Ga0070683_100001190 | 3300005329 | Bacteria | 19778 |
| 11 | Ga0070683_100003494 | 3300005329 | Bacteria | 12776 |
| 12 | Ga0070683_100011375 | 3300005329 | Bacteria | 7690 |
| 13 | Ga0070683_100018412 | 3300005329 | Bacteria | 6186 |
| 14 | Ga0070683_100020819 | 3300005329 | Bacteria | 5843 |
| 15 | Ga0070683_100024804 | 3300005329 | Bacteria | 5377 |
| 16 | Ga0070683_100029862 | 3300005329 | Bacteria | 4942 |
| 17 | Ga0070683_100030599 | 3300005329 | Bacteria | 4889 |
| 18 | Ga0070683_100040966 | 3300005329 | Bacteria | 4259 |
| 19 | Ga0070683_100043179 | 3300005329 | Bacteria | 4155 |
| 20 | Ga0070683_100059053 | 3300005329 | Bacteria | 3563 |
| 21 | Ga0070683_100064776 | 3300005329 | Bacteria | 3403 |
| 22 | Ga0070690_100001550 | 3300005330 | Bacteria | 12056 |
| 23 | Ga0070690_100006846 | 3300005330 | Bacteria | 6486 |
| 24 | Ga0070690_100019904 | 3300005330 | Bacteria | 4083 |
| 25 | Ga0070670_100002268 | 3300005331 | Bacteria | 15822 |
| 26 | Ga0070670_100004216 | 3300005331 | Bacteria | 12033 |
| 27 | Ga0070670_100007292 | 3300005331 | Bacteria | 9378 |
| 28 | Ga0070670_100013366 | 3300005331 | Bacteria | 7032 |
| 29 | Ga0070677_10000071 | 3300005333 | Bacteria | 31922 |
| 30 | Ga0068869_100000780 | 3300005334 | Bacteria | 18149 |
| 31 | Ga0068869_100002264 | 3300005334 | Bacteria | 11583 |
| 32 | Ga0068869_100062216 | 3300005334 | Bacteria | 2739 |
| 33 | Ga0068869_100187903 | 3300005334 | Unclassified | 1623 |
| 34 | Ga0070666_10000097 | 3300005335 | Bacteria | 60322 |
| 35 | Ga0070666_10055636 | 3300005335 | Bacteria | 2671 |
| 36 | Ga0070680_100000029 | 3300005336 | Bacteria | 74849 |
| 37 | Ga0070680_100001042 | 3300005336 | Bacteria | 19845 |
| 38 | Ga0070680_100007064 | 3300005336 | Bacteria | 8559 |
| 39 | Ga0070680_100033261 | 3300005336 | Bacteria | 4154 |
| 40 | Ga0070680_100101533 | 3300005336 | Bacteria | 2388 |
| 41 | Ga0070680_100135966 | 3300005336 | Bacteria | 2059 |
| 42 | Ga0070680_100213912 | 3300005336 | Bacteria | 1626 |
| 43 | Ga0070682_100000267 | 3300005337 | Bacteria | 37543 |
| 44 | Ga0070682_100005576 | 3300005337 | Bacteria | 7012 |
| 45 | Ga0068868_100005293 | 3300005338 | Bacteria | 9067 |
| 46 | Ga0068868_100020403 | 3300005338 | Bacteria | 4978 |
| 47 | Ga0070660_100000067 | 3300005339 | Bacteria | 61507 |
| 48 | Ga0070689_100003026 | 3300005340 | Bacteria | 11069 |
| 49 | Ga0070691_10013881 | 3300005341 | Bacteria | 3698 |
| 50 | Ga0070691_10029644 | 3300005341 | Bacteria | 2561 |
| 51 | Ga0070687_100000198 | 3300005343 | Bacteria | 21075 |
| 52 | Ga0070687_100034619 | 3300005343 | Bacteria | 2501 |
| 53 | Ga0070661_100000128 | 3300005344 | Bacteria | 63056 |
| 54 | Ga0070661_100005764 | 3300005344 | Bacteria | 8525 |
| 55 | Ga0070661_100049598 | 3300005344 | Bacteria | 3073 |
| 56 | Ga0070692_10003001 | 3300005345 | Bacteria | 6720 |
| 57 | Ga0070692_10003133 | 3300005345 | Bacteria | 6633 |
| 58 | Ga0070692_10004898 | 3300005345 | Bacteria | 5638 |
| 59 | Ga0070692_10033554 | 3300005345 | Bacteria | 2587 |
| 60 | Ga0070668_100000722 | 3300005347 | Bacteria | 22643 |
| 61 | Ga0070668_100033892 | 3300005347 | Bacteria | 3891 |
| 62 | Ga0070669_100002720 | 3300005353 | Bacteria | 12756 |
| 63 | Ga0070669_100020213 | 3300005353 | Bacteria | 4756 |
| 64 | Ga0070675_100004896 | 3300005354 | Bacteria | 10216 |
| 65 | Ga0070675_100028806 | 3300005354 | Bacteria | 4473 |
| 66 | Ga0070675_100044069 | 3300005354 | Bacteria | 3648 |
| 67 | Ga0070671_100000220 | 3300005355 | Bacteria | 38135 |
| 68 | Ga0070671_100017231 | 3300005355 | Bacteria | 5849 |
| 69 | Ga0070671_100083292 | 3300005355 | Bacteria | 2674 |
| 70 | Ga0070674_100000044 | 3300005356 | Bacteria | 54252 |
| 71 | Ga0070674_100027636 | 3300005356 | Bacteria | 3719 |
| 72 | Ga0070673_100003373 | 3300005364 | Bacteria | 9941 |
| 73 | Ga0070673_100063154 | 3300005364 | Bacteria | 2946 |
| 74 | Ga0070673_100064942 | 3300005364 | Bacteria | 2909 |
| 75 | Ga0070673_100145166 | 3300005364 | Bacteria | 2005 |
| 76 | Ga0070688_100000044 | 3300005365 | Bacteria | 59408 |
| 77 | Ga0070688_100068137 | 3300005365 | Bacteria | 2269 |
| 78 | Ga0070688_100074997 | 3300005365 | Bacteria | 2173 |
| 79 | Ga0070659_100000229 | 3300005366 | Bacteria | 43553 |
| 80 | Ga0070659_100015698 | 3300005366 | Bacteria | 5673 |
| 81 | Ga0070659_100046505 | 3300005366 | Bacteria | 3401 |
| 82 | Ga0070659_100051941 | 3300005366 | Bacteria | 3223 |
| 83 | Ga0070659_100150967 | 3300005366 | Bacteria | 1895 |
| 84 | Ga0070667_100004188 | 3300005367 | Bacteria | 12177 |
| 85 | Ga0070667_100070035 | 3300005367 | Bacteria | 2985 |
| 86 | Ga0070667_100088304 | 3300005367 | Bacteria | 2662 |
| 87 | Ga0070709_10001251 | 3300005434 | Bacteria | 13900 |
| 88 | Ga0070709_10003655 | 3300005434 | Bacteria | 8255 |
| 89 | Ga0070709_10007521 | 3300005434 | Bacteria | 5975 |
| 90 | Ga0070709_10093178 | 3300005434 | Unclassified | 1991 |
| 91 | Ga0070714_100004158 | 3300005435 | Bacteria | 10882 |
| 92 | Ga0070714_100004610 | 3300005435 | Bacteria | 10394 |
| 93 | Ga0070714_100113634 | 3300005435 | Bacteria | 2401 |
| 94 | Ga0070713_100000083 | 3300005436 | Bacteria | 59579 |
| 95 | Ga0070713_100022861 | 3300005436 | Bacteria | 4840 |
| 96 | Ga0070713_100083422 | 3300005436 | Bacteria | 2732 |
| 97 | Ga0070710_10007381 | 3300005437 | Bacteria | 5323 |
| 98 | Ga0070701_10007300 | 3300005438 | Bacteria | 4709 |
| 99 | Ga0070701_10036359 | 3300005438 | Bacteria | 2481 |
| 100 | Ga0070711_100065685 | 3300005439 | Bacteria | 2539 |
| 101 | Ga0070705_100000744 | 3300005440 | Bacteria | 18503 |
| 102 | Ga0070700_100000875 | 3300005441 | Bacteria | 14828 |
| 103 | Ga0070694_100017525 | 3300005444 | Bacteria | 4527 |
| 104 | Ga0070708_100000022 | 3300005445 | Bacteria | 113297 |
| 105 | Ga0070708_100000139 | 3300005445 | Bacteria | 49545 |
| 106 | Ga0070708_100008240 | 3300005445 | Bacteria | 8367 |
| 107 | Ga0070663_100000778 | 3300005455 | Bacteria | 17375 |
| 108 | Ga0070663_100010266 | 3300005455 | Bacteria | 5833 |
| 109 | Ga0070663_100021684 | 3300005455 | Bacteria | 4278 |
| 110 | Ga0070678_100006739 | 3300005456 | Bacteria | 6766 |
| 111 | Ga0070662_100000605 | 3300005457 | Bacteria | 21915 |
| 112 | Ga0070662_100002381 | 3300005457 | Bacteria | 11551 |
| 113 | Ga0070662_100006891 | 3300005457 | Bacteria | 7353 |
| 114 | Ga0070662_100024423 | 3300005457 | Bacteria | 4164 |
| 115 | Ga0070662_100042548 | 3300005457 | Bacteria | 3245 |
| 116 | Ga0070681_10002316 | 3300005458 | Bacteria | 17414 |
| 117 | Ga0070681_10012221 | 3300005458 | Bacteria | 8513 |
| 118 | Ga0070681_10030340 | 3300005458 | Bacteria | 5425 |
| 119 | Ga0070681_10035028 | 3300005458 | Bacteria | 5042 |
| 120 | Ga0070681_10042584 | 3300005458 | Bacteria | 4550 |
| 121 | Ga0070681_10067574 | 3300005458 | Bacteria | 3542 |
| 122 | Ga0070681_10087855 | 3300005458 | Bacteria | 3061 |
| 123 | Ga0070681_10198078 | 3300005458 | Bacteria | 1927 |
| 124 | Ga0068867_100000374 | 3300005459 | Bacteria | 29764 |
| 125 | Ga0068867_100021149 | 3300005459 | Bacteria | 4640 |
| 126 | Ga0068867_100066352 | 3300005459 | Bacteria | 2688 |
| 127 | Ga0070685_10001857 | 3300005466 | Bacteria | 11023 |
| 128 | Ga0070685_10057799 | 3300005466 | Bacteria | 2258 |
| 129 | Ga0070685_10060769 | 3300005466 | Bacteria | 2210 |
| 130 | Ga0070706_100010853 | 3300005467 | Bacteria | 8457 |
| 131 | Ga0070706_100114211 | 3300005467 | Bacteria | 2514 |
| 132 | Ga0070706_100118069 | 3300005467 | Bacteria | 2471 |
| 133 | Ga0070706_100149376 | 3300005467 | Bacteria | 2181 |
| 134 | Ga0070707_100005971 | 3300005468 | Bacteria | 11359 |
| 135 | Ga0070707_100017042 | 3300005468 | Bacteria | 6823 |
| 136 | Ga0070707_100110990 | 3300005468 | Bacteria | 2659 |
| 137 | Ga0070698_100006397 | 3300005471 | Bacteria | 12786 |
| 138 | Ga0070699_100026189 | 3300005518 | Bacteria | 5031 |
| 139 | Ga0070679_100003800 | 3300005530 | Bacteria | 13856 |
| 140 | Ga0070679_100004212 | 3300005530 | Bacteria | 13270 |
| 141 | Ga0070679_100009491 | 3300005530 | Bacteria | 9203 |
| 142 | Ga0070679_100036071 | 3300005530 | Bacteria | 4907 |
| 143 | Ga0070679_100091841 | 3300005530 | Bacteria | 3023 |
| 144 | Ga0070684_100000724 | 3300005535 | Bacteria | 22861 |
| 145 | Ga0070684_100009448 | 3300005535 | Bacteria | 7681 |
| 146 | Ga0070684_100011073 | 3300005535 | Bacteria | 7174 |
| 147 | Ga0070684_100021592 | 3300005535 | Bacteria | 5361 |
| 148 | Ga0070684_100035783 | 3300005535 | Bacteria | 4252 |
| 149 | Ga0070684_100036823 | 3300005535 | Bacteria | 4194 |
| 150 | Ga0070684_100087122 | 3300005535 | Bacteria | 2772 |
| 151 | Ga0070684_100250719 | 3300005535 | Bacteria | 1618 |
| 152 | Ga0068853_100002054 | 3300005539 | Bacteria | 14918 |
| 153 | Ga0068853_100004237 | 3300005539 | Bacteria | 11073 |
| 154 | Ga0070672_100001374 | 3300005543 | Bacteria | 15030 |
| 155 | Ga0070672_100002312 | 3300005543 | Bacteria | 12033 |
| 156 | Ga0070672_100100153 | 3300005543 | Bacteria | 2350 |
| 157 | Ga0070672_100105327 | 3300005543 | Bacteria | 2293 |
| 158 | Ga0070686_100000729 | 3300005544 | Bacteria | 19130 |
| 159 | Ga0070686_100025631 | 3300005544 | Bacteria | 3550 |
| 160 | Ga0070695_100003661 | 3300005545 | Bacteria | 8954 |
| 161 | Ga0070695_100004307 | 3300005545 | Bacteria | 8336 |
| 162 | Ga0070695_100005560 | 3300005545 | Bacteria | 7421 |
| 163 | Ga0070695_100057931 | 3300005545 | Unclassified | 2504 |
| 164 | Ga0070696_100007618 | 3300005546 | Bacteria | 7233 |
| 165 | Ga0070696_100078926 | 3300005546 | Bacteria | 2328 |
| 166 | Ga0070693_100001377 | 3300005547 | Bacteria | 10950 |
| 167 | Ga0070693_100004527 | 3300005547 | Bacteria | 6584 |
| 168 | Ga0070693_100007591 | 3300005547 | Bacteria | 5308 |
| 169 | Ga0070693_100021015 | 3300005547 | Bacteria | 3452 |
| 170 | Ga0070665_100013592 | 3300005548 | Bacteria | 8189 |
| 171 | Ga0070665_100023382 | 3300005548 | Bacteria | 6222 |
| 172 | Ga0070665_100066535 | 3300005548 | Bacteria | 3615 |
| 173 | Ga0068855_100022889 | 3300005563 | Bacteria | 7488 |
| 174 | Ga0068855_100024702 | 3300005563 | Bacteria | 7189 |
| 175 | Ga0068855_100044497 | 3300005563 | Bacteria | 5253 |
| 176 | Ga0068855_100154310 | 3300005563 | Bacteria | 2610 |
| 177 | Ga0068855_100299484 | 3300005563 | Bacteria | 1781 |
| 178 | Ga0068855_100402401 | 3300005563 | Bacteria | 1500 |
| 179 | Ga0070664_100000286 | 3300005564 | Bacteria | 36492 |
| 180 | Ga0070664_100001112 | 3300005564 | Bacteria | 21281 |
| 181 | Ga0070664_100021581 | 3300005564 | Bacteria | 5310 |
| 182 | Ga0070664_100087554 | 3300005564 | Bacteria | 2693 |
| 183 | Ga0068857_100000087 | 3300005577 | Bacteria | 53140 |
| 184 | Ga0068857_100002913 | 3300005577 | Bacteria | 14100 |
| 185 | Ga0068857_100012716 | 3300005577 | Bacteria | 7336 |
| 186 | Ga0068854_100000147 | 3300005578 | Bacteria | 48950 |
| 187 | Ga0068854_100017181 | 3300005578 | Bacteria | 4837 |
| 188 | Ga0068856_100003321 | 3300005614 | Bacteria | 16345 |
| 189 | Ga0068856_100018762 | 3300005614 | Bacteria | 6707 |
| 190 | Ga0068856_100024998 | 3300005614 | Bacteria | 5820 |
| 191 | Ga0068856_100128508 | 3300005614 | Bacteria | 2538 |
| 192 | Ga0070702_100016583 | 3300005615 | Bacteria | 3781 |
| 193 | Ga0068852_100000090 | 3300005616 | Bacteria | 64065 |
| 194 | Ga0068852_100011704 | 3300005616 | Bacteria | 6620 |
| 195 | Ga0068852_100041771 | 3300005616 | Bacteria | 3878 |
| 196 | Ga0068859_100008970 | 3300005617 | Bacteria | 10101 |
| 197 | Ga0068859_100009049 | 3300005617 | Bacteria | 10061 |
| 198 | Ga0068859_100031183 | 3300005617 | Bacteria | 5351 |
| 199 | Ga0068859_100077425 | 3300005617 | Bacteria | 3366 |
| 200 | Ga0068864_100001384 | 3300005618 | Bacteria | 20120 |
| 201 | Ga0068864_100006808 | 3300005618 | Bacteria | 9363 |
| 202 | Ga0068866_10000067 | 3300005718 | Bacteria | 41179 |
| 203 | Ga0068861_100001927 | 3300005719 | Bacteria | 13360 |
| 204 | Ga0068861_100018807 | 3300005719 | Bacteria | 4925 |
| 205 | Ga0068851_10000087 | 3300005834 | Bacteria | 51670 |
| 206 | Ga0068870_10000010 | 3300005840 | Bacteria | 70177 |
| 207 | Ga0068863_100003111 | 3300005841 | Bacteria | 16374 |
| 208 | Ga0068863_100089591 | 3300005841 | Bacteria | 2917 |
| 209 | Ga0068858_100029973 | 3300005842 | Bacteria | 5053 |
| 210 | Ga0068858_100153064 | 3300005842 | Bacteria | 2169 |
| 211 | Ga0068858_100176087 | 3300005842 | Bacteria | 2018 |
| 212 | Ga0068860_100001521 | 3300005843 | Bacteria | 24972 |
| 213 | Ga0068860_100004645 | 3300005843 | Bacteria | 14025 |
| 214 | Ga0068860_100006973 | 3300005843 | Bacteria | 11323 |
| 215 | Ga0068860_100023389 | 3300005843 | Bacteria | 5971 |
| 216 | Ga0068862_100004857 | 3300005844 | Bacteria | 11314 |
| 217 | Ga0068862_100005088 | 3300005844 | Bacteria | 11069 |
| 218 | Ga0081540_1000028 | 3300005983 | Bacteria | 150331 |
| 219 | Ga0081540_1004263 | 3300005983 | Bacteria | 10978 |
| 220 | Ga0081540_1004897 | 3300005983 | Bacteria | 10084 |
| 221 | Ga0081539_10000117 | 3300005985 | Bacteria | 185868 |
| 222 | Ga0070717_10001145 | 3300006028 | Bacteria | 17915 |
| 223 | Ga0070717_10126897 | 3300006028 | Bacteria | 2191 |
| 224 | Ga0070716_100029020 | 3300006173 | Bacteria | 2986 |
| 225 | Ga0070712_100002713 | 3300006175 | Bacteria | 10929 |
| 226 | Ga0070712_100010127 | 3300006175 | Bacteria | 5941 |
| 227 | Ga0070712_100040466 | 3300006175 | Unclassified | 3195 |
| 228 | Ga0070712_100090032 | 3300006175 | Bacteria | 2246 |
| 229 | Ga0097621_100146682 | 3300006237 | Unclassified | 2021 |
| 230 | Ga0068871_100000372 | 3300006358 | Bacteria | 31379 |
| 231 | Ga0068871_100008233 | 3300006358 | Bacteria | 7493 |
| 232 | Ga0075428_100033012 | 3300006844 | Bacteria | 5716 |
| 233 | Ga0075430_100001641 | 3300006846 | Bacteria | 18285 |
| 234 | Ga0075430_100068240 | 3300006846 | Bacteria | 2983 |
| 235 | Ga0075430_100102745 | 3300006846 | Bacteria | 2386 |
| 236 | Ga0075431_100017519 | 3300006847 | Bacteria | 7281 |
| 237 | Ga0075431_100030727 | 3300006847 | Bacteria | 5533 |
| 238 | Ga0075431_100030750 | 3300006847 | Bacteria | 5532 |
| 239 | Ga0075431_100041568 | 3300006847 | Bacteria | 4740 |
| 240 | Ga0075431_100050283 | 3300006847 | Bacteria | 4298 |
| 241 | Ga0075431_100075870 | 3300006847 | Bacteria | 3469 |
| 242 | Ga0075433_10013413 | 3300006852 | Bacteria | 6663 |
| 243 | Ga0075434_100001742 | 3300006871 | Bacteria | 18691 |
| 244 | Ga0075434_100154325 | 3300006871 | Bacteria | 2316 |
| 245 | Ga0075429_100047795 | 3300006880 | Bacteria | 3722 |
| 246 | Ga0075429_100065757 | 3300006880 | Bacteria | 3157 |
| 247 | Ga0068865_100000443 | 3300006881 | Bacteria | 23029 |
| 248 | Ga0068865_100002092 | 3300006881 | Bacteria | 11787 |
| 249 | Ga0068865_100022320 | 3300006881 | Bacteria | 4127 |
| 250 | Ga0097620_100008970 | 3300006931 | Bacteria | 10101 |
| 251 | Ga0097620_100009047 | 3300006931 | Bacteria | 10061 |
| 252 | Ga0097620_100031183 | 3300006931 | Bacteria | 5351 |
| 253 | Ga0097620_100077427 | 3300006931 | Bacteria | 3366 |
| 254 | Ga0075435_100062423 | 3300007076 | Bacteria | 3024 |
| 255 | Ga0099794_10000055 | 3300007265 | Bacteria | 43614 |
| 256 | Ga0105240_10001500 | 3300009093 | Bacteria | 39754 |
| 257 | Ga0105240_10016511 | 3300009093 | Bacteria | 9993 |
| 258 | Ga0105240_10084403 | 3300009093 | Bacteria | 3894 |
| 259 | Ga0105240_10084709 | 3300009093 | Bacteria | 3886 |
| 260 | Ga0111539_10038786 | 3300009094 | Bacteria | 5746 |
| 261 | Ga0111539_10120122 | 3300009094 | Bacteria | 3079 |
| 262 | Ga0105245_10001175 | 3300009098 | Bacteria | 23707 |
| 263 | Ga0105245_10003387 | 3300009098 | Bacteria | 14280 |
| 264 | Ga0105245_10037458 | 3300009098 | Bacteria | 4312 |
| 265 | Ga0105245_10052940 | 3300009098 | Bacteria | 3642 |
| 266 | Ga0105245_10148712 | 3300009098 | Bacteria | 2213 |
| 267 | Ga0105247_10000294 | 3300009101 | Bacteria | 45240 |
| 268 | Ga0114129_10002595 | 3300009147 | Bacteria | 25118 |
| 269 | Ga0114129_10018361 | 3300009147 | Bacteria | 9961 |
| 270 | Ga0114129_10078991 | 3300009147 | Bacteria | 4575 |
| 271 | Ga0105243_10024991 | 3300009148 | Bacteria | 4561 |
| 272 | Ga0105241_10000018 | 3300009174 | Bacteria | 155940 |
| 273 | Ga0105241_10000385 | 3300009174 | Bacteria | 33441 |
| 274 | Ga0105241_10037086 | 3300009174 | Bacteria | 3672 |
| 275 | Ga0105242_10002033 | 3300009176 | Bacteria | 15923 |
| 276 | Ga0105242_10036907 | 3300009176 | Bacteria | 3923 |
| 277 | Ga0105248_10000906 | 3300009177 | Bacteria | 33083 |
| 278 | Ga0105248_10002626 | 3300009177 | Bacteria | 19982 |
| 279 | Ga0105248_10142827 | 3300009177 | Bacteria | 2701 |
| 280 | Ga0105248_10162262 | 3300009177 | Bacteria | 2520 |
| 281 | Ga0105248_10185923 | 3300009177 | Bacteria | 2341 |
| 282 | Ga0105237_10000241 | 3300009545 | Bacteria | 77735 |
| 283 | Ga0105237_10009918 | 3300009545 | Bacteria | 10162 |
| 284 | Ga0105238_10001527 | 3300009551 | Bacteria | 23199 |
| 285 | Ga0105238_10019853 | 3300009551 | Bacteria | 6840 |
| 286 | Ga0105249_10000108 | 3300009553 | Bacteria | 113842 |
| 287 | Ga0105249_10000576 | 3300009553 | Bacteria | 33690 |
| 288 | Ga0105249_10006080 | 3300009553 | Bacteria | 10463 |
| 289 | Ga0105239_10000460 | 3300010375 | Bacteria | 59533 |
| 290 | Ga0105239_10012217 | 3300010375 | Bacteria | 9572 |
| 291 | Ga0105239_10033237 | 3300010375 | Bacteria | 5664 |
| 292 | Ga0105246_10000362 | 3300011119 | Bacteria | 24403 |
| 293 | Ga0157373_10000334 | 3300013100 | Bacteria | 38219 |
| 294 | Ga0157373_10005590 | 3300013100 | Bacteria | 9424 |
| 295 | Ga0157373_10075780 | 3300013100 | Bacteria | 2373 |
| 296 | Ga0157371_10000339 | 3300013102 | Bacteria | 60061 |
| 297 | Ga0157371_10008832 | 3300013102 | Bacteria | 7981 |
| 298 | Ga0157371_10019506 | 3300013102 | Bacteria | 4999 |
| 299 | Ga0157371_10030748 | 3300013102 | Bacteria | 3871 |
| 300 | Ga0157370_10001811 | 3300013104 | Bacteria | 26356 |
| 301 | Ga0157370_10012404 | 3300013104 | Bacteria | 8838 |
| 302 | Ga0157370_10023867 | 3300013104 | Bacteria | 6065 |
| 303 | Ga0157370_10086115 | 3300013104 | Bacteria | 2952 |
| 304 | Ga0157370_10118707 | 3300013104 | Bacteria | 2470 |
| 305 | Ga0157370_10184276 | 3300013104 | Bacteria | 1939 |
| 306 | Ga0157369_10003465 | 3300013105 | Bacteria | 18721 |
| 307 | Ga0157369_10043883 | 3300013105 | Bacteria | 4870 |
| 308 | Ga0157369_10065912 | 3300013105 | Bacteria | 3897 |
| 309 | Ga0157369_10072384 | 3300013105 | Bacteria | 3699 |
| 310 | Ga0157369_10115535 | 3300013105 | Bacteria | 2850 |
| 311 | Ga0157369_10174232 | 3300013105 | Bacteria | 2265 |
| 312 | Ga0157369_10384568 | 3300013105 | Bacteria | 1456 |
| 313 | Ga0157374_10004438 | 3300013296 | Bacteria | 11791 |
| 314 | Ga0157374_10010816 | 3300013296 | Bacteria | 7872 |
| 315 | Ga0157374_10191604 | 3300013296 | Bacteria | 2000 |
| 316 | Ga0157378_10008775 | 3300013297 | Bacteria | 8801 |
| 317 | Ga0157378_10018637 | 3300013297 | Bacteria | 6102 |
| 318 | Ga0157378_10029981 | 3300013297 | Bacteria | 4803 |
| 319 | Ga0163162_10001852 | 3300013306 | Bacteria | 19911 |
| 320 | Ga0163162_10019726 | 3300013306 | Bacteria | 6620 |
| 321 | Ga0163162_10073275 | 3300013306 | Bacteria | 3480 |
| 322 | Ga0163162_10158783 | 3300013306 | Unclassified | 2382 |
| 323 | Ga0157372_10001985 | 3300013307 | Bacteria | 22233 |
| 324 | Ga0157372_10005124 | 3300013307 | Bacteria | 13925 |
| 325 | Ga0157372_10008965 | 3300013307 | Bacteria | 10632 |
| 326 | Ga0157372_10024235 | 3300013307 | Bacteria | 6588 |
| 327 | Ga0157372_10034247 | 3300013307 | Bacteria | 5583 |
| 328 | Ga0157372_10034585 | 3300013307 | Bacteria | 5556 |
| 329 | Ga0157372_10042288 | 3300013307 | Bacteria | 5039 |
| 330 | Ga0157372_10042326 | 3300013307 | Bacteria | 5038 |
| 331 | Ga0157372_10153341 | 3300013307 | Bacteria | 2660 |
| 332 | Ga0157375_10007017 | 3300013308 | Bacteria | 9836 |
| 333 | Ga0157375_10012614 | 3300013308 | Bacteria | 7499 |
| 334 | Ga0157375_10027943 | 3300013308 | Bacteria | 5279 |
| 335 | Ga0157375_10194506 | 3300013308 | Unclassified | 2183 |
| 336 | Ga0163163_10001552 | 3300014325 | Bacteria | 19365 |
| 337 | Ga0163163_10042858 | 3300014325 | Bacteria | 4434 |
| 338 | Ga0157380_10005438 | 3300014326 | Bacteria | 8900 |
| 339 | Ga0157380_10025069 | 3300014326 | Bacteria | 4520 |
| 340 | Ga0157377_10000943 | 3300014745 | Bacteria | 12169 |
| 341 | Ga0157377_10025254 | 3300014745 | Bacteria | 3167 |
| 342 | Ga0157379_10004488 | 3300014968 | Bacteria | 11966 |
| 343 | Ga0157379_10006486 | 3300014968 | Bacteria | 10084 |
| 344 | Ga0157376_10000302 | 3300014969 | Bacteria | 33130 |
| 345 | Ga0206353_11875486 | 3300020082 | Bacteria | 2234 |
| 346 | Ga0207697_10000031 | 3300025315 | Bacteria | 51045 |
| 347 | Ga0207697_10002027 | 3300025315 | Bacteria | 10710 |
| 348 | Ga0207656_10000229 | 3300025321 | Bacteria | 20056 |
| 349 | Ga0207682_10000628 | 3300025893 | Bacteria | 16424 |
| 350 | Ga0207692_10091775 | 3300025898 | Bacteria | 1648 |
| 351 | Ga0207642_10001538 | 3300025899 | Bacteria | 7092 |
| 352 | Ga0207688_10000133 | 3300025901 | Bacteria | 31512 |
| 353 | Ga0207680_10000498 | 3300025903 | Bacteria | 18697 |
| 354 | Ga0207680_10040808 | 3300025903 | Bacteria | 2704 |
| 355 | Ga0207647_10000946 | 3300025904 | Bacteria | 22438 |
| 356 | Ga0207647_10055156 | 3300025904 | Bacteria | 2443 |
| 357 | Ga0207699_10004378 | 3300025906 | Bacteria | 6754 |
| 358 | Ga0207645_10000018 | 3300025907 | Bacteria | 110913 |
| 359 | Ga0207645_10007146 | 3300025907 | Bacteria | 7923 |
| 360 | Ga0207645_10018407 | 3300025907 | Bacteria | 4595 |
| 361 | Ga0207645_10021302 | 3300025907 | Bacteria | 4228 |
| 362 | Ga0207645_10131894 | 3300025907 | Bacteria | 1626 |
| 363 | Ga0207643_10000016 | 3300025908 | Bacteria | 121792 |
| 364 | Ga0207705_10009377 | 3300025909 | Bacteria | 7117 |
| 365 | Ga0207684_10009627 | 3300025910 | Bacteria | 8524 |
| 366 | Ga0207684_10098021 | 3300025910 | Bacteria | 2503 |
| 367 | Ga0207684_10099242 | 3300025910 | Bacteria | 2487 |
| 368 | Ga0207654_10000116 | 3300025911 | Bacteria | 51644 |
| 369 | Ga0207654_10003392 | 3300025911 | Bacteria | 8059 |
| 370 | Ga0207707_10000801 | 3300025912 | Bacteria | 30832 |
| 371 | Ga0207707_10005137 | 3300025912 | Bacteria | 11475 |
| 372 | Ga0207707_10005977 | 3300025912 | Bacteria | 10650 |
| 373 | Ga0207707_10031573 | 3300025912 | Bacteria | 4635 |
| 374 | Ga0207707_10062758 | 3300025912 | Bacteria | 3233 |
| 375 | Ga0207695_10002148 | 3300025913 | Bacteria | 29879 |
| 376 | Ga0207695_10006902 | 3300025913 | Bacteria | 14604 |
| 377 | Ga0207695_10009399 | 3300025913 | Bacteria | 12093 |
| 378 | Ga0207695_10027659 | 3300025913 | Bacteria | 6311 |
| 379 | Ga0207695_10116683 | 3300025913 | Bacteria | 2643 |
| 380 | Ga0207671_10048057 | 3300025914 | Bacteria | 3158 |
| 381 | Ga0207693_10006217 | 3300025915 | Bacteria | 9907 |
| 382 | Ga0207693_10026008 | 3300025915 | Bacteria | 4635 |
| 383 | Ga0207663_10023330 | 3300025916 | Bacteria | 3549 |
| 384 | Ga0207663_10067721 | 3300025916 | Bacteria | 2290 |
| 385 | Ga0207660_10000129 | 3300025917 | Bacteria | 44676 |
| 386 | Ga0207660_10009073 | 3300025917 | Bacteria | 6441 |
| 387 | Ga0207660_10016232 | 3300025917 | Bacteria | 4928 |
| 388 | Ga0207660_10087582 | 3300025917 | Bacteria | 2301 |
| 389 | Ga0207660_10099085 | 3300025917 | Bacteria | 2174 |
| 390 | Ga0207660_10109066 | 3300025917 | Bacteria | 2080 |
| 391 | Ga0207662_10000003 | 3300025918 | Bacteria | 148717 |
| 392 | Ga0207662_10164173 | 3300025918 | Bacteria | 1421 |
| 393 | Ga0207657_10000009 | 3300025919 | Bacteria | 187503 |
| 394 | Ga0207657_10009903 | 3300025919 | Bacteria | 9542 |
| 395 | Ga0207657_10023864 | 3300025919 | Bacteria | 5682 |
| 396 | Ga0207649_10003124 | 3300025920 | Bacteria | 9086 |
| 397 | Ga0207649_10005920 | 3300025920 | Bacteria | 6628 |
| 398 | Ga0207649_10025027 | 3300025920 | Bacteria | 3476 |
| 399 | Ga0207649_10138074 | 3300025920 | Bacteria | 1664 |
| 400 | Ga0207652_10004436 | 3300025921 | Bacteria | 11437 |
| 401 | Ga0207652_10010020 | 3300025921 | Bacteria | 7634 |
| 402 | Ga0207652_10015304 | 3300025921 | Bacteria | 6229 |
| 403 | Ga0207652_10022984 | 3300025921 | Bacteria | 5165 |
| 404 | Ga0207652_10032860 | 3300025921 | Bacteria | 4366 |
| 405 | Ga0207652_10036232 | 3300025921 | Bacteria | 4171 |
| 406 | Ga0207652_10096122 | 3300025921 | Bacteria | 2610 |
| 407 | Ga0207646_10002972 | 3300025922 | Bacteria | 19619 |
| 408 | Ga0207681_10001341 | 3300025923 | Bacteria | 15891 |
| 409 | Ga0207681_10008385 | 3300025923 | Bacteria | 6319 |
| 410 | Ga0207681_10028393 | 3300025923 | Bacteria | 3623 |
| 411 | Ga0207681_10035375 | 3300025923 | Bacteria | 3291 |
| 412 | Ga0207694_10098704 | 3300025924 | Bacteria | 2313 |
| 413 | Ga0207650_10000753 | 3300025925 | Bacteria | 24962 |
| 414 | Ga0207659_10000475 | 3300025926 | Bacteria | 24107 |
| 415 | Ga0207659_10006307 | 3300025926 | Bacteria | 7257 |
| 416 | Ga0207687_10009050 | 3300025927 | Bacteria | 6510 |
| 417 | Ga0207687_10018208 | 3300025927 | Bacteria | 4633 |
| 418 | Ga0207687_10020911 | 3300025927 | Bacteria | 4343 |
| 419 | Ga0207687_10024394 | 3300025927 | Bacteria | 4041 |
| 420 | Ga0207700_10000760 | 3300025928 | Bacteria | 18589 |
| 421 | Ga0207700_10068231 | 3300025928 | Bacteria | 2725 |
| 422 | Ga0207664_10014424 | 3300025929 | Bacteria | 5706 |
| 423 | Ga0207664_10015083 | 3300025929 | Bacteria | 5597 |
| 424 | Ga0207664_10028641 | 3300025929 | Bacteria | 4235 |
| 425 | Ga0207644_10000263 | 3300025931 | Bacteria | 35326 |
| 426 | Ga0207644_10040293 | 3300025931 | Bacteria | 3301 |
| 427 | Ga0207644_10059595 | 3300025931 | Bacteria | 2761 |
| 428 | Ga0207690_10014702 | 3300025932 | Bacteria | 4733 |
| 429 | Ga0207690_10032163 | 3300025932 | Bacteria | 3364 |
| 430 | Ga0207690_10033296 | 3300025932 | Bacteria | 3313 |
| 431 | Ga0207690_10045735 | 3300025932 | Bacteria | 2894 |
| 432 | Ga0207706_10000060 | 3300025933 | Bacteria | 110912 |
| 433 | Ga0207706_10000478 | 3300025933 | Bacteria | 42804 |
| 434 | Ga0207706_10005311 | 3300025933 | Bacteria | 12008 |
| 435 | Ga0207706_10024342 | 3300025933 | Bacteria | 5428 |
| 436 | Ga0207706_10049860 | 3300025933 | Bacteria | 3699 |
| 437 | Ga0207686_10021964 | 3300025934 | Bacteria | 3670 |
| 438 | Ga0207686_10072883 | 3300025934 | Bacteria | 2214 |
| 439 | Ga0207686_10131864 | 3300025934 | Bacteria | 1715 |
| 440 | Ga0207709_10002843 | 3300025935 | Bacteria | 10636 |
| 441 | Ga0207670_10000415 | 3300025936 | Bacteria | 24212 |
| 442 | Ga0207670_10171476 | 3300025936 | Bacteria | 1627 |
| 443 | Ga0207669_10000464 | 3300025937 | Bacteria | 17694 |
| 444 | Ga0207669_10016031 | 3300025937 | Bacteria | 3796 |
| 445 | Ga0207669_10050863 | 3300025937 | Unclassified | 2480 |
| 446 | Ga0207704_10000030 | 3300025938 | Bacteria | 115240 |
| 447 | Ga0207704_10008447 | 3300025938 | Bacteria | 4927 |
| 448 | Ga0207704_10060293 | 3300025938 | Unclassified | 2347 |
| 449 | Ga0207704_10114820 | 3300025938 | Bacteria | 1829 |
| 450 | Ga0207665_10000354 | 3300025939 | Bacteria | 31781 |
| 451 | Ga0207691_10000259 | 3300025940 | Bacteria | 52644 |
| 452 | Ga0207691_10000730 | 3300025940 | Bacteria | 32487 |
| 453 | Ga0207691_10002431 | 3300025940 | Bacteria | 18216 |
| 454 | Ga0207711_10000070 | 3300025941 | Bacteria | 114551 |
| 455 | Ga0207711_10002627 | 3300025941 | Bacteria | 15910 |
| 456 | Ga0207711_10109899 | 3300025941 | Bacteria | 2450 |
| 457 | Ga0207689_10000010 | 3300025942 | Bacteria | 124704 |
| 458 | Ga0207689_10001483 | 3300025942 | Bacteria | 22453 |
| 459 | Ga0207689_10004032 | 3300025942 | Bacteria | 13349 |
| 460 | Ga0207689_10023570 | 3300025942 | Bacteria | 5163 |
| 461 | Ga0207661_10000893 | 3300025944 | Bacteria | 19588 |
| 462 | Ga0207661_10001424 | 3300025944 | Bacteria | 16124 |
| 463 | Ga0207661_10007259 | 3300025944 | Bacteria | 7882 |
| 464 | Ga0207661_10008737 | 3300025944 | Bacteria | 7247 |
| 465 | Ga0207661_10013561 | 3300025944 | Bacteria | 5952 |
| 466 | Ga0207661_10055177 | 3300025944 | Bacteria | 3186 |
| 467 | Ga0207661_10111930 | 3300025944 | Bacteria | 2310 |
| 468 | Ga0207679_10000437 | 3300025945 | Bacteria | 29428 |
| 469 | Ga0207679_10000556 | 3300025945 | Bacteria | 25043 |
| 470 | Ga0207679_10000797 | 3300025945 | Bacteria | 20587 |
| 471 | Ga0207679_10001062 | 3300025945 | Bacteria | 17471 |
| 472 | Ga0207667_10000724 | 3300025949 | Bacteria | 42850 |
| 473 | Ga0207667_10032458 | 3300025949 | Bacteria | 5626 |
| 474 | Ga0207667_10040834 | 3300025949 | Bacteria | 4937 |
| 475 | Ga0207667_10047041 | 3300025949 | Bacteria | 4567 |
| 476 | Ga0207667_10068597 | 3300025949 | Bacteria | 3692 |
| 477 | Ga0207667_10127569 | 3300025949 | Bacteria | 2621 |
| 478 | Ga0207667_10212591 | 3300025949 | Bacteria | 1982 |
| 479 | Ga0207651_10000030 | 3300025960 | Bacteria | 67091 |
| 480 | Ga0207712_10003196 | 3300025961 | Bacteria | 10420 |
| 481 | Ga0207712_10005187 | 3300025961 | Bacteria | 8240 |
| 482 | Ga0207668_10119940 | 3300025972 | Unclassified | 1990 |
| 483 | Ga0207640_10000534 | 3300025981 | Bacteria | 22781 |
| 484 | Ga0207658_10000141 | 3300025986 | Bacteria | 75673 |
| 485 | Ga0207658_10045838 | 3300025986 | Bacteria | 3189 |
| 486 | Ga0207677_10000028 | 3300026023 | Bacteria | 125165 |
| 487 | Ga0207677_10025961 | 3300026023 | Bacteria | 3664 |
| 488 | Ga0207677_10026588 | 3300026023 | Bacteria | 3633 |
| 489 | Ga0207677_10049265 | 3300026023 | Bacteria | 2841 |
| 490 | Ga0207677_10117185 | 3300026023 | Unclassified | 1996 |
| 491 | Ga0207703_10000398 | 3300026035 | Bacteria | 46686 |
| 492 | Ga0207703_10070389 | 3300026035 | Bacteria | 2887 |
| 493 | Ga0207703_10075055 | 3300026035 | Bacteria | 2801 |
| 494 | Ga0207639_10023700 | 3300026041 | Bacteria | 4433 |
| 495 | Ga0207639_10090618 | 3300026041 | Bacteria | 2446 |
| 496 | Ga0207678_10000569 | 3300026067 | Bacteria | 33786 |
| 497 | Ga0207678_10001207 | 3300026067 | Bacteria | 23746 |
| 498 | Ga0207678_10115160 | 3300026067 | Bacteria | 2293 |
| 499 | Ga0207678_10266764 | 3300026067 | Bacteria | 1468 |
| 500 | Ga0207708_10002792 | 3300026075 | Bacteria | 12837 |
| 501 | Ga0207708_10048373 | 3300026075 | Bacteria | 3237 |
| 502 | Ga0207702_10038901 | 3300026078 | Bacteria | 3985 |
| 503 | Ga0207702_10059924 | 3300026078 | Bacteria | 3244 |
| 504 | Ga0207702_10102066 | 3300026078 | Bacteria | 2534 |
| 505 | Ga0207641_10007555 | 3300026088 | Bacteria | 9041 |
| 506 | Ga0207641_10008391 | 3300026088 | Bacteria | 8535 |
| 507 | Ga0207641_10026382 | 3300026088 | Bacteria | 4794 |
| 508 | Ga0207648_10000035 | 3300026089 | Bacteria | 124704 |
| 509 | Ga0207648_10006464 | 3300026089 | Bacteria | 11641 |
| 510 | Ga0207648_10010137 | 3300026089 | Bacteria | 8959 |
| 511 | Ga0207648_10106533 | 3300026089 | Bacteria | 2460 |
| 512 | Ga0207676_10001507 | 3300026095 | Bacteria | 17190 |
| 513 | Ga0207676_10003424 | 3300026095 | Bacteria | 11218 |
| 514 | Ga0207674_10000103 | 3300026116 | Bacteria | 97454 |
| 515 | Ga0207674_10000662 | 3300026116 | Bacteria | 44758 |
| 516 | Ga0207674_10002356 | 3300026116 | Bacteria | 23892 |
| 517 | Ga0207674_10069167 | 3300026116 | Bacteria | 3551 |
| 518 | Ga0207675_100000044 | 3300026118 | Bacteria | 88380 |
| 519 | Ga0207675_100000899 | 3300026118 | Bacteria | 29725 |
| 520 | Ga0207675_100236831 | 3300026118 | Bacteria | 1763 |
| 521 | Ga0207683_10000609 | 3300026121 | Bacteria | 33004 |
| 522 | Ga0207683_10032678 | 3300026121 | Bacteria | 4520 |
| 523 | Ga0207698_10002469 | 3300026142 | Bacteria | 10967 |
| 524 | Ga0207698_10139752 | 3300026142 | Bacteria | 2084 |
| 525 | Ga0209588_1000012 | 3300027671 | Bacteria | 141363 |
| 526 | Ga0209971_1019878 | 3300027682 | Bacteria | 1595 |
| 527 | Ga0207428_10164271 | 3300027907 | Bacteria | 1684 |
| 528 | Ga0268266_10000155 | 3300028379 | Bacteria | 129145 |
| 529 | Ga0268265_10000411 | 3300028380 | Bacteria | 45912 |
| 530 | Ga0268265_10002112 | 3300028380 | Bacteria | 15419 |
| 531 | Ga0268265_10010210 | 3300028380 | Bacteria | 6339 |
| 532 | Ga0268265_10013433 | 3300028380 | Bacteria | 5564 |
| 533 | Ga0268264_10000173 | 3300028381 | Bacteria | 138426 |
| 534 | Ga0268264_10001170 | 3300028381 | Bacteria | 25490 |
| 535 | Ga0265332_10035190 | 3300031238 | Bacteria | 2175 |
| 536 | Ga0265340_10029319 | 3300031247 | Bacteria | 2764 |
| 537 | Ga0307408_100004891 | 3300031548 | Bacteria | 9022 |
| 538 | Ga0307408_100006250 | 3300031548 | Bacteria | 7906 |
| 539 | Ga0307408_100080130 | 3300031548 | Bacteria | 2438 |
| 540 | Ga0265314_10005069 | 3300031711 | Bacteria | 12004 |
| 541 | Ga0265342_10027219 | 3300031712 | Bacteria | 3576 |
| 542 | Ga0307405_10002753 | 3300031731 | Bacteria | 7876 |
| 543 | Ga0307405_10004716 | 3300031731 | Bacteria | 6487 |
| 544 | Ga0307405_10048532 | 3300031731 | Bacteria | 2618 |
| 545 | Ga0307413_10008666 | 3300031824 | Bacteria | 4818 |
| 546 | Ga0307413_10034053 | 3300031824 | Bacteria | 2907 |
| 547 | Ga0307410_10000190 | 3300031852 | Bacteria | 22747 |
| 548 | Ga0307410_10010167 | 3300031852 | Bacteria | 5319 |
| 549 | Ga0307410_10053853 | 3300031852 | Bacteria | 2724 |
| 550 | Ga0307410_10161609 | 3300031852 | Bacteria | 1679 |
| 551 | Ga0307406_10008057 | 3300031901 | Bacteria | 5868 |
| 552 | Ga0307406_10009755 | 3300031901 | Bacteria | 5399 |
| 553 | Ga0307406_10017928 | 3300031901 | Bacteria | 4130 |
| 554 | Ga0307406_10076174 | 3300031901 | Bacteria | 2215 |
| 555 | Ga0307407_10002572 | 3300031903 | Bacteria | 7145 |
| 556 | Ga0307407_10031371 | 3300031903 | Bacteria | 2877 |
| 557 | Ga0307407_10035979 | 3300031903 | Bacteria | 2724 |
| 558 | Ga0307407_10076771 | 3300031903 | Bacteria | 2007 |
| 559 | Ga0307412_10003215 | 3300031911 | Bacteria | 9085 |
| 560 | Ga0307412_10004260 | 3300031911 | Bacteria | 7976 |
| 561 | Ga0307412_10209151 | 3300031911 | Bacteria | 1487 |
| 562 | Ga0307409_100002218 | 3300031995 | Bacteria | 10043 |
| 563 | Ga0307409_100009419 | 3300031995 | Bacteria | 5997 |
| 564 | Ga0307409_100247778 | 3300031995 | Bacteria | 1627 |
| 565 | Ga0307416_100003674 | 3300032002 | Bacteria | 9082 |
| 566 | Ga0307416_100049150 | 3300032002 | Bacteria | 3351 |
| 567 | Ga0307416_100083562 | 3300032002 | Bacteria | 2710 |
| 568 | Ga0307416_100114753 | 3300032002 | Bacteria | 2384 |
| 569 | Ga0307416_100170264 | 3300032002 | Bacteria | 2026 |
| 570 | Ga0307416_100254044 | 3300032002 | Bacteria | 1713 |
| 571 | Ga0307414_10011379 | 3300032004 | Bacteria | 5214 |
| 572 | Ga0307414_10035511 | 3300032004 | Bacteria | 3318 |
| 573 | Ga0307411_10002083 | 3300032005 | Bacteria | 8617 |
| 574 | Ga0307411_10020673 | 3300032005 | Bacteria | 3834 |
| 575 | Ga0307411_10141457 | 3300032005 | Bacteria | 1775 |
| 576 | Ga0307411_10147336 | 3300032005 | Bacteria | 1744 |
| 577 | Ga0307411_10178268 | 3300032005 | Bacteria | 1610 |
| 578 | Ga0307411_10214341 | 3300032005 | Bacteria | 1489 |
| 579 | Ga0307415_100028608 | 3300032126 | Bacteria | 3548 |
| 580 | Ga0307415_100038385 | 3300032126 | Bacteria | 3155 |
| 581 | Ga0307415_100089308 | 3300032126 | Bacteria | 2226 |
| 582 | Ga0373934_0000406 | 3300035086 | Bacteria | 15082 |
| 583 | Ga0373934_0005683 | 3300035086 | Bacteria | 4617 |
| 584 | Ga0373944_0000786 | 3300035089 | Bacteria | 7741 |
| 585 | Ga0373923_0037835 | 3300035111 | Bacteria | 1974 |
| 586 | Ga0373941_0001212 | 3300035115 | Bacteria | 5405 |
| 587 | Ga0373945_0019809 | 3300035116 | Unclassified | 2298 |
| 588 | Ga0373953_0020877 | 3300035117 | Bacteria | 2451 |
| 589 | Ga0373956_0001700 | 3300035119 | Bacteria | 9070 |
| 590 | Ga0373957_0020572 | 3300035120 | Bacteria | 2332 |
| 591 | Ga0373943_0000721 | 3300035170 | Bacteria | 14463 |
| 592 | Ga0373943_0016784 | 3300035170 | Bacteria | 3345 |
| 593 | Ga0373946_0001214 | 3300035171 | Bacteria | 8916 |
| 594 | Ga0373955_0000275 | 3300035172 | Bacteria | 21509 |
| 595 | Ga0373955_0003192 | 3300035172 | Bacteria | 7179 |
| 596 | Ga0373924_0017161 | 3300035410 | Bacteria | 2773 |
| 597 | Ga0373931_0107117 | 3300035691 | Unclassified | 1580 |
| 598 | Ga0373935_0001458 | 3300035692 | Bacteria | 13120 |
| 599 | Ga0373935_0071480 | 3300035692 | Bacteria | 2239 |
| 600 | Ga0373935_0079171 | 3300035692 | Bacteria | 2133 |
| 601 | Ga0373927_0009458 | 3300035695 | Bacteria | 6535 |
| 602 | Ga0373927_0010218 | 3300035695 | Bacteria | 6270 |
| 603 | Ga0373933_0000048 | 3300035724 | Bacteria | 74138 |
| 604 | Ga0373933_0000927 | 3300035724 | Bacteria | 17880 |
| 605 | Ga0373947_0000223 | 3300035725 | Bacteria | 31691 |
| 606 | Ga0373947_0006114 | 3300035725 | Bacteria | 7008 |
| 607 | Ga0373937_0000209 | 3300036401 | Bacteria | 56604 |
| 608 | Ga0373937_0000417 | 3300036401 | Bacteria | 39718 |
| 609 | Ga0373925_0000664 | 3300037068 | Bacteria | 32303 |
| 610 | Ga0373925_0003037 | 3300037068 | Bacteria | 13205 |
| 611 | Ga0373925_0006996 | 3300037068 | Bacteria | 8240 |
| 612 | Ga0373925_0032095 | 3300037068 | Bacteria | 3864 |
| 613 | Ga0436363_1007604 | 3300039450 | Bacteria | 4224 |
| 614 | Ga0439461_0003194 | 3300041410 | Bacteria | 2682 |
| 615 | Ga0439445_0004371 | 3300042004 | Bacteria | 3202 |
| 616 | Ga0439448_0004144 | 3300042005 | Bacteria | 4083 |
| 617 | Ga0466969_0024106 | 3300044656 | Bacteria | 3130 |
| 618 | Ga0466966_0034702 | 3300044684 | Bacteria | 3261 |
| 619 | Ga0466963_0109730 | 3300044694 | Bacteria | 1893 |
| 620 | Ga0453684_0106312 | 3300044712 | Bacteria | 3420 |
| 621 | Ga0466959_0016889 | 3300045049 | Bacteria | 5341 |
| 622 | Ga0466959_0022027 | 3300045049 | Bacteria | 4706 |
| 623 | Ga0451576_0017396 | 3300045051 | Bacteria | 7905 |
| 624 | Ga0451576_0230264 | 3300045051 | Bacteria | 1935 |
| 625 | Ga0466958_0012289 | 3300045836 | Bacteria | 4848 |
| 626 | Ga0495592_0059430 | 3300046454 | Bacteria | 2815 |
| 627 | Ga0495603_0012900 | 3300046455 | Bacteria | 5052 |
| 628 | Ga0495629_0002789 | 3300046459 | Bacteria | 13332 |
| 629 | Ga0495629_0006310 | 3300046459 | Bacteria | 8798 |
| 630 | Ga0495629_0010889 | 3300046459 | Bacteria | 6614 |
| 631 | Ga0495629_0186524 | 3300046459 | Bacteria | 1436 |
| 632 | Ga0495641_0060067 | 3300046461 | Unclassified | 1718 |
| 633 | Ga0495651_0003268 | 3300046462 | Bacteria | 12444 |
| 634 | Ga0495653_0000050 | 3300046463 | Bacteria | 106233 |
| 635 | Ga0495580_0000935 | 3300046472 | Bacteria | 25503 |
| 636 | Ga0495582_0000796 | 3300046473 | Bacteria | 17477 |
| 637 | Ga0495582_0003621 | 3300046473 | Bacteria | 8700 |
| 638 | Ga0495639_0002003 | 3300046475 | Bacteria | 9018 |
| 639 | Ga0495664_0157435 | 3300046477 | Bacteria | 1378 |
| 640 | Ga0495594_0016379 | 3300046499 | Bacteria | 3905 |
| 641 | Ga0495608_0000216 | 3300046511 | Bacteria | 41647 |
| 642 | Ga0495618_0053917 | 3300046514 | Bacteria | 2543 |
| 643 | Ga0495628_0000654 | 3300046516 | Bacteria | 31712 |
| 644 | Ga0495630_0001528 | 3300046517 | Bacteria | 16036 |
| 645 | Ga0495630_0002012 | 3300046517 | Bacteria | 14133 |
| 646 | Ga0495630_0002364 | 3300046517 | Bacteria | 13087 |
| 647 | Ga0495630_0171116 | 3300046517 | Bacteria | 1655 |
| 648 | Ga0495663_0001361 | 3300046525 | Bacteria | 7704 |
| 649 | Ga0495652_0001059 | 3300046529 | Bacteria | 31241 |
| 650 | Ga0495665_0000260 | 3300046531 | Bacteria | 26673 |
| 651 | Ga0495665_0038683 | 3300046531 | Bacteria | 2543 |
| 652 | Ga0495665_0048766 | 3300046531 | Bacteria | 2245 |
| 653 | Ga0495586_0002347 | 3300046535 | Bacteria | 10304 |
| 654 | Ga0495586_0013632 | 3300046535 | Bacteria | 4312 |
| 655 | Ga0495587_0000660 | 3300046536 | Bacteria | 23102 |
| 656 | Ga0495587_0001321 | 3300046536 | Bacteria | 16474 |
| 657 | Ga0495645_0000066 | 3300046543 | Bacteria | 73132 |
| 658 | Ga0495645_0000292 | 3300046543 | Bacteria | 36760 |
| 659 | Ga0495667_0000609 | 3300046559 | Bacteria | 22859 |
| 660 | Ga0495667_0024532 | 3300046559 | Bacteria | 4061 |
| 661 | Ga0495656_0000632 | 3300046615 | Bacteria | 11276 |
| 662 | Ga0495635_0003779 | 3300046663 | Bacteria | 10519 |
| 663 | Ga0495588_0001715 | 3300046674 | Bacteria | 9336 |
| 664 | Ga0495588_0032806 | 3300046674 | Bacteria | 2619 |
| 665 | Ga0495588_0057952 | 3300046674 | Bacteria | 2002 |
| 666 | Ga0495657_0000053 | 3300046675 | Bacteria | 100979 |
| 667 | Ga0495599_0000708 | 3300046678 | Bacteria | 18830 |
| 668 | Ga0495599_0058559 | 3300046678 | Bacteria | 2410 |
| 669 | Ga0495623_0000158 | 3300046679 | Bacteria | 42253 |
| 670 | Ga0495623_0007589 | 3300046679 | Bacteria | 7041 |
| 671 | Ga0495646_0001991 | 3300046680 | Bacteria | 12339 |
| 672 | Ga0495658_0000162 | 3300046683 | Bacteria | 37342 |
| 673 | Ga0495658_0029677 | 3300046683 | Bacteria | 2963 |
| 674 | Ga0495658_0058822 | 3300046683 | Bacteria | 2199 |
| 675 | Ga0495613_0012235 | 3300046689 | Bacteria | 6378 |
| 676 | Ga0495613_0069379 | 3300046689 | Bacteria | 2570 |
| 677 | Ga0495600_0000032 | 3300046809 | Bacteria | 85490 |
| 678 | Ga0495581_0003113 | 3300047315 | Bacteria | 9499 |
| 679 | Ga0495581_0019350 | 3300047315 | Bacteria | 3952 |
| 680 | Ga0495604_0000051 | 3300047317 | Bacteria | 103371 |
| 681 | Ga0495674_0023758 | 3300047319 | Bacteria | 5644 |
| 682 | Ga0495680_0004862 | 3300047322 | Bacteria | 12728 |
| 683 | Ga0495675_0000738 | 3300047444 | Bacteria | 20387 |
| 684 | Ga0495675_0006656 | 3300047444 | Bacteria | 7077 |
| 685 | Ga0495684_0000929 | 3300047471 | Bacteria | 23788 |
| 686 | Ga0495684_0111389 | 3300047471 | Bacteria | 2065 |
| 687 | Ga0495593_0000232 | 3300047673 | Bacteria | 29743 |
| 688 | Ga0495593_0054395 | 3300047673 | Bacteria | 2110 |
| 689 | Ga0495602_0000361 | 3300048088 | Bacteria | 42478 |
| 690 | Ga0495614_0000185 | 3300048089 | Bacteria | 23397 |
| 691 | Ga0495615_0001183 | 3300048090 | Bacteria | 3789 |
| 692 | Ga0496102_0001910 | 3300048905 | Bacteria | 17949 |
| 693 | Ga0496106_0005452 | 3300048909 | Bacteria | 9416 |
| 694 | Ga0496109_0009339 | 3300048912 | Bacteria | 8356 |
| 695 | Ga0496109_0021650 | 3300048912 | Bacteria | 5689 |
| 696 | Ga0496109_0244671 | 3300048912 | Bacteria | 1689 |
| 697 | Ga0496112_0001136 | 3300048915 | Bacteria | 19817 |
| 698 | Ga0496112_0005795 | 3300048915 | Bacteria | 10745 |
| 699 | Ga0496112_0011843 | 3300048915 | Bacteria | 7986 |
| 700 | Ga0496113_0006829 | 3300048916 | Bacteria | 7278 |
| 701 | Ga0496113_0020657 | 3300048916 | Bacteria | 4635 |
| 702 | Ga0496115_0184752 | 3300048918 | Bacteria | 1723 |
| 703 | Ga0501033_0018633 | 3300049570 | Bacteria | 5246 |
| 704 | Ga0501034_0381210 | 3300049571 | Bacteria | 1335 |
| 705 | Ga0501037_0116661 | 3300049573 | Bacteria | 1921 |
| 706 | Ga0501046_0074544 | 3300049580 | Bacteria | 2633 |
| 707 | Ga0501047_0072317 | 3300049581 | Bacteria | 3319 |
| 708 | Ga0501047_0091808 | 3300049581 | Bacteria | 2915 |
| 709 | Ga0501075_0010770 | 3300049591 | Bacteria | 6442 |
| 710 | Ga0501077_0072984 | 3300049593 | Bacteria | 2174 |
| 711 | Ga0501261_005347 | 3300049690 | Bacteria | 1611 |
| 712 | Ga0501035_0055433 | 3300049822 | Bacteria | 3539 |
| 713 | Ga0501044_0034237 | 3300049823 | Bacteria | 5330 |
| 714 | Ga0501044_0293987 | 3300049823 | Bacteria | 1555 |
| 715 | nmdc:mga05p37_22428_c1 | 3300050507 | Bacteria | 7657 |
| 716 | nmdc:mga05p37_58743_c1 | 3300050507 | Bacteria | 4737 |
| 717 | nmdc:mga0qj67_10966_c1 | 3300050509 | Bacteria | 6783 |
| 718 | nmdc:mga0qj67_37316_c1 | 3300050509 | Bacteria | 3806 |
| 719 | nmdc:mga06r32_133178_c1 | 3300050510 | Bacteria | 2459 |
| 720 | nmdc:mga06r32_18647_c1 | 3300050510 | Bacteria | 6356 |
| 721 | nmdc:mga06r32_297056_c1 | 3300050510 | Bacteria | 1601 |
| 722 | nmdc:mga06r32_68602_c1 | 3300050510 | Bacteria | 3426 |
| 723 | nmdc:mga08y16_127125_c1 | 3300050511 | Bacteria | 2651 |
| 724 | nmdc:mga0n895_169826_c1 | 3300050512 | Bacteria | 2213 |
| 725 | nmdc:mga0n895_32137_c1 | 3300050512 | Bacteria | 5035 |
| 726 | nmdc:mga0n895_9347_c1 | 3300050512 | Bacteria | 8570 |
| 727 | nmdc:mga0rr50_73923_c1 | 3300050513 | Bacteria | 2607 |
| 728 | nmdc:mga0rr50_88619_c1 | 3300050513 | Bacteria | 2404 |
| 729 | nmdc:mga08x19_101446_c1 | 3300050514 | Bacteria | 1910 |
| 730 | nmdc:mga0a205_10119_c1 | 3300050515 | Bacteria | 8656 |
| 731 | nmdc:mga0a205_9691_c1 | 3300050515 | Bacteria | 8820 |
| 732 | Ga0495601_0006239 | 3300053077 | Bacteria | 6960 |
| 733 | Ga0495612_0002646 | 3300053078 | Bacteria | 7388 |
| 734 | Ga0495595_0013214 | 3300053084 | Bacteria | 3485 |
| 735 | Ga0495619_0011346 | 3300053085 | Bacteria | 5610 |
| 736 | Ga0500618_000173 | 3300053125 | Bacteria | 53346 |
| 737 | Ga0501084_0077436 | 3300054114 | Bacteria | 2788 |
| 738 | Ga0501082_0038557 | 3300060353 | Bacteria | 4123 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005545 | Ga0070695_100057931 | Ga0070695_1000579313 | 350 |
| 2 | 3300049823 | Ga0501044_0293987 | Ga0501044_0293987_14_1111 | 365 |
| 3 | 3300047471 | Ga0495684_0111389 | Ga0495684_0111389_26_1195 | 389 |
| 4 | 3300005355 | Ga0070671_100083292 | Ga0070671_1000832922 | 391 |
| 5 | 3300005459 | Ga0068867_100066352 | Ga0068867_1000663522 | 391 |
| 6 | 3300013297 | Ga0157378_10018637 | Ga0157378_100186372 | 391 |
| 7 | 3300025931 | Ga0207644_10059595 | Ga0207644_100595953 | 391 |
| 8 | 3300026089 | Ga0207648_10006464 | Ga0207648_100064648 | 391 |
| 9 | 3300046525 | Ga0495663_0001361 | Ga0495663_0001361_1930_3132 | 391 |
| 10 | 3300046615 | Ga0495656_0000632 | Ga0495656_0000632_5503_6705 | 391 |
| 11 | 3300048090 | Ga0495615_0001183 | Ga0495615_0001183_2431_3633 | 391 |
| 12 | 3300053125 | Ga0500618_000173 | Ga0500618_000173_21223_22428 | 391 |
| 13 | 3300026121 | Ga0207683_10032678 | Ga0207683_100326782 | 397 |
| 14 | 3300009545 | Ga0105237_10009918 | Ga0105237_100099183 | 402 |
| 15 | 3300009098 | Ga0105245_10052940 | Ga0105245_100529402 | 405 |
| 16 | 3300046689 | Ga0495613_0069379 | Ga0495613_0069379_21_1238 | 405 |
| 17 | 3300005467 | Ga0070706_100118069 | Ga0070706_1001180691 | 409 |
| 18 | 3300025910 | Ga0207684_10099242 | Ga0207684_100992421 | 409 |
| 19 | 3300009098 | Ga0105245_10003387 | Ga0105245_100033878 | 411 |
| 20 | 3300009174 | Ga0105241_10037086 | Ga0105241_100370863 | 411 |
| 21 | 3300009177 | Ga0105248_10000906 | Ga0105248_1000090617 | 411 |
| 22 | 3300010375 | Ga0105239_10033237 | Ga0105239_100332372 | 411 |
| 23 | 3300011119 | Ga0105246_10000362 | Ga0105246_100003629 | 411 |
| 24 | 3300013100 | Ga0157373_10005590 | Ga0157373_100055906 | 411 |
| 25 | 3300013102 | Ga0157371_10008832 | Ga0157371_100088325 | 411 |
| 26 | 3300013307 | Ga0157372_10001985 | Ga0157372_1000198517 | 411 |
| 27 | 3300031852 | Ga0307410_10053853 | Ga0307410_100538532 | 413 |
| 28 | 3300031911 | Ga0307412_10209151 | Ga0307412_102091511 | 413 |
| 29 | 3300032004 | Ga0307414_10035511 | Ga0307414_100355112 | 413 |
| 30 | 3300032005 | Ga0307411_10147336 | Ga0307411_101473361 | 413 |
| 31 | 3300035086 | Ga0373934_0005683 | Ga0373934_0005683_510_1760 | 416 |
| 32 | 3300035172 | Ga0373955_0003192 | Ga0373955_0003192_4908_6158 | 416 |
| 33 | 3300035691 | Ga0373931_0107117 | Ga0373931_0107117_12_1262 | 416 |
| 34 | 3300035724 | Ga0373933_0000927 | Ga0373933_0000927_12678_13928 | 416 |
| 35 | 3300036401 | Ga0373937_0000417 | Ga0373937_0000417_11529_12779 | 416 |
| 36 | 3300046517 | Ga0495630_0171116 | Ga0495630_0171116_219_1469 | 416 |
| 37 | 3300046536 | Ga0495587_0001321 | Ga0495587_0001321_9549_10799 | 416 |
| 38 | 3300046543 | Ga0495645_0000066 | Ga0495645_0000066_59501_60751 | 416 |
| 39 | 3300046559 | Ga0495667_0024532 | Ga0495667_0024532_2207_3457 | 416 |
| 40 | 3300046678 | Ga0495599_0058559 | Ga0495599_0058559_1122_2372 | 416 |
| 41 | 3300046679 | Ga0495623_0007589 | Ga0495623_0007589_3933_5183 | 416 |
| 42 | 3300047444 | Ga0495675_0006656 | Ga0495675_0006656_5664_6914 | 416 |
| 43 | 3300046461 | Ga0495641_0060067 | Ga0495641_0060067_420_1682 | 419 |
| 44 | 3300048918 | Ga0496115_0184752 | Ga0496115_0184752_35_1294 | 419 |
| 45 | 3300039450 | Ga0436363_1007604 | Ga0436363_1007604_536_1843 | 420 |
| 46 | 3300035692 | Ga0373935_0079171 | Ga0373935_0079171_202_1473 | 421 |
| 47 | 3300035695 | Ga0373927_0010218 | Ga0373927_0010218_1257_2528 | 421 |
| 48 | 3300037068 | Ga0373925_0003037 | Ga0373925_0003037_10069_11340 | 421 |
| 49 | 3300007265 | Ga0099794_10000055 | Ga0099794_100000553 | 425 |
| 50 | 3300027671 | Ga0209588_1000012 | Ga0209588_1000012128 | 425 |
| 51 | 3300026067 | Ga0207678_10266764 | Ga0207678_102667641 | 426 |
| 52 | 3300005341 | Ga0070691_10013881 | Ga0070691_100138812 | 429 |
| 53 | 3300005843 | Ga0068860_100001521 | Ga0068860_1000015217 | 429 |
| 54 | 3300028381 | Ga0268264_10001170 | Ga0268264_100011708 | 429 |
| 55 | 3300049822 | Ga0501035_0055433 | Ga0501035_0055433_674_1963 | 429 |
| 56 | 3300006847 | Ga0075431_100075870 | Ga0075431_1000758701 | 430 |
| 57 | 3300041410 | Ga0439461_0003194 | Ga0439461_0003194_792_2090 | 430 |
| 58 | 3300050510 | nmdc:mga06r32_133178_c1 | nmdc:mga06r32_133178_c1_108_1400 | 430 |
| 59 | 3300005293 | Ga0065715_10092087 | Ga0065715_100920874 | 431 |
| 60 | 3300005327 | Ga0070658_10036906 | Ga0070658_100369062 | 431 |
| 61 | 3300005327 | Ga0070658_10060322 | Ga0070658_100603221 | 431 |
| 62 | 3300005328 | Ga0070676_10013679 | Ga0070676_100136792 | 431 |
| 63 | 3300005328 | Ga0070676_10136888 | Ga0070676_101368881 | 431 |
| 64 | 3300005329 | Ga0070683_100029862 | Ga0070683_1000298622 | 431 |
| 65 | 3300005329 | Ga0070683_100030599 | Ga0070683_1000305993 | 431 |
| 66 | 3300005329 | Ga0070683_100040966 | Ga0070683_1000409662 | 431 |
| 67 | 3300005329 | Ga0070683_100059053 | Ga0070683_1000590533 | 431 |
| 68 | 3300005329 | Ga0070683_100064776 | Ga0070683_1000647761 | 431 |
| 69 | 3300005331 | Ga0070670_100007292 | Ga0070670_1000072926 | 431 |
| 70 | 3300005331 | Ga0070670_100013366 | Ga0070670_1000133663 | 431 |
| 71 | 3300005334 | Ga0068869_100062216 | Ga0068869_1000622162 | 431 |
| 72 | 3300005336 | Ga0070680_100001042 | Ga0070680_1000010426 | 431 |
| 73 | 3300005336 | Ga0070680_100033261 | Ga0070680_1000332612 | 431 |
| 74 | 3300005336 | Ga0070680_100101533 | Ga0070680_1001015332 | 431 |
| 75 | 3300005336 | Ga0070680_100135966 | Ga0070680_1001359662 | 431 |
| 76 | 3300005336 | Ga0070680_100213912 | Ga0070680_1002139122 | 431 |
| 77 | 3300005337 | Ga0070682_100000267 | Ga0070682_1000002676 | 431 |
| 78 | 3300005337 | Ga0070682_100005576 | Ga0070682_1000055764 | 431 |
| 79 | 3300005338 | Ga0068868_100020403 | Ga0068868_1000204033 | 431 |
| 80 | 3300005341 | Ga0070691_10029644 | Ga0070691_100296442 | 431 |
| 81 | 3300005344 | Ga0070661_100049598 | Ga0070661_1000495982 | 431 |
| 82 | 3300005345 | Ga0070692_10003001 | Ga0070692_100030014 | 431 |
| 83 | 3300005345 | Ga0070692_10033554 | Ga0070692_100335542 | 431 |
| 84 | 3300005347 | Ga0070668_100033892 | Ga0070668_1000338922 | 431 |
| 85 | 3300005353 | Ga0070669_100020213 | Ga0070669_1000202133 | 431 |
| 86 | 3300005354 | Ga0070675_100044069 | Ga0070675_1000440692 | 431 |
| 87 | 3300005355 | Ga0070671_100017231 | Ga0070671_1000172316 | 431 |
| 88 | 3300005356 | Ga0070674_100027636 | Ga0070674_1000276362 | 431 |
| 89 | 3300005364 | Ga0070673_100064942 | Ga0070673_1000649423 | 431 |
| 90 | 3300005364 | Ga0070673_100145166 | Ga0070673_1001451662 | 431 |
| 91 | 3300005365 | Ga0070688_100068137 | Ga0070688_1000681372 | 431 |
| 92 | 3300005366 | Ga0070659_100015698 | Ga0070659_1000156987 | 431 |
| 93 | 3300005366 | Ga0070659_100046505 | Ga0070659_1000465053 | 431 |
| 94 | 3300005366 | Ga0070659_100150967 | Ga0070659_1001509672 | 431 |
| 95 | 3300005367 | Ga0070667_100070035 | Ga0070667_1000700352 | 431 |
| 96 | 3300005434 | Ga0070709_10007521 | Ga0070709_100075213 | 431 |
| 97 | 3300005435 | Ga0070714_100004158 | Ga0070714_10000415810 | 431 |
| 98 | 3300005437 | Ga0070710_10007381 | Ga0070710_100073814 | 431 |
| 99 | 3300005438 | Ga0070701_10036359 | Ga0070701_100363592 | 431 |
| 100 | 3300005444 | Ga0070694_100017525 | Ga0070694_1000175252 | 431 |
| 101 | 3300005445 | Ga0070708_100000139 | Ga0070708_10000013930 | 431 |
| 102 | 3300005445 | Ga0070708_100008240 | Ga0070708_1000082402 | 431 |
| 103 | 3300005455 | Ga0070663_100010266 | Ga0070663_1000102662 | 431 |
| 104 | 3300005455 | Ga0070663_100021684 | Ga0070663_1000216842 | 431 |
| 105 | 3300005457 | Ga0070662_100002381 | Ga0070662_1000023813 | 431 |
| 106 | 3300005457 | Ga0070662_100006891 | Ga0070662_1000068912 | 431 |
| 107 | 3300005457 | Ga0070662_100042548 | Ga0070662_1000425482 | 431 |
| 108 | 3300005458 | Ga0070681_10012221 | Ga0070681_100122212 | 431 |
| 109 | 3300005458 | Ga0070681_10030340 | Ga0070681_100303402 | 431 |
| 110 | 3300005458 | Ga0070681_10198078 | Ga0070681_101980782 | 431 |
| 111 | 3300005459 | Ga0068867_100021149 | Ga0068867_1000211492 | 431 |
| 112 | 3300005466 | Ga0070685_10057799 | Ga0070685_100577992 | 431 |
| 113 | 3300005467 | Ga0070706_100010853 | Ga0070706_1000108535 | 431 |
| 114 | 3300005467 | Ga0070706_100114211 | Ga0070706_1001142112 | 431 |
| 115 | 3300005467 | Ga0070706_100149376 | Ga0070706_1001493762 | 431 |
| 116 | 3300005468 | Ga0070707_100005971 | Ga0070707_1000059712 | 431 |
| 117 | 3300005468 | Ga0070707_100017042 | Ga0070707_1000170422 | 431 |
| 118 | 3300005468 | Ga0070707_100110990 | Ga0070707_1001109902 | 431 |
| 119 | 3300005518 | Ga0070699_100026189 | Ga0070699_1000261893 | 431 |
| 120 | 3300005530 | Ga0070679_100004212 | Ga0070679_1000042126 | 431 |
| 121 | 3300005535 | Ga0070684_100021592 | Ga0070684_1000215922 | 431 |
| 122 | 3300005535 | Ga0070684_100035783 | Ga0070684_1000357833 | 431 |
| 123 | 3300005535 | Ga0070684_100087122 | Ga0070684_1000871222 | 431 |
| 124 | 3300005535 | Ga0070684_100250719 | Ga0070684_1002507192 | 431 |
| 125 | 3300005539 | Ga0068853_100002054 | Ga0068853_10000205413 | 431 |
| 126 | 3300005543 | Ga0070672_100001374 | Ga0070672_1000013745 | 431 |
| 127 | 3300005543 | Ga0070672_100100153 | Ga0070672_1001001532 | 431 |
| 128 | 3300005544 | Ga0070686_100025631 | Ga0070686_1000256312 | 431 |
| 129 | 3300005545 | Ga0070695_100004307 | Ga0070695_1000043073 | 431 |
| 130 | 3300005546 | Ga0070696_100078926 | Ga0070696_1000789262 | 431 |
| 131 | 3300005547 | Ga0070693_100001377 | Ga0070693_1000013774 | 431 |
| 132 | 3300005548 | Ga0070665_100023382 | Ga0070665_1000233822 | 431 |
| 133 | 3300005548 | Ga0070665_100066535 | Ga0070665_1000665355 | 431 |
| 134 | 3300005563 | Ga0068855_100154310 | Ga0068855_1001543102 | 431 |
| 135 | 3300005563 | Ga0068855_100299484 | Ga0068855_1002994842 | 431 |
| 136 | 3300005563 | Ga0068855_100402401 | Ga0068855_1004024012 | 431 |
| 137 | 3300005564 | Ga0070664_100087554 | Ga0070664_1000875542 | 431 |
| 138 | 3300005577 | Ga0068857_100012716 | Ga0068857_1000127163 | 431 |
| 139 | 3300005578 | Ga0068854_100017181 | Ga0068854_1000171814 | 431 |
| 140 | 3300005614 | Ga0068856_100128508 | Ga0068856_1001285082 | 431 |
| 141 | 3300005617 | Ga0068859_100031183 | Ga0068859_1000311834 | 431 |
| 142 | 3300005719 | Ga0068861_100018807 | Ga0068861_1000188075 | 431 |
| 143 | 3300005842 | Ga0068858_100176087 | Ga0068858_1001760871 | 431 |
| 144 | 3300005843 | Ga0068860_100023389 | Ga0068860_1000233892 | 431 |
| 145 | 3300005844 | Ga0068862_100004857 | Ga0068862_1000048577 | 431 |
| 146 | 3300006173 | Ga0070716_100029020 | Ga0070716_1000290202 | 431 |
| 147 | 3300006175 | Ga0070712_100010127 | Ga0070712_1000101272 | 431 |
| 148 | 3300006844 | Ga0075428_100033012 | Ga0075428_1000330125 | 431 |
| 149 | 3300006846 | Ga0075430_100001641 | Ga0075430_10000164114 | 431 |
| 150 | 3300006846 | Ga0075430_100068240 | Ga0075430_1000682402 | 431 |
| 151 | 3300006846 | Ga0075430_100102745 | Ga0075430_1001027452 | 431 |
| 152 | 3300006847 | Ga0075431_100017519 | Ga0075431_1000175197 | 431 |
| 153 | 3300006847 | Ga0075431_100030727 | Ga0075431_1000307274 | 431 |
| 154 | 3300006847 | Ga0075431_100030750 | Ga0075431_1000307503 | 431 |
| 155 | 3300006847 | Ga0075431_100041568 | Ga0075431_1000415683 | 431 |
| 156 | 3300006847 | Ga0075431_100050283 | Ga0075431_1000502832 | 431 |
| 157 | 3300006852 | Ga0075433_10013413 | Ga0075433_100134136 | 431 |
| 158 | 3300006871 | Ga0075434_100001742 | Ga0075434_1000017426 | 431 |
| 159 | 3300006871 | Ga0075434_100154325 | Ga0075434_1001543253 | 431 |
| 160 | 3300006880 | Ga0075429_100047795 | Ga0075429_1000477952 | 431 |
| 161 | 3300006880 | Ga0075429_100065757 | Ga0075429_1000657571 | 431 |
| 162 | 3300006881 | Ga0068865_100002092 | Ga0068865_1000020923 | 431 |
| 163 | 3300006881 | Ga0068865_100022320 | Ga0068865_1000223203 | 431 |
| 164 | 3300006931 | Ga0097620_100031183 | Ga0097620_1000311834 | 431 |
| 165 | 3300007076 | Ga0075435_100062423 | Ga0075435_1000624234 | 431 |
| 166 | 3300009093 | Ga0105240_10016511 | Ga0105240_100165118 | 431 |
| 167 | 3300009093 | Ga0105240_10084403 | Ga0105240_100844032 | 431 |
| 168 | 3300009094 | Ga0111539_10038786 | Ga0111539_100387865 | 431 |
| 169 | 3300009094 | Ga0111539_10120122 | Ga0111539_101201221 | 431 |
| 170 | 3300009098 | Ga0105245_10037458 | Ga0105245_100374582 | 431 |
| 171 | 3300009098 | Ga0105245_10148712 | Ga0105245_101487122 | 431 |
| 172 | 3300009147 | Ga0114129_10002595 | Ga0114129_100025957 | 431 |
| 173 | 3300009147 | Ga0114129_10018361 | Ga0114129_100183614 | 431 |
| 174 | 3300009147 | Ga0114129_10078991 | Ga0114129_100789912 | 431 |
| 175 | 3300009174 | Ga0105241_10000018 | Ga0105241_1000001858 | 431 |
| 176 | 3300009177 | Ga0105248_10162262 | Ga0105248_101622622 | 431 |
| 177 | 3300009177 | Ga0105248_10185923 | Ga0105248_101859233 | 431 |
| 178 | 3300009551 | Ga0105238_10019853 | Ga0105238_100198534 | 431 |
| 179 | 3300009553 | Ga0105249_10000576 | Ga0105249_1000057621 | 431 |
| 180 | 3300009553 | Ga0105249_10006080 | Ga0105249_100060803 | 431 |
| 181 | 3300010375 | Ga0105239_10012217 | Ga0105239_100122174 | 431 |
| 182 | 3300013100 | Ga0157373_10075780 | Ga0157373_100757802 | 431 |
| 183 | 3300013102 | Ga0157371_10019506 | Ga0157371_100195065 | 431 |
| 184 | 3300013102 | Ga0157371_10030748 | Ga0157371_100307484 | 431 |
| 185 | 3300013104 | Ga0157370_10023867 | Ga0157370_100238672 | 431 |
| 186 | 3300013104 | Ga0157370_10184276 | Ga0157370_101842762 | 431 |
| 187 | 3300013105 | Ga0157369_10043883 | Ga0157369_100438833 | 431 |
| 188 | 3300013105 | Ga0157369_10072384 | Ga0157369_100723841 | 431 |
| 189 | 3300013105 | Ga0157369_10115535 | Ga0157369_101155353 | 431 |
| 190 | 3300013105 | Ga0157369_10174232 | Ga0157369_101742322 | 431 |
| 191 | 3300013296 | Ga0157374_10191604 | Ga0157374_101916042 | 431 |
| 192 | 3300013297 | Ga0157378_10029981 | Ga0157378_100299812 | 431 |
| 193 | 3300013306 | Ga0163162_10019726 | Ga0163162_100197261 | 431 |
| 194 | 3300013306 | Ga0163162_10073275 | Ga0163162_100732752 | 431 |
| 195 | 3300013307 | Ga0157372_10034247 | Ga0157372_100342476 | 431 |
| 196 | 3300013307 | Ga0157372_10042288 | Ga0157372_100422884 | 431 |
| 197 | 3300013308 | Ga0157375_10027943 | Ga0157375_100279433 | 431 |
| 198 | 3300014325 | Ga0163163_10042858 | Ga0163163_100428584 | 431 |
| 199 | 3300014326 | Ga0157380_10005438 | Ga0157380_100054383 | 431 |
| 200 | 3300014326 | Ga0157380_10025069 | Ga0157380_100250693 | 431 |
| 201 | 3300014745 | Ga0157377_10025254 | Ga0157377_100252543 | 431 |
| 202 | 3300014968 | Ga0157379_10004488 | Ga0157379_100044882 | 431 |
| 203 | 3300020082 | Ga0206353_11875486 | Ga0206353_118754862 | 431 |
| 204 | 3300025315 | Ga0207697_10002027 | Ga0207697_100020274 | 431 |
| 205 | 3300025898 | Ga0207692_10091775 | Ga0207692_100917752 | 431 |
| 206 | 3300025904 | Ga0207647_10055156 | Ga0207647_100551562 | 431 |
| 207 | 3300025907 | Ga0207645_10007146 | Ga0207645_100071464 | 431 |
| 208 | 3300025907 | Ga0207645_10021302 | Ga0207645_100213022 | 431 |
| 209 | 3300025907 | Ga0207645_10131894 | Ga0207645_101318941 | 431 |
| 210 | 3300025909 | Ga0207705_10009377 | Ga0207705_100093773 | 431 |
| 211 | 3300025910 | Ga0207684_10009627 | Ga0207684_100096271 | 431 |
| 212 | 3300025910 | Ga0207684_10098021 | Ga0207684_100980212 | 431 |
| 213 | 3300025911 | Ga0207654_10000116 | Ga0207654_1000011637 | 431 |
| 214 | 3300025912 | Ga0207707_10000801 | Ga0207707_100008013 | 431 |
| 215 | 3300025912 | Ga0207707_10062758 | Ga0207707_100627581 | 431 |
| 216 | 3300025913 | Ga0207695_10116683 | Ga0207695_101166832 | 431 |
| 217 | 3300025914 | Ga0207671_10048057 | Ga0207671_100480572 | 431 |
| 218 | 3300025916 | Ga0207663_10067721 | Ga0207663_100677212 | 431 |
| 219 | 3300025917 | Ga0207660_10087582 | Ga0207660_100875822 | 431 |
| 220 | 3300025917 | Ga0207660_10099085 | Ga0207660_100990852 | 431 |
| 221 | 3300025917 | Ga0207660_10109066 | Ga0207660_101090662 | 431 |
| 222 | 3300025919 | Ga0207657_10009903 | Ga0207657_100099035 | 431 |
| 223 | 3300025919 | Ga0207657_10023864 | Ga0207657_100238645 | 431 |
| 224 | 3300025920 | Ga0207649_10025027 | Ga0207649_100250272 | 431 |
| 225 | 3300025920 | Ga0207649_10138074 | Ga0207649_101380742 | 431 |
| 226 | 3300025921 | Ga0207652_10022984 | Ga0207652_100229845 | 431 |
| 227 | 3300025921 | Ga0207652_10036232 | Ga0207652_100362323 | 431 |
| 228 | 3300025922 | Ga0207646_10002972 | Ga0207646_1000297212 | 431 |
| 229 | 3300025923 | Ga0207681_10008385 | Ga0207681_100083853 | 431 |
| 230 | 3300025923 | Ga0207681_10028393 | Ga0207681_100283932 | 431 |
| 231 | 3300025923 | Ga0207681_10035375 | Ga0207681_100353752 | 431 |
| 232 | 3300025927 | Ga0207687_10020911 | Ga0207687_100209112 | 431 |
| 233 | 3300025929 | Ga0207664_10015083 | Ga0207664_100150835 | 431 |
| 234 | 3300025931 | Ga0207644_10040293 | Ga0207644_100402932 | 431 |
| 235 | 3300025932 | Ga0207690_10032163 | Ga0207690_100321633 | 431 |
| 236 | 3300025932 | Ga0207690_10033296 | Ga0207690_100332962 | 431 |
| 237 | 3300025932 | Ga0207690_10045735 | Ga0207690_100457352 | 431 |
| 238 | 3300025933 | Ga0207706_10000478 | Ga0207706_1000047821 | 431 |
| 239 | 3300025933 | Ga0207706_10005311 | Ga0207706_100053116 | 431 |
| 240 | 3300025933 | Ga0207706_10049860 | Ga0207706_100498602 | 431 |
| 241 | 3300025936 | Ga0207670_10171476 | Ga0207670_101714762 | 431 |
| 242 | 3300025937 | Ga0207669_10016031 | Ga0207669_100160312 | 431 |
| 243 | 3300025938 | Ga0207704_10008447 | Ga0207704_100084473 | 431 |
| 244 | 3300025938 | Ga0207704_10114820 | Ga0207704_101148201 | 431 |
| 245 | 3300025939 | Ga0207665_10000354 | Ga0207665_100003544 | 431 |
| 246 | 3300025940 | Ga0207691_10000259 | Ga0207691_1000025922 | 431 |
| 247 | 3300025940 | Ga0207691_10002431 | Ga0207691_1000243113 | 431 |
| 248 | 3300025941 | Ga0207711_10109899 | Ga0207711_101098993 | 431 |
| 249 | 3300025942 | Ga0207689_10004032 | Ga0207689_100040329 | 431 |
| 250 | 3300025944 | Ga0207661_10007259 | Ga0207661_100072595 | 431 |
| 251 | 3300025945 | Ga0207679_10001062 | Ga0207679_1000106220 | 431 |
| 252 | 3300025949 | Ga0207667_10032458 | Ga0207667_100324586 | 431 |
| 253 | 3300025949 | Ga0207667_10047041 | Ga0207667_100470413 | 431 |
| 254 | 3300025949 | Ga0207667_10068597 | Ga0207667_100685971 | 431 |
| 255 | 3300025949 | Ga0207667_10127569 | Ga0207667_101275692 | 431 |
| 256 | 3300025949 | Ga0207667_10212591 | Ga0207667_102125912 | 431 |
| 257 | 3300025961 | Ga0207712_10005187 | Ga0207712_100051878 | 431 |
| 258 | 3300025986 | Ga0207658_10045838 | Ga0207658_100458382 | 431 |
| 259 | 3300026023 | Ga0207677_10025961 | Ga0207677_100259612 | 431 |
| 260 | 3300026023 | Ga0207677_10026588 | Ga0207677_100265884 | 431 |
| 261 | 3300026023 | Ga0207677_10049265 | Ga0207677_100492652 | 431 |
| 262 | 3300026035 | Ga0207703_10070389 | Ga0207703_100703892 | 431 |
| 263 | 3300026041 | Ga0207639_10023700 | Ga0207639_100237002 | 431 |
| 264 | 3300026041 | Ga0207639_10090618 | Ga0207639_100906183 | 431 |
| 265 | 3300026067 | Ga0207678_10001207 | Ga0207678_100012075 | 431 |
| 266 | 3300026067 | Ga0207678_10115160 | Ga0207678_101151602 | 431 |
| 267 | 3300026075 | Ga0207708_10002792 | Ga0207708_100027923 | 431 |
| 268 | 3300026075 | Ga0207708_10048373 | Ga0207708_100483733 | 431 |
| 269 | 3300026088 | Ga0207641_10026382 | Ga0207641_100263821 | 431 |
| 270 | 3300026089 | Ga0207648_10010137 | Ga0207648_100101376 | 431 |
| 271 | 3300026116 | Ga0207674_10002356 | Ga0207674_100023562 | 431 |
| 272 | 3300026118 | Ga0207675_100000044 | Ga0207675_10000004459 | 431 |
| 273 | 3300026118 | Ga0207675_100236831 | Ga0207675_1002368312 | 431 |
| 274 | 3300026142 | Ga0207698_10139752 | Ga0207698_101397522 | 431 |
| 275 | 3300027682 | Ga0209971_1019878 | Ga0209971_10198781 | 431 |
| 276 | 3300027907 | Ga0207428_10164271 | Ga0207428_101642712 | 431 |
| 277 | 3300028380 | Ga0268265_10002112 | Ga0268265_1000211213 | 431 |
| 278 | 3300028380 | Ga0268265_10010210 | Ga0268265_100102103 | 431 |
| 279 | 3300031238 | Ga0265332_10035190 | Ga0265332_100351901 | 431 |
| 280 | 3300031247 | Ga0265340_10029319 | Ga0265340_100293192 | 431 |
| 281 | 3300031548 | Ga0307408_100004891 | Ga0307408_1000048913 | 431 |
| 282 | 3300031548 | Ga0307408_100080130 | Ga0307408_1000801302 | 431 |
| 283 | 3300031711 | Ga0265314_10005069 | Ga0265314_100050698 | 431 |
| 284 | 3300031712 | Ga0265342_10027219 | Ga0265342_100272192 | 431 |
| 285 | 3300031731 | Ga0307405_10002753 | Ga0307405_100027532 | 431 |
| 286 | 3300031731 | Ga0307405_10048532 | Ga0307405_100485322 | 431 |
| 287 | 3300031824 | Ga0307413_10008666 | Ga0307413_100086662 | 431 |
| 288 | 3300031824 | Ga0307413_10034053 | Ga0307413_100340532 | 431 |
| 289 | 3300031852 | Ga0307410_10000190 | Ga0307410_100001905 | 431 |
| 290 | 3300031852 | Ga0307410_10161609 | Ga0307410_101616092 | 431 |
| 291 | 3300031901 | Ga0307406_10008057 | Ga0307406_100080573 | 431 |
| 292 | 3300031901 | Ga0307406_10009755 | Ga0307406_100097554 | 431 |
| 293 | 3300031901 | Ga0307406_10017928 | Ga0307406_100179281 | 431 |
| 294 | 3300031903 | Ga0307407_10031371 | Ga0307407_100313712 | 431 |
| 295 | 3300031903 | Ga0307407_10035979 | Ga0307407_100359792 | 431 |
| 296 | 3300031903 | Ga0307407_10076771 | Ga0307407_100767712 | 431 |
| 297 | 3300031911 | Ga0307412_10004260 | Ga0307412_100042602 | 431 |
| 298 | 3300031995 | Ga0307409_100002218 | Ga0307409_1000022183 | 431 |
| 299 | 3300032002 | Ga0307416_100003674 | Ga0307416_1000036744 | 431 |
| 300 | 3300032002 | Ga0307416_100049150 | Ga0307416_1000491502 | 431 |
| 301 | 3300032002 | Ga0307416_100083562 | Ga0307416_1000835622 | 431 |
| 302 | 3300032002 | Ga0307416_100114753 | Ga0307416_1001147532 | 431 |
| 303 | 3300032002 | Ga0307416_100170264 | Ga0307416_1001702642 | 431 |
| 304 | 3300032005 | Ga0307411_10002083 | Ga0307411_100020835 | 431 |
| 305 | 3300032005 | Ga0307411_10178268 | Ga0307411_101782682 | 431 |
| 306 | 3300032005 | Ga0307411_10214341 | Ga0307411_102143411 | 431 |
| 307 | 3300032126 | Ga0307415_100028608 | Ga0307415_1000286082 | 431 |
| 308 | 3300032126 | Ga0307415_100089308 | Ga0307415_1000893082 | 431 |
| 309 | 3300035115 | Ga0373941_0001212 | Ga0373941_0001212_3192_4490 | 431 |
| 310 | 3300035692 | Ga0373935_0071480 | Ga0373935_0071480_490_1788 | 431 |
| 311 | 3300042004 | Ga0439445_0004371 | Ga0439445_0004371_64_1377 | 431 |
| 312 | 3300044656 | Ga0466969_0024106 | Ga0466969_0024106_106_1404 | 431 |
| 313 | 3300044712 | Ga0453684_0106312 | Ga0453684_0106312_837_2132 | 431 |
| 314 | 3300045049 | Ga0466959_0016889 | Ga0466959_0016889_1926_3224 | 431 |
| 315 | 3300045051 | Ga0451576_0230264 | Ga0451576_0230264_514_1809 | 431 |
| 316 | 3300046459 | Ga0495629_0186524 | Ga0495629_0186524_41_1336 | 431 |
| 317 | 3300046674 | Ga0495588_0032806 | Ga0495588_0032806_296_1594 | 431 |
| 318 | 3300046683 | Ga0495658_0058822 | Ga0495658_0058822_860_2155 | 431 |
| 319 | 3300048912 | Ga0496109_0244671 | Ga0496109_0244671_19_1314 | 431 |
| 320 | 3300048915 | Ga0496112_0011843 | Ga0496112_0011843_5870_7168 | 431 |
| 321 | 3300049571 | Ga0501034_0381210 | Ga0501034_0381210_18_1313 | 431 |
| 322 | 3300049573 | Ga0501037_0116661 | Ga0501037_0116661_552_1847 | 431 |
| 323 | 3300049580 | Ga0501046_0074544 | Ga0501046_0074544_824_2119 | 431 |
| 324 | 3300049581 | Ga0501047_0072317 | Ga0501047_0072317_1861_3156 | 431 |
| 325 | 3300049591 | Ga0501075_0010770 | Ga0501075_0010770_1399_2697 | 431 |
| 326 | 3300049593 | Ga0501077_0072984 | Ga0501077_0072984_531_1829 | 431 |
| 327 | 3300049690 | Ga0501261_005347 | Ga0501261_005347_229_1524 | 431 |
| 328 | 3300050507 | nmdc:mga05p37_22428_c1 | nmdc:mga05p37_22428_c1_1749_3044 | 431 |
| 329 | 3300050507 | nmdc:mga05p37_58743_c1 | nmdc:mga05p37_58743_c1_1134_2429 | 431 |
| 330 | 3300050509 | nmdc:mga0qj67_10966_c1 | nmdc:mga0qj67_10966_c1_2560_3855 | 431 |
| 331 | 3300050509 | nmdc:mga0qj67_37316_c1 | nmdc:mga0qj67_37316_c1_886_2184 | 431 |
| 332 | 3300050510 | nmdc:mga06r32_18647_c1 | nmdc:mga06r32_18647_c1_3597_4901 | 431 |
| 333 | 3300050510 | nmdc:mga06r32_297056_c1 | nmdc:mga06r32_297056_c1_130_1425 | 431 |
| 334 | 3300050510 | nmdc:mga06r32_68602_c1 | nmdc:mga06r32_68602_c1_1478_2773 | 431 |
| 335 | 3300050511 | nmdc:mga08y16_127125_c1 | nmdc:mga08y16_127125_c1_254_1549 | 431 |
| 336 | 3300050512 | nmdc:mga0n895_169826_c1 | nmdc:mga0n895_169826_c1_179_1474 | 431 |
| 337 | 3300050512 | nmdc:mga0n895_32137_c1 | nmdc:mga0n895_32137_c1_3052_4350 | 431 |
| 338 | 3300050512 | nmdc:mga0n895_9347_c1 | nmdc:mga0n895_9347_c1_3882_5177 | 431 |
| 339 | 3300050513 | nmdc:mga0rr50_73923_c1 | nmdc:mga0rr50_73923_c1_1236_2531 | 431 |
| 340 | 3300050515 | nmdc:mga0a205_10119_c1 | nmdc:mga0a205_10119_c1_5424_6722 | 431 |
| 341 | 3300050515 | nmdc:mga0a205_9691_c1 | nmdc:mga0a205_9691_c1_4607_5902 | 431 |
| 342 | 3300054114 | Ga0501084_0077436 | Ga0501084_0077436_131_1429 | 431 |
| 343 | 3300060353 | Ga0501082_0038557 | Ga0501082_0038557_2264_3562 | 431 |
| 344 | 3300005290 | Ga0065712_10106929 | Ga0065712_101069292 | 432 |
| 345 | 3300005327 | Ga0070658_10000166 | Ga0070658_1000016644 | 432 |
| 346 | 3300005328 | Ga0070676_10002851 | Ga0070676_100028514 | 432 |
| 347 | 3300005329 | Ga0070683_100000840 | Ga0070683_1000008408 | 432 |
| 348 | 3300005329 | Ga0070683_100001190 | Ga0070683_1000011903 | 432 |
| 349 | 3300005329 | Ga0070683_100003494 | Ga0070683_1000034944 | 432 |
| 350 | 3300005329 | Ga0070683_100011375 | Ga0070683_1000113755 | 432 |
| 351 | 3300005329 | Ga0070683_100018412 | Ga0070683_1000184122 | 432 |
| 352 | 3300005329 | Ga0070683_100020819 | Ga0070683_1000208192 | 432 |
| 353 | 3300005329 | Ga0070683_100024804 | Ga0070683_1000248042 | 432 |
| 354 | 3300005329 | Ga0070683_100043179 | Ga0070683_1000431792 | 432 |
| 355 | 3300005330 | Ga0070690_100001550 | Ga0070690_1000015505 | 432 |
| 356 | 3300005330 | Ga0070690_100006846 | Ga0070690_1000068464 | 432 |
| 357 | 3300005330 | Ga0070690_100019904 | Ga0070690_1000199042 | 432 |
| 358 | 3300005331 | Ga0070670_100002268 | Ga0070670_1000022686 | 432 |
| 359 | 3300005331 | Ga0070670_100004216 | Ga0070670_1000042165 | 432 |
| 360 | 3300005333 | Ga0070677_10000071 | Ga0070677_1000007114 | 432 |
| 361 | 3300005334 | Ga0068869_100000780 | Ga0068869_10000078012 | 432 |
| 362 | 3300005334 | Ga0068869_100002264 | Ga0068869_1000022649 | 432 |
| 363 | 3300005334 | Ga0068869_100187903 | Ga0068869_1001879031 | 432 |
| 364 | 3300005335 | Ga0070666_10000097 | Ga0070666_1000009749 | 432 |
| 365 | 3300005335 | Ga0070666_10055636 | Ga0070666_100556362 | 432 |
| 366 | 3300005336 | Ga0070680_100000029 | Ga0070680_10000002932 | 432 |
| 367 | 3300005336 | Ga0070680_100007064 | Ga0070680_1000070643 | 432 |
| 368 | 3300005338 | Ga0068868_100005293 | Ga0068868_1000052931 | 432 |
| 369 | 3300005339 | Ga0070660_100000067 | Ga0070660_10000006741 | 432 |
| 370 | 3300005340 | Ga0070689_100003026 | Ga0070689_1000030267 | 432 |
| 371 | 3300005343 | Ga0070687_100000198 | Ga0070687_1000001985 | 432 |
| 372 | 3300005343 | Ga0070687_100034619 | Ga0070687_1000346192 | 432 |
| 373 | 3300005344 | Ga0070661_100000128 | Ga0070661_10000012856 | 432 |
| 374 | 3300005344 | Ga0070661_100005764 | Ga0070661_1000057646 | 432 |
| 375 | 3300005345 | Ga0070692_10003133 | Ga0070692_100031332 | 432 |
| 376 | 3300005345 | Ga0070692_10004898 | Ga0070692_100048982 | 432 |
| 377 | 3300005347 | Ga0070668_100000722 | Ga0070668_10000072212 | 432 |
| 378 | 3300005353 | Ga0070669_100002720 | Ga0070669_1000027202 | 432 |
| 379 | 3300005354 | Ga0070675_100004896 | Ga0070675_1000048962 | 432 |
| 380 | 3300005354 | Ga0070675_100028806 | Ga0070675_1000288064 | 432 |
| 381 | 3300005355 | Ga0070671_100000220 | Ga0070671_10000022029 | 432 |
| 382 | 3300005356 | Ga0070674_100000044 | Ga0070674_10000004420 | 432 |
| 383 | 3300005364 | Ga0070673_100003373 | Ga0070673_1000033732 | 432 |
| 384 | 3300005364 | Ga0070673_100063154 | Ga0070673_1000631542 | 432 |
| 385 | 3300005365 | Ga0070688_100000044 | Ga0070688_10000004440 | 432 |
| 386 | 3300005365 | Ga0070688_100074997 | Ga0070688_1000749972 | 432 |
| 387 | 3300005366 | Ga0070659_100000229 | Ga0070659_10000022914 | 432 |
| 388 | 3300005366 | Ga0070659_100051941 | Ga0070659_1000519412 | 432 |
| 389 | 3300005367 | Ga0070667_100004188 | Ga0070667_1000041885 | 432 |
| 390 | 3300005367 | Ga0070667_100088304 | Ga0070667_1000883042 | 432 |
| 391 | 3300005434 | Ga0070709_10001251 | Ga0070709_1000125111 | 432 |
| 392 | 3300005434 | Ga0070709_10003655 | Ga0070709_100036556 | 432 |
| 393 | 3300005434 | Ga0070709_10093178 | Ga0070709_100931782 | 432 |
| 394 | 3300005435 | Ga0070714_100004610 | Ga0070714_1000046107 | 432 |
| 395 | 3300005435 | Ga0070714_100113634 | Ga0070714_1001136342 | 432 |
| 396 | 3300005436 | Ga0070713_100000083 | Ga0070713_10000008347 | 432 |
| 397 | 3300005436 | Ga0070713_100022861 | Ga0070713_1000228613 | 432 |
| 398 | 3300005436 | Ga0070713_100083422 | Ga0070713_1000834222 | 432 |
| 399 | 3300005438 | Ga0070701_10007300 | Ga0070701_100073004 | 432 |
| 400 | 3300005439 | Ga0070711_100065685 | Ga0070711_1000656852 | 432 |
| 401 | 3300005440 | Ga0070705_100000744 | Ga0070705_1000007441 | 432 |
| 402 | 3300005441 | Ga0070700_100000875 | Ga0070700_10000087516 | 432 |
| 403 | 3300005445 | Ga0070708_100000022 | Ga0070708_10000002264 | 432 |
| 404 | 3300005455 | Ga0070663_100000778 | Ga0070663_1000007789 | 432 |
| 405 | 3300005456 | Ga0070678_100006739 | Ga0070678_1000067392 | 432 |
| 406 | 3300005457 | Ga0070662_100000605 | Ga0070662_1000006053 | 432 |
| 407 | 3300005457 | Ga0070662_100024423 | Ga0070662_1000244232 | 432 |
| 408 | 3300005458 | Ga0070681_10002316 | Ga0070681_100023163 | 432 |
| 409 | 3300005458 | Ga0070681_10035028 | Ga0070681_100350282 | 432 |
| 410 | 3300005458 | Ga0070681_10042584 | Ga0070681_100425843 | 432 |
| 411 | 3300005458 | Ga0070681_10067574 | Ga0070681_100675741 | 432 |
| 412 | 3300005458 | Ga0070681_10087855 | Ga0070681_100878552 | 432 |
| 413 | 3300005459 | Ga0068867_100000374 | Ga0068867_10000037418 | 432 |
| 414 | 3300005466 | Ga0070685_10001857 | Ga0070685_100018575 | 432 |
| 415 | 3300005466 | Ga0070685_10060769 | Ga0070685_100607692 | 432 |
| 416 | 3300005471 | Ga0070698_100006397 | Ga0070698_10000639712 | 432 |
| 417 | 3300005530 | Ga0070679_100003800 | Ga0070679_1000038006 | 432 |
| 418 | 3300005530 | Ga0070679_100009491 | Ga0070679_1000094912 | 432 |
| 419 | 3300005530 | Ga0070679_100036071 | Ga0070679_1000360712 | 432 |
| 420 | 3300005530 | Ga0070679_100091841 | Ga0070679_1000918412 | 432 |
| 421 | 3300005535 | Ga0070684_100000724 | Ga0070684_1000007242 | 432 |
| 422 | 3300005535 | Ga0070684_100009448 | Ga0070684_1000094485 | 432 |
| 423 | 3300005535 | Ga0070684_100011073 | Ga0070684_1000110735 | 432 |
| 424 | 3300005535 | Ga0070684_100036823 | Ga0070684_1000368233 | 432 |
| 425 | 3300005539 | Ga0068853_100004237 | Ga0068853_1000042377 | 432 |
| 426 | 3300005543 | Ga0070672_100002312 | Ga0070672_1000023125 | 432 |
| 427 | 3300005543 | Ga0070672_100105327 | Ga0070672_1001053272 | 432 |
| 428 | 3300005544 | Ga0070686_100000729 | Ga0070686_1000007293 | 432 |
| 429 | 3300005545 | Ga0070695_100003661 | Ga0070695_1000036613 | 432 |
| 430 | 3300005545 | Ga0070695_100005560 | Ga0070695_1000055608 | 432 |
| 431 | 3300005546 | Ga0070696_100007618 | Ga0070696_1000076186 | 432 |
| 432 | 3300005547 | Ga0070693_100004527 | Ga0070693_1000045272 | 432 |
| 433 | 3300005547 | Ga0070693_100007591 | Ga0070693_1000075912 | 432 |
| 434 | 3300005547 | Ga0070693_100021015 | Ga0070693_1000210152 | 432 |
| 435 | 3300005548 | Ga0070665_100013592 | Ga0070665_1000135925 | 432 |
| 436 | 3300005563 | Ga0068855_100022889 | Ga0068855_1000228895 | 432 |
| 437 | 3300005563 | Ga0068855_100024702 | Ga0068855_1000247022 | 432 |
| 438 | 3300005563 | Ga0068855_100044497 | Ga0068855_1000444972 | 432 |
| 439 | 3300005564 | Ga0070664_100000286 | Ga0070664_10000028629 | 432 |
| 440 | 3300005564 | Ga0070664_100001112 | Ga0070664_1000011126 | 432 |
| 441 | 3300005564 | Ga0070664_100021581 | Ga0070664_1000215812 | 432 |
| 442 | 3300005577 | Ga0068857_100000087 | Ga0068857_10000008732 | 432 |
| 443 | 3300005577 | Ga0068857_100002913 | Ga0068857_10000291314 | 432 |
| 444 | 3300005578 | Ga0068854_100000147 | Ga0068854_10000014714 | 432 |
| 445 | 3300005614 | Ga0068856_100003321 | Ga0068856_1000033215 | 432 |
| 446 | 3300005614 | Ga0068856_100018762 | Ga0068856_1000187623 | 432 |
| 447 | 3300005614 | Ga0068856_100024998 | Ga0068856_1000249984 | 432 |
| 448 | 3300005615 | Ga0070702_100016583 | Ga0070702_1000165832 | 432 |
| 449 | 3300005616 | Ga0068852_100000090 | Ga0068852_10000009012 | 432 |
| 450 | 3300005616 | Ga0068852_100011704 | Ga0068852_1000117043 | 432 |
| 451 | 3300005616 | Ga0068852_100041771 | Ga0068852_1000417712 | 432 |
| 452 | 3300005617 | Ga0068859_100008970 | Ga0068859_1000089706 | 432 |
| 453 | 3300005617 | Ga0068859_100009049 | Ga0068859_1000090493 | 432 |
| 454 | 3300005617 | Ga0068859_100077425 | Ga0068859_1000774252 | 432 |
| 455 | 3300005618 | Ga0068864_100001384 | Ga0068864_10000138414 | 432 |
| 456 | 3300005618 | Ga0068864_100006808 | Ga0068864_1000068086 | 432 |
| 457 | 3300005718 | Ga0068866_10000067 | Ga0068866_1000006717 | 432 |
| 458 | 3300005719 | Ga0068861_100001927 | Ga0068861_1000019272 | 432 |
| 459 | 3300005834 | Ga0068851_10000087 | Ga0068851_1000008725 | 432 |
| 460 | 3300005840 | Ga0068870_10000010 | Ga0068870_1000001041 | 432 |
| 461 | 3300005841 | Ga0068863_100003111 | Ga0068863_1000031112 | 432 |
| 462 | 3300005841 | Ga0068863_100089591 | Ga0068863_1000895912 | 432 |
| 463 | 3300005842 | Ga0068858_100029973 | Ga0068858_1000299732 | 432 |
| 464 | 3300005842 | Ga0068858_100153064 | Ga0068858_1001530642 | 432 |
| 465 | 3300005843 | Ga0068860_100004645 | Ga0068860_1000046459 | 432 |
| 466 | 3300005843 | Ga0068860_100006973 | Ga0068860_1000069736 | 432 |
| 467 | 3300005844 | Ga0068862_100005088 | Ga0068862_1000050887 | 432 |
| 468 | 3300005983 | Ga0081540_1000028 | Ga0081540_100002835 | 432 |
| 469 | 3300005983 | Ga0081540_1004263 | Ga0081540_10042638 | 432 |
| 470 | 3300005983 | Ga0081540_1004897 | Ga0081540_10048974 | 432 |
| 471 | 3300005985 | Ga0081539_10000117 | Ga0081539_1000011780 | 432 |
| 472 | 3300006028 | Ga0070717_10001145 | Ga0070717_1000114513 | 432 |
| 473 | 3300006028 | Ga0070717_10126897 | Ga0070717_101268972 | 432 |
| 474 | 3300006175 | Ga0070712_100002713 | Ga0070712_1000027133 | 432 |
| 475 | 3300006175 | Ga0070712_100040466 | Ga0070712_1000404663 | 432 |
| 476 | 3300006175 | Ga0070712_100090032 | Ga0070712_1000900322 | 432 |
| 477 | 3300006237 | Ga0097621_100146682 | Ga0097621_1001466822 | 432 |
| 478 | 3300006358 | Ga0068871_100000372 | Ga0068871_10000037226 | 432 |
| 479 | 3300006358 | Ga0068871_100008233 | Ga0068871_1000082333 | 432 |
| 480 | 3300006881 | Ga0068865_100000443 | Ga0068865_1000004435 | 432 |
| 481 | 3300006931 | Ga0097620_100008970 | Ga0097620_1000089703 | 432 |
| 482 | 3300006931 | Ga0097620_100009047 | Ga0097620_1000090473 | 432 |
| 483 | 3300006931 | Ga0097620_100077427 | Ga0097620_1000774272 | 432 |
| 484 | 3300009093 | Ga0105240_10001500 | Ga0105240_1000150028 | 432 |
| 485 | 3300009093 | Ga0105240_10084709 | Ga0105240_100847092 | 432 |
| 486 | 3300009098 | Ga0105245_10001175 | Ga0105245_1000117514 | 432 |
| 487 | 3300009101 | Ga0105247_10000294 | Ga0105247_1000029412 | 432 |
| 488 | 3300009148 | Ga0105243_10024991 | Ga0105243_100249915 | 432 |
| 489 | 3300009174 | Ga0105241_10000385 | Ga0105241_1000038516 | 432 |
| 490 | 3300009176 | Ga0105242_10002033 | Ga0105242_100020336 | 432 |
| 491 | 3300009176 | Ga0105242_10036907 | Ga0105242_100369073 | 432 |
| 492 | 3300009177 | Ga0105248_10002626 | Ga0105248_1000262614 | 432 |
| 493 | 3300009177 | Ga0105248_10142827 | Ga0105248_101428272 | 432 |
| 494 | 3300009545 | Ga0105237_10000241 | Ga0105237_1000024123 | 432 |
| 495 | 3300009551 | Ga0105238_10001527 | Ga0105238_1000152717 | 432 |
| 496 | 3300009553 | Ga0105249_10000108 | Ga0105249_1000010840 | 432 |
| 497 | 3300010375 | Ga0105239_10000460 | Ga0105239_100004603 | 432 |
| 498 | 3300013100 | Ga0157373_10000334 | Ga0157373_100003348 | 432 |
| 499 | 3300013102 | Ga0157371_10000339 | Ga0157371_1000033918 | 432 |
| 500 | 3300013104 | Ga0157370_10001811 | Ga0157370_1000181111 | 432 |
| 501 | 3300013104 | Ga0157370_10012404 | Ga0157370_100124046 | 432 |
| 502 | 3300013104 | Ga0157370_10086115 | Ga0157370_100861152 | 432 |
| 503 | 3300013104 | Ga0157370_10118707 | Ga0157370_101187072 | 432 |
| 504 | 3300013105 | Ga0157369_10003465 | Ga0157369_100034654 | 432 |
| 505 | 3300013105 | Ga0157369_10065912 | Ga0157369_100659124 | 432 |
| 506 | 3300013105 | Ga0157369_10384568 | Ga0157369_103845681 | 432 |
| 507 | 3300013296 | Ga0157374_10004438 | Ga0157374_100044386 | 432 |
| 508 | 3300013296 | Ga0157374_10010816 | Ga0157374_100108164 | 432 |
| 509 | 3300013297 | Ga0157378_10008775 | Ga0157378_100087754 | 432 |
| 510 | 3300013306 | Ga0163162_10001852 | Ga0163162_1000185214 | 432 |
| 511 | 3300013306 | Ga0163162_10158783 | Ga0163162_101587832 | 432 |
| 512 | 3300013307 | Ga0157372_10005124 | Ga0157372_100051247 | 432 |
| 513 | 3300013307 | Ga0157372_10008965 | Ga0157372_100089656 | 432 |
| 514 | 3300013307 | Ga0157372_10024235 | Ga0157372_100242356 | 432 |
| 515 | 3300013307 | Ga0157372_10034585 | Ga0157372_100345855 | 432 |
| 516 | 3300013307 | Ga0157372_10042326 | Ga0157372_100423262 | 432 |
| 517 | 3300013307 | Ga0157372_10153341 | Ga0157372_101533412 | 432 |
| 518 | 3300013308 | Ga0157375_10007017 | Ga0157375_100070177 | 432 |
| 519 | 3300013308 | Ga0157375_10012614 | Ga0157375_100126145 | 432 |
| 520 | 3300013308 | Ga0157375_10194506 | Ga0157375_101945062 | 432 |
| 521 | 3300014325 | Ga0163163_10001552 | Ga0163163_1000155213 | 432 |
| 522 | 3300014745 | Ga0157377_10000943 | Ga0157377_100009439 | 432 |
| 523 | 3300014968 | Ga0157379_10006486 | Ga0157379_100064866 | 432 |
| 524 | 3300014969 | Ga0157376_10000302 | Ga0157376_100003024 | 432 |
| 525 | 3300025315 | Ga0207697_10000031 | Ga0207697_100000319 | 432 |
| 526 | 3300025321 | Ga0207656_10000229 | Ga0207656_100002294 | 432 |
| 527 | 3300025893 | Ga0207682_10000628 | Ga0207682_1000062817 | 432 |
| 528 | 3300025899 | Ga0207642_10001538 | Ga0207642_100015385 | 432 |
| 529 | 3300025901 | Ga0207688_10000133 | Ga0207688_1000013322 | 432 |
| 530 | 3300025903 | Ga0207680_10000498 | Ga0207680_1000049813 | 432 |
| 531 | 3300025903 | Ga0207680_10040808 | Ga0207680_100408082 | 432 |
| 532 | 3300025904 | Ga0207647_10000946 | Ga0207647_1000094618 | 432 |
| 533 | 3300025906 | Ga0207699_10004378 | Ga0207699_100043783 | 432 |
| 534 | 3300025907 | Ga0207645_10000018 | Ga0207645_1000001892 | 432 |
| 535 | 3300025907 | Ga0207645_10018407 | Ga0207645_100184073 | 432 |
| 536 | 3300025908 | Ga0207643_10000016 | Ga0207643_1000001682 | 432 |
| 537 | 3300025911 | Ga0207654_10003392 | Ga0207654_100033922 | 432 |
| 538 | 3300025912 | Ga0207707_10005137 | Ga0207707_100051378 | 432 |
| 539 | 3300025912 | Ga0207707_10005977 | Ga0207707_100059772 | 432 |
| 540 | 3300025912 | Ga0207707_10031573 | Ga0207707_100315732 | 432 |
| 541 | 3300025913 | Ga0207695_10002148 | Ga0207695_1000214828 | 432 |
| 542 | 3300025913 | Ga0207695_10006902 | Ga0207695_100069026 | 432 |
| 543 | 3300025913 | Ga0207695_10009399 | Ga0207695_100093999 | 432 |
| 544 | 3300025913 | Ga0207695_10027659 | Ga0207695_100276596 | 432 |
| 545 | 3300025915 | Ga0207693_10006217 | Ga0207693_100062176 | 432 |
| 546 | 3300025915 | Ga0207693_10026008 | Ga0207693_100260083 | 432 |
| 547 | 3300025916 | Ga0207663_10023330 | Ga0207663_100233302 | 432 |
| 548 | 3300025917 | Ga0207660_10000129 | Ga0207660_100001292 | 432 |
| 549 | 3300025917 | Ga0207660_10009073 | Ga0207660_100090733 | 432 |
| 550 | 3300025917 | Ga0207660_10016232 | Ga0207660_100162322 | 432 |
| 551 | 3300025918 | Ga0207662_10000003 | Ga0207662_1000000314 | 432 |
| 552 | 3300025918 | Ga0207662_10164173 | Ga0207662_101641731 | 432 |
| 553 | 3300025919 | Ga0207657_10000009 | Ga0207657_10000009107 | 432 |
| 554 | 3300025920 | Ga0207649_10003124 | Ga0207649_100031242 | 432 |
| 555 | 3300025920 | Ga0207649_10005920 | Ga0207649_100059203 | 432 |
| 556 | 3300025921 | Ga0207652_10004436 | Ga0207652_100044366 | 432 |
| 557 | 3300025921 | Ga0207652_10010020 | Ga0207652_100100206 | 432 |
| 558 | 3300025921 | Ga0207652_10015304 | Ga0207652_100153042 | 432 |
| 559 | 3300025921 | Ga0207652_10032860 | Ga0207652_100328604 | 432 |
| 560 | 3300025921 | Ga0207652_10096122 | Ga0207652_100961222 | 432 |
| 561 | 3300025923 | Ga0207681_10001341 | Ga0207681_100013415 | 432 |
| 562 | 3300025924 | Ga0207694_10098704 | Ga0207694_100987042 | 432 |
| 563 | 3300025925 | Ga0207650_10000753 | Ga0207650_1000075314 | 432 |
| 564 | 3300025926 | Ga0207659_10000475 | Ga0207659_1000047514 | 432 |
| 565 | 3300025926 | Ga0207659_10006307 | Ga0207659_100063072 | 432 |
| 566 | 3300025927 | Ga0207687_10009050 | Ga0207687_100090505 | 432 |
| 567 | 3300025927 | Ga0207687_10018208 | Ga0207687_100182082 | 432 |
| 568 | 3300025927 | Ga0207687_10024394 | Ga0207687_100243943 | 432 |
| 569 | 3300025928 | Ga0207700_10000760 | Ga0207700_1000076010 | 432 |
| 570 | 3300025928 | Ga0207700_10068231 | Ga0207700_100682311 | 432 |
| 571 | 3300025929 | Ga0207664_10014424 | Ga0207664_100144243 | 432 |
| 572 | 3300025929 | Ga0207664_10028641 | Ga0207664_100286413 | 432 |
| 573 | 3300025931 | Ga0207644_10000263 | Ga0207644_1000026323 | 432 |
| 574 | 3300025932 | Ga0207690_10014702 | Ga0207690_100147023 | 432 |
| 575 | 3300025933 | Ga0207706_10000060 | Ga0207706_100000603 | 432 |
| 576 | 3300025933 | Ga0207706_10024342 | Ga0207706_100243423 | 432 |
| 577 | 3300025934 | Ga0207686_10021964 | Ga0207686_100219642 | 432 |
| 578 | 3300025934 | Ga0207686_10072883 | Ga0207686_100728832 | 432 |
| 579 | 3300025934 | Ga0207686_10131864 | Ga0207686_101318642 | 432 |
| 580 | 3300025935 | Ga0207709_10002843 | Ga0207709_100028436 | 432 |
| 581 | 3300025936 | Ga0207670_10000415 | Ga0207670_1000041510 | 432 |
| 582 | 3300025937 | Ga0207669_10000464 | Ga0207669_1000046414 | 432 |
| 583 | 3300025937 | Ga0207669_10050863 | Ga0207669_100508632 | 432 |
| 584 | 3300025938 | Ga0207704_10000030 | Ga0207704_1000003092 | 432 |
| 585 | 3300025938 | Ga0207704_10060293 | Ga0207704_100602932 | 432 |
| 586 | 3300025940 | Ga0207691_10000730 | Ga0207691_1000073028 | 432 |
| 587 | 3300025941 | Ga0207711_10000070 | Ga0207711_1000007040 | 432 |
| 588 | 3300025941 | Ga0207711_10002627 | Ga0207711_100026279 | 432 |
| 589 | 3300025942 | Ga0207689_10000010 | Ga0207689_10000010106 | 432 |
| 590 | 3300025942 | Ga0207689_10001483 | Ga0207689_100014833 | 432 |
| 591 | 3300025942 | Ga0207689_10023570 | Ga0207689_100235704 | 432 |
| 592 | 3300025944 | Ga0207661_10000893 | Ga0207661_1000089317 | 432 |
| 593 | 3300025944 | Ga0207661_10001424 | Ga0207661_100014246 | 432 |
| 594 | 3300025944 | Ga0207661_10008737 | Ga0207661_100087375 | 432 |
| 595 | 3300025944 | Ga0207661_10013561 | Ga0207661_100135612 | 432 |
| 596 | 3300025944 | Ga0207661_10055177 | Ga0207661_100551771 | 432 |
| 597 | 3300025944 | Ga0207661_10111930 | Ga0207661_101119302 | 432 |
| 598 | 3300025945 | Ga0207679_10000437 | Ga0207679_1000043714 | 432 |
| 599 | 3300025945 | Ga0207679_10000556 | Ga0207679_1000055610 | 432 |
| 600 | 3300025945 | Ga0207679_10000797 | Ga0207679_100007975 | 432 |
| 601 | 3300025949 | Ga0207667_10000724 | Ga0207667_100007243 | 432 |
| 602 | 3300025949 | Ga0207667_10040834 | Ga0207667_100408342 | 432 |
| 603 | 3300025960 | Ga0207651_10000030 | Ga0207651_1000003020 | 432 |
| 604 | 3300025961 | Ga0207712_10003196 | Ga0207712_100031966 | 432 |
| 605 | 3300025972 | Ga0207668_10119940 | Ga0207668_101199402 | 432 |
| 606 | 3300025981 | Ga0207640_10000534 | Ga0207640_1000053418 | 432 |
| 607 | 3300025986 | Ga0207658_10000141 | Ga0207658_1000014155 | 432 |
| 608 | 3300026023 | Ga0207677_10000028 | Ga0207677_1000002837 | 432 |
| 609 | 3300026023 | Ga0207677_10117185 | Ga0207677_101171852 | 432 |
| 610 | 3300026035 | Ga0207703_10000398 | Ga0207703_100003985 | 432 |
| 611 | 3300026035 | Ga0207703_10075055 | Ga0207703_100750552 | 432 |
| 612 | 3300026067 | Ga0207678_10000569 | Ga0207678_1000056929 | 432 |
| 613 | 3300026078 | Ga0207702_10038901 | Ga0207702_100389013 | 432 |
| 614 | 3300026078 | Ga0207702_10059924 | Ga0207702_100599242 | 432 |
| 615 | 3300026078 | Ga0207702_10102066 | Ga0207702_101020662 | 432 |
| 616 | 3300026088 | Ga0207641_10007555 | Ga0207641_100075557 | 432 |
| 617 | 3300026088 | Ga0207641_10008391 | Ga0207641_100083912 | 432 |
| 618 | 3300026089 | Ga0207648_10000035 | Ga0207648_10000035106 | 432 |
| 619 | 3300026089 | Ga0207648_10106533 | Ga0207648_101065332 | 432 |
| 620 | 3300026095 | Ga0207676_10001507 | Ga0207676_1000150712 | 432 |
| 621 | 3300026095 | Ga0207676_10003424 | Ga0207676_100034245 | 432 |
| 622 | 3300026116 | Ga0207674_10000103 | Ga0207674_1000010318 | 432 |
| 623 | 3300026116 | Ga0207674_10000662 | Ga0207674_1000066227 | 432 |
| 624 | 3300026116 | Ga0207674_10069167 | Ga0207674_100691672 | 432 |
| 625 | 3300026118 | Ga0207675_100000899 | Ga0207675_10000089920 | 432 |
| 626 | 3300026121 | Ga0207683_10000609 | Ga0207683_1000060922 | 432 |
| 627 | 3300026142 | Ga0207698_10002469 | Ga0207698_100024696 | 432 |
| 628 | 3300028379 | Ga0268266_10000155 | Ga0268266_100001559 | 432 |
| 629 | 3300028380 | Ga0268265_10000411 | Ga0268265_100004114 | 432 |
| 630 | 3300028380 | Ga0268265_10013433 | Ga0268265_100134332 | 432 |
| 631 | 3300028381 | Ga0268264_10000173 | Ga0268264_1000017364 | 432 |
| 632 | 3300031548 | Ga0307408_100006250 | Ga0307408_1000062504 | 432 |
| 633 | 3300031731 | Ga0307405_10004716 | Ga0307405_100047164 | 432 |
| 634 | 3300031852 | Ga0307410_10010167 | Ga0307410_100101672 | 432 |
| 635 | 3300031901 | Ga0307406_10076174 | Ga0307406_100761742 | 432 |
| 636 | 3300031903 | Ga0307407_10002572 | Ga0307407_100025724 | 432 |
| 637 | 3300031911 | Ga0307412_10003215 | Ga0307412_100032154 | 432 |
| 638 | 3300031995 | Ga0307409_100009419 | Ga0307409_1000094194 | 432 |
| 639 | 3300031995 | Ga0307409_100247778 | Ga0307409_1002477782 | 432 |
| 640 | 3300032002 | Ga0307416_100254044 | Ga0307416_1002540442 | 432 |
| 641 | 3300032004 | Ga0307414_10011379 | Ga0307414_100113793 | 432 |
| 642 | 3300032005 | Ga0307411_10020673 | Ga0307411_100206731 | 432 |
| 643 | 3300032005 | Ga0307411_10141457 | Ga0307411_101414572 | 432 |
| 644 | 3300032126 | Ga0307415_100038385 | Ga0307415_1000383852 | 432 |
| 645 | 3300035086 | Ga0373934_0000406 | Ga0373934_0000406_2695_3993 | 432 |
| 646 | 3300035089 | Ga0373944_0000786 | Ga0373944_0000786_5050_6351 | 432 |
| 647 | 3300035111 | Ga0373923_0037835 | Ga0373923_0037835_413_1711 | 432 |
| 648 | 3300035116 | Ga0373945_0019809 | Ga0373945_0019809_336_1637 | 432 |
| 649 | 3300035117 | Ga0373953_0020877 | Ga0373953_0020877_1141_2439 | 432 |
| 650 | 3300035119 | Ga0373956_0001700 | Ga0373956_0001700_3385_4683 | 432 |
| 651 | 3300035120 | Ga0373957_0020572 | Ga0373957_0020572_379_1677 | 432 |
| 652 | 3300035170 | Ga0373943_0000721 | Ga0373943_0000721_7285_8586 | 432 |
| 653 | 3300035170 | Ga0373943_0016784 | Ga0373943_0016784_1385_2683 | 432 |
| 654 | 3300035171 | Ga0373946_0001214 | Ga0373946_0001214_3577_4878 | 432 |
| 655 | 3300035172 | Ga0373955_0000275 | Ga0373955_0000275_1681_2979 | 432 |
| 656 | 3300035410 | Ga0373924_0017161 | Ga0373924_0017161_1138_2436 | 432 |
| 657 | 3300035692 | Ga0373935_0001458 | Ga0373935_0001458_5725_7026 | 432 |
| 658 | 3300035695 | Ga0373927_0009458 | Ga0373927_0009458_1355_2656 | 432 |
| 659 | 3300035724 | Ga0373933_0000048 | Ga0373933_0000048_52868_54166 | 432 |
| 660 | 3300035725 | Ga0373947_0000223 | Ga0373947_0000223_22063_23364 | 432 |
| 661 | 3300035725 | Ga0373947_0006114 | Ga0373947_0006114_3169_4467 | 432 |
| 662 | 3300036401 | Ga0373937_0000209 | Ga0373937_0000209_44790_46088 | 432 |
| 663 | 3300037068 | Ga0373925_0000664 | Ga0373925_0000664_25665_26966 | 432 |
| 664 | 3300037068 | Ga0373925_0006996 | Ga0373925_0006996_5970_7268 | 432 |
| 665 | 3300037068 | Ga0373925_0032095 | Ga0373925_0032095_1118_2428 | 432 |
| 666 | 3300042005 | Ga0439448_0004144 | Ga0439448_0004144_1359_2666 | 432 |
| 667 | 3300044684 | Ga0466966_0034702 | Ga0466966_0034702_1826_3127 | 432 |
| 668 | 3300044694 | Ga0466963_0109730 | Ga0466963_0109730_404_1705 | 432 |
| 669 | 3300045049 | Ga0466959_0022027 | Ga0466959_0022027_3353_4654 | 432 |
| 670 | 3300045051 | Ga0451576_0017396 | Ga0451576_0017396_3185_4489 | 432 |
| 671 | 3300045836 | Ga0466958_0012289 | Ga0466958_0012289_3076_4377 | 432 |
| 672 | 3300046454 | Ga0495592_0059430 | Ga0495592_0059430_713_2011 | 432 |
| 673 | 3300046455 | Ga0495603_0012900 | Ga0495603_0012900_2603_3904 | 432 |
| 674 | 3300046459 | Ga0495629_0002789 | Ga0495629_0002789_5439_6740 | 432 |
| 675 | 3300046459 | Ga0495629_0006310 | Ga0495629_0006310_4866_6164 | 432 |
| 676 | 3300046459 | Ga0495629_0010889 | Ga0495629_0010889_1202_2500 | 432 |
| 677 | 3300046462 | Ga0495651_0003268 | Ga0495651_0003268_8225_9523 | 432 |
| 678 | 3300046463 | Ga0495653_0000050 | Ga0495653_0000050_7972_9270 | 432 |
| 679 | 3300046472 | Ga0495580_0000935 | Ga0495580_0000935_17045_18346 | 432 |
| 680 | 3300046473 | Ga0495582_0000796 | Ga0495582_0000796_5214_6515 | 432 |
| 681 | 3300046473 | Ga0495582_0003621 | Ga0495582_0003621_4470_5768 | 432 |
| 682 | 3300046475 | Ga0495639_0002003 | Ga0495639_0002003_1430_2731 | 432 |
| 683 | 3300046477 | Ga0495664_0157435 | Ga0495664_0157435_35_1333 | 432 |
| 684 | 3300046499 | Ga0495594_0016379 | Ga0495594_0016379_2457_3755 | 432 |
| 685 | 3300046511 | Ga0495608_0000216 | Ga0495608_0000216_36860_38158 | 432 |
| 686 | 3300046514 | Ga0495618_0053917 | Ga0495618_0053917_195_1493 | 432 |
| 687 | 3300046516 | Ga0495628_0000654 | Ga0495628_0000654_5619_6917 | 432 |
| 688 | 3300046517 | Ga0495630_0001528 | Ga0495630_0001528_11141_12442 | 432 |
| 689 | 3300046517 | Ga0495630_0002012 | Ga0495630_0002012_11890_13188 | 432 |
| 690 | 3300046517 | Ga0495630_0002364 | Ga0495630_0002364_8243_9541 | 432 |
| 691 | 3300046529 | Ga0495652_0001059 | Ga0495652_0001059_28860_30158 | 432 |
| 692 | 3300046531 | Ga0495665_0000260 | Ga0495665_0000260_8328_9629 | 432 |
| 693 | 3300046531 | Ga0495665_0038683 | Ga0495665_0038683_328_1626 | 432 |
| 694 | 3300046531 | Ga0495665_0048766 | Ga0495665_0048766_15_1313 | 432 |
| 695 | 3300046535 | Ga0495586_0002347 | Ga0495586_0002347_3395_4693 | 432 |
| 696 | 3300046535 | Ga0495586_0013632 | Ga0495586_0013632_1121_2419 | 432 |
| 697 | 3300046536 | Ga0495587_0000660 | Ga0495587_0000660_4041_5339 | 432 |
| 698 | 3300046543 | Ga0495645_0000292 | Ga0495645_0000292_11733_13031 | 432 |
| 699 | 3300046559 | Ga0495667_0000609 | Ga0495667_0000609_6867_8165 | 432 |
| 700 | 3300046663 | Ga0495635_0003779 | Ga0495635_0003779_6831_8129 | 432 |
| 701 | 3300046674 | Ga0495588_0001715 | Ga0495588_0001715_6728_8029 | 432 |
| 702 | 3300046674 | Ga0495588_0057952 | Ga0495588_0057952_498_1796 | 432 |
| 703 | 3300046675 | Ga0495657_0000053 | Ga0495657_0000053_68361_69659 | 432 |
| 704 | 3300046678 | Ga0495599_0000708 | Ga0495599_0000708_1091_2389 | 432 |
| 705 | 3300046679 | Ga0495623_0000158 | Ga0495623_0000158_37989_39287 | 432 |
| 706 | 3300046680 | Ga0495646_0001991 | Ga0495646_0001991_6099_7397 | 432 |
| 707 | 3300046683 | Ga0495658_0000162 | Ga0495658_0000162_21073_22374 | 432 |
| 708 | 3300046683 | Ga0495658_0029677 | Ga0495658_0029677_1501_2799 | 432 |
| 709 | 3300046689 | Ga0495613_0012235 | Ga0495613_0012235_4224_5525 | 432 |
| 710 | 3300046809 | Ga0495600_0000032 | Ga0495600_0000032_67417_68715 | 432 |
| 711 | 3300047315 | Ga0495581_0003113 | Ga0495581_0003113_6768_8069 | 432 |
| 712 | 3300047315 | Ga0495581_0019350 | Ga0495581_0019350_1834_3132 | 432 |
| 713 | 3300047317 | Ga0495604_0000051 | Ga0495604_0000051_90468_91766 | 432 |
| 714 | 3300047319 | Ga0495674_0023758 | Ga0495674_0023758_3778_5079 | 432 |
| 715 | 3300047322 | Ga0495680_0004862 | Ga0495680_0004862_4564_5862 | 432 |
| 716 | 3300047444 | Ga0495675_0000738 | Ga0495675_0000738_4230_5528 | 432 |
| 717 | 3300047471 | Ga0495684_0000929 | Ga0495684_0000929_7911_9209 | 432 |
| 718 | 3300047673 | Ga0495593_0000232 | Ga0495593_0000232_6381_7682 | 432 |
| 719 | 3300047673 | Ga0495593_0054395 | Ga0495593_0054395_784_2082 | 432 |
| 720 | 3300048088 | Ga0495602_0000361 | Ga0495602_0000361_23871_25169 | 432 |
| 721 | 3300048089 | Ga0495614_0000185 | Ga0495614_0000185_5340_6641 | 432 |
| 722 | 3300048905 | Ga0496102_0001910 | Ga0496102_0001910_10368_11675 | 432 |
| 723 | 3300048909 | Ga0496106_0005452 | Ga0496106_0005452_2897_4204 | 432 |
| 724 | 3300048912 | Ga0496109_0009339 | Ga0496109_0009339_6149_7456 | 432 |
| 725 | 3300048912 | Ga0496109_0021650 | Ga0496109_0021650_3454_4752 | 432 |
| 726 | 3300048915 | Ga0496112_0001136 | Ga0496112_0001136_16083_17390 | 432 |
| 727 | 3300048915 | Ga0496112_0005795 | Ga0496112_0005795_2478_3776 | 432 |
| 728 | 3300048916 | Ga0496113_0006829 | Ga0496113_0006829_871_2169 | 432 |
| 729 | 3300048916 | Ga0496113_0020657 | Ga0496113_0020657_2439_3746 | 432 |
| 730 | 3300049570 | Ga0501033_0018633 | Ga0501033_0018633_1746_3044 | 432 |
| 731 | 3300049581 | Ga0501047_0091808 | Ga0501047_0091808_1203_2501 | 432 |
| 732 | 3300049823 | Ga0501044_0034237 | Ga0501044_0034237_2203_3501 | 432 |
| 733 | 3300050513 | nmdc:mga0rr50_88619_c1 | nmdc:mga0rr50_88619_c1_995_2296 | 432 |
| 734 | 3300050514 | nmdc:mga08x19_101446_c1 | nmdc:mga08x19_101446_c1_16_1317 | 432 |
| 735 | 3300053077 | Ga0495601_0006239 | Ga0495601_0006239_789_2087 | 432 |
| 736 | 3300053078 | Ga0495612_0002646 | Ga0495612_0002646_3883_5181 | 432 |
| 737 | 3300053084 | Ga0495595_0013214 | Ga0495595_0013214_1663_2961 | 432 |
| 738 | 3300053085 | Ga0495619_0011346 | Ga0495619_0011346_1753_3051 | 432 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4e1l-assembly1.cif.gz_C | crystal structure of acetoacetyl-coa thiolase (thla2) from clostridium difficile | 0.937 | 9 | 431 |
| 7n7z-assembly1.cif.gz_A-2 | structure of acetyl-coa acetyltransferase from syntrophomonas wolfei | 0.9361 | 9 | 431 |
| 5f38-assembly1.cif.gz_B | x-ray crystal structure of a thiolase from escherichia coli at 1.8 a resolution | 0.9359 | 8 | 432 |
| 4n45-assembly1.cif.gz_A | crystal structure of reduced form of thiolase from clostridium acetobutylicum | 0.9356 | 8 | 432 |
| 7ei4-assembly1.cif.gz_C | crystal structure of masl in complex with a novel covalent inhibitor, collimonin c | 0.9347 | 10 | 432 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5lp7C01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9418 | 9 | 298 | 3.40.47.10 |
| af_P76503_7_435_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9382 | 8 | 430 | 3.40.47.10 |
| 5lp7C01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9373 | 9 | 298 | 3.40.47.10 |
| af_A0A096MJY8_281_393_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9326 | 300 | 427 | 3.40.47.10 |
| 1dluC01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9318 | 11 | 295 | 3.40.47.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A377LXS3-F1-model_v4 | 3-ketoacyl-CoA thiolase (EC 2.3.1.16) | 0.977 | 282 | 430 |
GO:0003988
GO:0005829 GO:0044281 |
| AF-A0A7S2U634-F1-model_v4 | Thiolase N-terminal domain-containing protein | 0.9766 | 5 | 127 |
GO:0003985
GO:0005739 GO:0006635 |
| AF-A0A2T2TGQ5-F1-model_v4 | acetyl-CoA C-acyltransferase (EC 2.3.1.16) | 0.9716 | 292 | 432 |
GO:0003985
GO:0006635 |
| AF-A0A4C3Q699-F1-model_v4 | deleted | 0.9688 | 188 | 432 |
|
| AF-A0A7V6FD01-F1-model_v4 | acetyl-CoA C-acetyltransferase (EC 2.3.1.9) (Acetoacetyl-CoA thiolase) | 0.968 | 13 | 129 |
GO:0003985
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar