F478408
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 738 | 292 | 1476 | 297 |
Family's Representative Sequence
| Representative Sequence | 3300048911|Ga0496108_0000325|Ga0496108_0000325_36364_37335 |
| Length | 323 |
| Sequence | MPVAGRPTPRHPPQLREAGETNPMSTIGSPALTEAELKLLQALVYQECGMHFDDRRTHFLEDRLQRRLKECQLDSFYSYYRLLISQDGKHELARLLENLTVNETSFFRNKAQLDLFHKTILEDMLHYKQERRDYSLRFWSAGCSTGQEPYTIAMLVADALAYYYLRNPLPFDMPLPKPLIPPPWRVEIMASDISYSVLRAAQEGVYSETQMASVDYSYRLRYFDKVGDRYAIKKAVKELVHIDFHNLKTEFLPQRNDVIFCRNVMMYFDEAEQKRLIDKFYRCLNPNGFVLVGHAESLLGLTDKFQMVHRNAGTAYQRVEGRL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 88 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 116 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 120 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 121 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 122 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 123 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 124 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 125 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 187 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 188 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 192 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 197 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 198 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 199 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 200 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 201 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 203 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 204 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 205 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 206 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 207 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 208 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 209 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 211 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 213 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 215 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 217 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 218 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 221 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 222 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 223 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 224 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 225 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 228 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 229 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 230 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 231 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 232 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 233 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 234 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 235 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 236 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 237 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 238 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 239 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 269 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 270 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 271 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 272 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 273 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 274 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 276 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 277 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 278 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 279 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 280 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 281 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 282 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 284 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 285 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.51 |
| Metatranscriptomes | 1.49 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.88 |
| Rhizosphere | 94.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496108_0000325 | 3300048911 | Bacteria | 40507 |
| 2 | MBSR1b_contig_10381525 | 2162886012 | Unclassified | 2906 |
| 3 | MBSR1b_contig_11555807 | 2162886012 | Unclassified | 3601 |
| 4 | MBSR1b_contig_2529071 | 2162886012 | Unclassified | 3228 |
| 5 | LJNas_1000457 | 3300000546 | Bacteria | 7167 |
| 6 | JGI24743J22301_10011188 | 3300001991 | Bacteria | 1612 |
| 7 | JGI24034J26672_10007821 | 3300002239 | Bacteria | 1556 |
| 8 | rootL2_10145897 | 3300003322 | Unclassified | 2511 |
| 9 | Ga0058862_12832003 | 3300004803 | Bacteria | 1402 |
| 10 | Ga0065712_10108699 | 3300005290 | Unclassified | 1869 |
| 11 | Ga0065715_10092393 | 3300005293 | Bacteria | 5145 |
| 12 | Ga0065715_10103892 | 3300005293 | Bacteria | 3001 |
| 13 | Ga0070658_10239815 | 3300005327 | Bacteria | 1536 |
| 14 | Ga0070676_10002790 | 3300005328 | Bacteria | 9022 |
| 15 | Ga0070683_100008507 | 3300005329 | Bacteria | 8718 |
| 16 | Ga0070683_100105812 | 3300005329 | Bacteria | 2652 |
| 17 | Ga0070683_100122059 | 3300005329 | Bacteria | 2462 |
| 18 | Ga0070683_100124740 | 3300005329 | Bacteria | 2434 |
| 19 | Ga0070683_100468831 | 3300005329 | Bacteria | 1202 |
| 20 | Ga0070690_100003796 | 3300005330 | Bacteria | 8322 |
| 21 | Ga0070690_100045779 | 3300005330 | Bacteria | 2780 |
| 22 | Ga0070670_100014317 | 3300005331 | Bacteria | 6805 |
| 23 | Ga0068869_100000550 | 3300005334 | Bacteria | 20980 |
| 24 | Ga0068869_100352568 | 3300005334 | Bacteria | 1200 |
| 25 | Ga0070666_10385987 | 3300005335 | Unclassified | 1006 |
| 26 | Ga0070680_100000966 | 3300005336 | Bacteria | 20343 |
| 27 | Ga0070680_100141560 | 3300005336 | Bacteria | 2017 |
| 28 | Ga0070680_100196197 | 3300005336 | Unclassified | 1702 |
| 29 | Ga0070680_100239700 | 3300005336 | Bacteria | 1533 |
| 30 | Ga0070682_100049035 | 3300005337 | Bacteria | 2631 |
| 31 | Ga0070682_100080276 | 3300005337 | Unclassified | 2109 |
| 32 | Ga0070682_100293572 | 3300005337 | Bacteria | 1190 |
| 33 | Ga0068868_100008835 | 3300005338 | Bacteria | 7218 |
| 34 | Ga0068868_100026818 | 3300005338 | Bacteria | 4393 |
| 35 | Ga0068868_100054761 | 3300005338 | Bacteria | 3145 |
| 36 | Ga0068868_100163328 | 3300005338 | Unclassified | 1841 |
| 37 | Ga0070660_100045003 | 3300005339 | Bacteria | 3377 |
| 38 | Ga0070660_100110819 | 3300005339 | Unclassified | 2183 |
| 39 | Ga0070689_100060534 | 3300005340 | Bacteria | 2944 |
| 40 | Ga0070687_100011158 | 3300005343 | Bacteria | 3919 |
| 41 | Ga0070661_100046715 | 3300005344 | Bacteria | 3168 |
| 42 | Ga0070661_100060426 | 3300005344 | Bacteria | 2781 |
| 43 | Ga0070692_10143438 | 3300005345 | Bacteria | 1354 |
| 44 | Ga0070668_100009738 | 3300005347 | Bacteria | 7125 |
| 45 | Ga0070668_100185171 | 3300005347 | Unclassified | 1703 |
| 46 | Ga0070669_100018549 | 3300005353 | Bacteria | 4971 |
| 47 | Ga0070669_100317896 | 3300005353 | Unclassified | 1256 |
| 48 | Ga0070675_100128770 | 3300005354 | Unclassified | 2155 |
| 49 | Ga0070675_100465650 | 3300005354 | Unclassified | 1135 |
| 50 | Ga0070674_100130686 | 3300005356 | Unclassified | 1871 |
| 51 | Ga0070673_100010535 | 3300005364 | Bacteria | 6261 |
| 52 | Ga0070673_100457358 | 3300005364 | Bacteria | 1149 |
| 53 | Ga0070688_100033125 | 3300005365 | Bacteria | 3122 |
| 54 | Ga0070659_100005924 | 3300005366 | Bacteria | 8812 |
| 55 | Ga0070667_100274459 | 3300005367 | Unclassified | 1512 |
| 56 | Ga0070709_10001876 | 3300005434 | Bacteria | 11392 |
| 57 | Ga0070709_10015209 | 3300005434 | Bacteria | 4373 |
| 58 | Ga0070709_10018335 | 3300005434 | Bacteria | 4029 |
| 59 | Ga0070709_10049172 | 3300005434 | Bacteria | 2635 |
| 60 | Ga0070709_10052546 | 3300005434 | Bacteria | 2561 |
| 61 | Ga0070709_10289532 | 3300005434 | Bacteria | 1193 |
| 62 | Ga0070714_100000172 | 3300005435 | Bacteria | 52540 |
| 63 | Ga0070714_100034727 | 3300005435 | Bacteria | 4223 |
| 64 | Ga0070714_100045723 | 3300005435 | Bacteria | 3712 |
| 65 | Ga0070714_100383852 | 3300005435 | Bacteria | 1325 |
| 66 | Ga0070714_100424847 | 3300005435 | Bacteria | 1259 |
| 67 | Ga0070714_100523397 | 3300005435 | Bacteria | 1133 |
| 68 | Ga0070713_100000342 | 3300005436 | Bacteria | 30393 |
| 69 | Ga0070713_100000510 | 3300005436 | Bacteria | 24756 |
| 70 | Ga0070713_100012080 | 3300005436 | Bacteria | 6322 |
| 71 | Ga0070713_100014913 | 3300005436 | Bacteria | 5785 |
| 72 | Ga0070713_100017439 | 3300005436 | Bacteria | 5430 |
| 73 | Ga0070713_100021804 | 3300005436 | Bacteria | 4937 |
| 74 | Ga0070713_100023895 | 3300005436 | Bacteria | 4752 |
| 75 | Ga0070713_100038892 | 3300005436 | Bacteria | 3858 |
| 76 | Ga0070713_100062715 | 3300005436 | Bacteria | 3114 |
| 77 | Ga0070713_100209423 | 3300005436 | Bacteria | 1764 |
| 78 | Ga0070713_100269550 | 3300005436 | Bacteria | 1558 |
| 79 | Ga0070713_100303520 | 3300005436 | Bacteria | 1470 |
| 80 | Ga0070713_100390775 | 3300005436 | Bacteria | 1298 |
| 81 | Ga0070710_10001792 | 3300005437 | Bacteria | 10163 |
| 82 | Ga0070710_10009246 | 3300005437 | Bacteria | 4817 |
| 83 | Ga0070710_10064133 | 3300005437 | Bacteria | 2100 |
| 84 | Ga0070710_10152561 | 3300005437 | Unclassified | 1426 |
| 85 | Ga0070711_100000099 | 3300005439 | Bacteria | 45540 |
| 86 | Ga0070711_100009364 | 3300005439 | Bacteria | 6031 |
| 87 | Ga0070711_100024722 | 3300005439 | Bacteria | 3923 |
| 88 | Ga0070711_100058468 | 3300005439 | Bacteria | 2673 |
| 89 | Ga0070711_100098019 | 3300005439 | Bacteria | 2127 |
| 90 | Ga0070711_100105675 | 3300005439 | Bacteria | 2057 |
| 91 | Ga0070700_100040780 | 3300005441 | Unclassified | 2844 |
| 92 | Ga0070694_100143215 | 3300005444 | Bacteria | 1738 |
| 93 | Ga0070708_100002020 | 3300005445 | Bacteria | 15621 |
| 94 | Ga0070708_100012504 | 3300005445 | Bacteria | 6928 |
| 95 | Ga0070708_100027025 | 3300005445 | Bacteria | 4919 |
| 96 | Ga0070708_100089495 | 3300005445 | Unclassified | 2801 |
| 97 | Ga0070708_100189985 | 3300005445 | Bacteria | 1921 |
| 98 | Ga0070708_100202432 | 3300005445 | Bacteria | 1859 |
| 99 | Ga0070708_100332005 | 3300005445 | Bacteria | 1433 |
| 100 | Ga0070708_100449384 | 3300005445 | Bacteria | 1216 |
| 101 | Ga0070663_100055535 | 3300005455 | Bacteria | 2835 |
| 102 | Ga0070678_100235151 | 3300005456 | Bacteria | 1529 |
| 103 | Ga0070662_100028395 | 3300005457 | Bacteria | 3892 |
| 104 | Ga0070662_100056858 | 3300005457 | Unclassified | 2841 |
| 105 | Ga0070681_10001869 | 3300005458 | Bacteria | 19012 |
| 106 | Ga0070681_10030858 | 3300005458 | Bacteria | 5380 |
| 107 | Ga0070681_10040824 | 3300005458 | Bacteria | 4648 |
| 108 | Ga0070681_10135010 | 3300005458 | Bacteria | 2398 |
| 109 | Ga0070681_10136281 | 3300005458 | Bacteria | 2386 |
| 110 | Ga0070681_10221731 | 3300005458 | Bacteria | 1806 |
| 111 | Ga0070681_10271021 | 3300005458 | Bacteria | 1609 |
| 112 | Ga0070681_10284010 | 3300005458 | Bacteria | 1566 |
| 113 | Ga0070681_10285434 | 3300005458 | Bacteria | 1561 |
| 114 | Ga0068867_100011942 | 3300005459 | Bacteria | 6136 |
| 115 | Ga0068867_100088440 | 3300005459 | Bacteria | 2347 |
| 116 | Ga0070685_10005938 | 3300005466 | Bacteria | 6213 |
| 117 | Ga0070685_10176446 | 3300005466 | Bacteria | 1372 |
| 118 | Ga0070706_100000173 | 3300005467 | Bacteria | 81500 |
| 119 | Ga0070706_100013420 | 3300005467 | Bacteria | 7574 |
| 120 | Ga0070706_100105960 | 3300005467 | Unclassified | 2616 |
| 121 | Ga0070706_100159416 | 3300005467 | Bacteria | 2107 |
| 122 | Ga0070707_100000719 | 3300005468 | Bacteria | 33081 |
| 123 | Ga0070707_100002543 | 3300005468 | Bacteria | 17343 |
| 124 | Ga0070707_100031701 | 3300005468 | Bacteria | 5036 |
| 125 | Ga0070707_100072085 | 3300005468 | Bacteria | 3329 |
| 126 | Ga0070707_100151074 | 3300005468 | Unclassified | 2261 |
| 127 | Ga0070707_100770743 | 3300005468 | Bacteria | 925 |
| 128 | Ga0070698_100000162 | 3300005471 | Bacteria | 61345 |
| 129 | Ga0070698_100007167 | 3300005471 | Bacteria | 12080 |
| 130 | Ga0070698_100046263 | 3300005471 | Bacteria | 4449 |
| 131 | Ga0070698_100063129 | 3300005471 | Bacteria | 3736 |
| 132 | Ga0070699_100001096 | 3300005518 | Bacteria | 25207 |
| 133 | Ga0070699_100002540 | 3300005518 | Bacteria | 16392 |
| 134 | Ga0070699_100198433 | 3300005518 | Unclassified | 1784 |
| 135 | Ga0070699_100282924 | 3300005518 | Unclassified | 1486 |
| 136 | Ga0070699_100360994 | 3300005518 | Unclassified | 1310 |
| 137 | Ga0070699_100658660 | 3300005518 | Bacteria | 956 |
| 138 | Ga0070679_100000510 | 3300005530 | Bacteria | 33022 |
| 139 | Ga0070679_100000520 | 3300005530 | Bacteria | 32710 |
| 140 | Ga0070679_100030148 | 3300005530 | Bacteria | 5354 |
| 141 | Ga0070679_100190458 | 3300005530 | Bacteria | 2020 |
| 142 | Ga0070679_100770500 | 3300005530 | Bacteria | 905 |
| 143 | Ga0070684_100005565 | 3300005535 | Bacteria | 9670 |
| 144 | Ga0070684_100006304 | 3300005535 | Bacteria | 9166 |
| 145 | Ga0070684_100254228 | 3300005535 | Bacteria | 1606 |
| 146 | Ga0070684_100334411 | 3300005535 | Bacteria | 1392 |
| 147 | Ga0070697_100000194 | 3300005536 | Bacteria | 49634 |
| 148 | Ga0070697_100002639 | 3300005536 | Bacteria | 13795 |
| 149 | Ga0070697_100029174 | 3300005536 | Bacteria | 4421 |
| 150 | Ga0068853_100017447 | 3300005539 | Bacteria | 5924 |
| 151 | Ga0068853_100019840 | 3300005539 | Bacteria | 5584 |
| 152 | Ga0068853_100056849 | 3300005539 | Bacteria | 3374 |
| 153 | Ga0068853_100060553 | 3300005539 | Unclassified | 3271 |
| 154 | Ga0070672_100025283 | 3300005543 | Bacteria | 4401 |
| 155 | Ga0070686_100019750 | 3300005544 | Bacteria | 3976 |
| 156 | Ga0070704_100454610 | 3300005549 | Bacteria | 1103 |
| 157 | Ga0068855_100054000 | 3300005563 | Bacteria | 4725 |
| 158 | Ga0068855_100070492 | 3300005563 | Bacteria | 4066 |
| 159 | Ga0068855_100143113 | 3300005563 | Bacteria | 2724 |
| 160 | Ga0068855_100312429 | 3300005563 | Unclassified | 1738 |
| 161 | Ga0070664_100012980 | 3300005564 | Bacteria | 6778 |
| 162 | Ga0068857_100002662 | 3300005577 | Bacteria | 14661 |
| 163 | Ga0068857_100166016 | 3300005577 | Bacteria | 2005 |
| 164 | Ga0068854_100019451 | 3300005578 | Bacteria | 4577 |
| 165 | Ga0068854_100056700 | 3300005578 | Unclassified | 2824 |
| 166 | Ga0068854_100076758 | 3300005578 | Unclassified | 2456 |
| 167 | Ga0068854_100204328 | 3300005578 | Bacteria | 1555 |
| 168 | Ga0068856_100078529 | 3300005614 | Unclassified | 3272 |
| 169 | Ga0068856_100108659 | 3300005614 | Bacteria | 2770 |
| 170 | Ga0068856_100208281 | 3300005614 | Unclassified | 1970 |
| 171 | Ga0068856_100210396 | 3300005614 | Bacteria | 1960 |
| 172 | Ga0068856_100540491 | 3300005614 | Unclassified | 1186 |
| 173 | Ga0070702_100004820 | 3300005615 | Bacteria | 6201 |
| 174 | Ga0068852_100008725 | 3300005616 | Bacteria | 7494 |
| 175 | Ga0068852_100066133 | 3300005616 | Bacteria | 3156 |
| 176 | Ga0068852_100122769 | 3300005616 | Bacteria | 2381 |
| 177 | Ga0068859_100061519 | 3300005617 | Bacteria | 3783 |
| 178 | Ga0068859_100180875 | 3300005617 | Unclassified | 2191 |
| 179 | Ga0068864_100027756 | 3300005618 | Bacteria | 4783 |
| 180 | Ga0068864_100050144 | 3300005618 | Bacteria | 3592 |
| 181 | Ga0068864_100056258 | 3300005618 | Bacteria | 3399 |
| 182 | Ga0068866_10001944 | 3300005718 | Bacteria | 8612 |
| 183 | Ga0068851_10006235 | 3300005834 | Bacteria | 5441 |
| 184 | Ga0068851_10008933 | 3300005834 | Unclassified | 4647 |
| 185 | Ga0068870_10025939 | 3300005840 | Bacteria | 2915 |
| 186 | Ga0068863_100015876 | 3300005841 | Bacteria | 7223 |
| 187 | Ga0068863_100036664 | 3300005841 | Bacteria | 4671 |
| 188 | Ga0068863_100062287 | 3300005841 | Bacteria | 3528 |
| 189 | Ga0068863_100082639 | 3300005841 | Bacteria | 3044 |
| 190 | Ga0068863_100345653 | 3300005841 | Bacteria | 1448 |
| 191 | Ga0068858_100018536 | 3300005842 | Bacteria | 6516 |
| 192 | Ga0068858_100105877 | 3300005842 | Bacteria | 2625 |
| 193 | Ga0068858_100573562 | 3300005842 | Unclassified | 1093 |
| 194 | Ga0068860_100034790 | 3300005843 | Bacteria | 4833 |
| 195 | Ga0068860_100058239 | 3300005843 | Bacteria | 3672 |
| 196 | Ga0068862_100038124 | 3300005844 | Bacteria | 4075 |
| 197 | Ga0081455_10124268 | 3300005937 | Bacteria | 2028 |
| 198 | Ga0070717_10000837 | 3300006028 | Bacteria | 20360 |
| 199 | Ga0070717_10012939 | 3300006028 | Bacteria | 6373 |
| 200 | Ga0070717_10045526 | 3300006028 | Bacteria | 3587 |
| 201 | Ga0070717_10050844 | 3300006028 | Bacteria | 3408 |
| 202 | Ga0070717_10054722 | 3300006028 | Bacteria | 3291 |
| 203 | Ga0070717_10126995 | 3300006028 | Bacteria | 2190 |
| 204 | Ga0070717_10130489 | 3300006028 | Bacteria | 2161 |
| 205 | Ga0070717_10156475 | 3300006028 | Bacteria | 1975 |
| 206 | Ga0070717_10193292 | 3300006028 | Unclassified | 1779 |
| 207 | Ga0070715_10005176 | 3300006163 | Bacteria | 4332 |
| 208 | Ga0070715_10024056 | 3300006163 | Unclassified | 2394 |
| 209 | Ga0070716_100000315 | 3300006173 | Bacteria | 19472 |
| 210 | Ga0070716_100009262 | 3300006173 | Bacteria | 4907 |
| 211 | Ga0070716_100015509 | 3300006173 | Bacteria | 3916 |
| 212 | Ga0070716_100115425 | 3300006173 | Bacteria | 1671 |
| 213 | Ga0070716_100188957 | 3300006173 | Bacteria | 1359 |
| 214 | Ga0070712_100000546 | 3300006175 | Bacteria | 21742 |
| 215 | Ga0070712_100003075 | 3300006175 | Bacteria | 10319 |
| 216 | Ga0070712_100005278 | 3300006175 | Bacteria | 7994 |
| 217 | Ga0070712_100025709 | 3300006175 | Bacteria | 3915 |
| 218 | Ga0070712_100036638 | 3300006175 | Bacteria | 3339 |
| 219 | Ga0070712_100190548 | 3300006175 | Bacteria | 1604 |
| 220 | Ga0070712_100204899 | 3300006175 | Bacteria | 1552 |
| 221 | Ga0070712_100225602 | 3300006175 | Bacteria | 1485 |
| 222 | Ga0070712_100346634 | 3300006175 | Bacteria | 1214 |
| 223 | Ga0070712_100433194 | 3300006175 | Bacteria | 1092 |
| 224 | Ga0097621_100058974 | 3300006237 | Bacteria | 3141 |
| 225 | Ga0097621_100116896 | 3300006237 | Bacteria | 2259 |
| 226 | Ga0097621_100161306 | 3300006237 | Unclassified | 1927 |
| 227 | Ga0097621_100265093 | 3300006237 | Unclassified | 1508 |
| 228 | Ga0068871_100174696 | 3300006358 | Unclassified | 1843 |
| 229 | Ga0075433_10001164 | 3300006852 | Bacteria | 19108 |
| 230 | Ga0075433_10170259 | 3300006852 | Bacteria | 1938 |
| 231 | Ga0075434_100000041 | 3300006871 | Bacteria | 59536 |
| 232 | Ga0075434_100072900 | 3300006871 | Bacteria | 3426 |
| 233 | Ga0068865_100037031 | 3300006881 | Unclassified | 3292 |
| 234 | Ga0075436_100017155 | 3300006914 | Bacteria | 4956 |
| 235 | Ga0075436_100203583 | 3300006914 | Bacteria | 1402 |
| 236 | Ga0097620_100061520 | 3300006931 | Bacteria | 3783 |
| 237 | Ga0097620_100180848 | 3300006931 | Unclassified | 2191 |
| 238 | Ga0075435_100000105 | 3300007076 | Bacteria | 45736 |
| 239 | Ga0075435_100024950 | 3300007076 | Bacteria | 4648 |
| 240 | Ga0075435_100056238 | 3300007076 | Bacteria | 3180 |
| 241 | Ga0075435_100332039 | 3300007076 | Unclassified | 1302 |
| 242 | Ga0099794_10003333 | 3300007265 | Bacteria | 6103 |
| 243 | Ga0099794_10012324 | 3300007265 | Unclassified | 3686 |
| 244 | Ga0099794_10098222 | 3300007265 | Bacteria | 1460 |
| 245 | Ga0105250_10069312 | 3300009092 | Unclassified | 1424 |
| 246 | Ga0105240_10006795 | 3300009093 | Bacteria | 16736 |
| 247 | Ga0105240_10020033 | 3300009093 | Bacteria | 8930 |
| 248 | Ga0105240_10020074 | 3300009093 | Bacteria | 8921 |
| 249 | Ga0105240_10084816 | 3300009093 | Bacteria | 3883 |
| 250 | Ga0105240_10257351 | 3300009093 | Bacteria | 2015 |
| 251 | Ga0105245_10003453 | 3300009098 | Bacteria | 14159 |
| 252 | Ga0105245_10058109 | 3300009098 | Bacteria | 3481 |
| 253 | Ga0105245_10067483 | 3300009098 | Bacteria | 3239 |
| 254 | Ga0105245_10075850 | 3300009098 | Bacteria | 3062 |
| 255 | Ga0105247_10006289 | 3300009101 | Bacteria | 7361 |
| 256 | Ga0105241_10005248 | 3300009174 | Bacteria | 9568 |
| 257 | Ga0105241_10009745 | 3300009174 | Bacteria | 7060 |
| 258 | Ga0105241_10010180 | 3300009174 | Bacteria | 6907 |
| 259 | Ga0105241_10089286 | 3300009174 | Bacteria | 2428 |
| 260 | Ga0105241_10196006 | 3300009174 | Bacteria | 1684 |
| 261 | Ga0105241_10244496 | 3300009174 | Bacteria | 1518 |
| 262 | Ga0105242_10416482 | 3300009176 | Unclassified | 1258 |
| 263 | Ga0105248_10010789 | 3300009177 | Bacteria | 10087 |
| 264 | Ga0105248_10168359 | 3300009177 | Bacteria | 2470 |
| 265 | Ga0105248_10230295 | 3300009177 | Unclassified | 2086 |
| 266 | Ga0105248_10353125 | 3300009177 | Unclassified | 1655 |
| 267 | Ga0105248_10735084 | 3300009177 | Unclassified | 1113 |
| 268 | Ga0105237_10090858 | 3300009545 | Unclassified | 3043 |
| 269 | Ga0105237_10116949 | 3300009545 | Bacteria | 2660 |
| 270 | Ga0105237_10162375 | 3300009545 | Bacteria | 2233 |
| 271 | Ga0105238_10005181 | 3300009551 | Bacteria | 12883 |
| 272 | Ga0105238_10107430 | 3300009551 | Bacteria | 2771 |
| 273 | Ga0105238_10113491 | 3300009551 | Unclassified | 2689 |
| 274 | Ga0105238_10170043 | 3300009551 | Bacteria | 2155 |
| 275 | Ga0105238_10316294 | 3300009551 | Unclassified | 1547 |
| 276 | Ga0105249_10011376 | 3300009553 | Bacteria | 7814 |
| 277 | Ga0105249_10105191 | 3300009553 | Unclassified | 2660 |
| 278 | Ga0099796_10013449 | 3300010159 | Bacteria | 2338 |
| 279 | Ga0105239_10038771 | 3300010375 | Bacteria | 5220 |
| 280 | Ga0105239_10753082 | 3300010375 | Bacteria | 1115 |
| 281 | Ga0105239_10770551 | 3300010375 | Bacteria | 1102 |
| 282 | Ga0105246_10035400 | 3300011119 | Bacteria | 3337 |
| 283 | Ga0157373_10004158 | 3300013100 | Bacteria | 10914 |
| 284 | Ga0157373_10045027 | 3300013100 | Bacteria | 3150 |
| 285 | Ga0157371_10004724 | 3300013102 | Bacteria | 11769 |
| 286 | Ga0157370_10105012 | 3300013104 | Bacteria | 2645 |
| 287 | Ga0157370_10141224 | 3300013104 | Bacteria | 2244 |
| 288 | Ga0157369_10026010 | 3300013105 | Bacteria | 6494 |
| 289 | Ga0157369_10032939 | 3300013105 | Bacteria | 5695 |
| 290 | Ga0157369_10037623 | 3300013105 | Bacteria | 5297 |
| 291 | Ga0157369_10102992 | 3300013105 | Bacteria | 3040 |
| 292 | Ga0157369_10137163 | 3300013105 | Bacteria | 2589 |
| 293 | Ga0157369_10217159 | 3300013105 | Bacteria | 2002 |
| 294 | Ga0157369_10347333 | 3300013105 | Bacteria | 1541 |
| 295 | Ga0157374_10022187 | 3300013296 | Bacteria | 5661 |
| 296 | Ga0157374_10046665 | 3300013296 | Bacteria | 4013 |
| 297 | Ga0157374_10065747 | 3300013296 | Bacteria | 3406 |
| 298 | Ga0157374_10108358 | 3300013296 | Bacteria | 2670 |
| 299 | Ga0157374_10115790 | 3300013296 | Bacteria | 2582 |
| 300 | Ga0157374_10271062 | 3300013296 | Unclassified | 1674 |
| 301 | Ga0157378_10018892 | 3300013297 | Bacteria | 6058 |
| 302 | Ga0157378_10074344 | 3300013297 | Bacteria | 3058 |
| 303 | Ga0157378_10113990 | 3300013297 | Bacteria | 2483 |
| 304 | Ga0157378_10437812 | 3300013297 | Bacteria | 1295 |
| 305 | Ga0163162_10132089 | 3300013306 | Bacteria | 2606 |
| 306 | Ga0163162_10148808 | 3300013306 | Bacteria | 2458 |
| 307 | Ga0157372_10142621 | 3300013307 | Bacteria | 2761 |
| 308 | Ga0157372_10144089 | 3300013307 | Bacteria | 2747 |
| 309 | Ga0157372_10223391 | 3300013307 | Bacteria | 2183 |
| 310 | Ga0157372_10252204 | 3300013307 | Bacteria | 2048 |
| 311 | Ga0157372_10581714 | 3300013307 | Bacteria | 1305 |
| 312 | Ga0157372_10598251 | 3300013307 | Bacteria | 1285 |
| 313 | Ga0157375_10111416 | 3300013308 | Bacteria | 2835 |
| 314 | Ga0163163_10002469 | 3300014325 | Bacteria | 15630 |
| 315 | Ga0163163_10002705 | 3300014325 | Bacteria | 14974 |
| 316 | Ga0163163_10005504 | 3300014325 | Bacteria | 10962 |
| 317 | Ga0163163_10007476 | 3300014325 | Bacteria | 9642 |
| 318 | Ga0163163_10011914 | 3300014325 | Bacteria | 7911 |
| 319 | Ga0163163_10172295 | 3300014325 | Bacteria | 2211 |
| 320 | Ga0182008_10004982 | 3300014497 | Bacteria | 7644 |
| 321 | Ga0182008_10188387 | 3300014497 | Bacteria | 1046 |
| 322 | Ga0157377_10001020 | 3300014745 | Bacteria | 11815 |
| 323 | Ga0157377_10258259 | 3300014745 | Unclassified | 1132 |
| 324 | Ga0157379_10014150 | 3300014968 | Bacteria | 6996 |
| 325 | Ga0157379_10019365 | 3300014968 | Bacteria | 6011 |
| 326 | Ga0157379_10024289 | 3300014968 | Bacteria | 5382 |
| 327 | Ga0157376_10009736 | 3300014969 | Bacteria | 6997 |
| 328 | Ga0157376_10059670 | 3300014969 | Bacteria | 3199 |
| 329 | Ga0157376_10078340 | 3300014969 | Unclassified | 2830 |
| 330 | Ga0157376_10412477 | 3300014969 | Unclassified | 1309 |
| 331 | Ga0182006_1057591 | 3300015261 | Unclassified | 1477 |
| 332 | Ga0182006_1063624 | 3300015261 | Unclassified | 1385 |
| 333 | Ga0182007_10003288 | 3300015262 | Bacteria | 7672 |
| 334 | Ga0182007_10005070 | 3300015262 | Bacteria | 5851 |
| 335 | Ga0182005_1010937 | 3300015265 | Bacteria | 2600 |
| 336 | Ga0163161_10007272 | 3300017792 | Bacteria | 7645 |
| 337 | Ga0154015_1151417 | 3300020610 | Bacteria | 4162 |
| 338 | Ga0213874_10011227 | 3300021377 | Bacteria | 2263 |
| 339 | Ga0213874_10013760 | 3300021377 | Bacteria | 2104 |
| 340 | Ga0224570_100845 | 3300022730 | Bacteria | 2445 |
| 341 | Ga0224571_100909 | 3300022734 | Unclassified | 1773 |
| 342 | Ga0224572_1003971 | 3300024225 | Bacteria | 2539 |
| 343 | Ga0228598_1000222 | 3300024227 | Bacteria | 10731 |
| 344 | Ga0228598_1002594 | 3300024227 | Bacteria | 3926 |
| 345 | Ga0228598_1003622 | 3300024227 | Bacteria | 3313 |
| 346 | Ga0207697_10025446 | 3300025315 | Bacteria | 2419 |
| 347 | Ga0207656_10043180 | 3300025321 | Bacteria | 1921 |
| 348 | Ga0207682_10063620 | 3300025893 | Bacteria | 1549 |
| 349 | Ga0207692_10122553 | 3300025898 | Bacteria | 1458 |
| 350 | Ga0207692_10127192 | 3300025898 | Unclassified | 1435 |
| 351 | Ga0207692_10134960 | 3300025898 | Bacteria | 1398 |
| 352 | Ga0207692_10248277 | 3300025898 | Bacteria | 1065 |
| 353 | Ga0207642_10012636 | 3300025899 | Bacteria | 3055 |
| 354 | Ga0207688_10024685 | 3300025901 | Bacteria | 3298 |
| 355 | Ga0207680_10094776 | 3300025903 | Unclassified | 1906 |
| 356 | Ga0207680_10368309 | 3300025903 | Unclassified | 1011 |
| 357 | Ga0207647_10003441 | 3300025904 | Bacteria | 11878 |
| 358 | Ga0207647_10008016 | 3300025904 | Bacteria | 7596 |
| 359 | Ga0207685_10000821 | 3300025905 | Bacteria | 5770 |
| 360 | Ga0207685_10010386 | 3300025905 | Unclassified | 2748 |
| 361 | Ga0207685_10100487 | 3300025905 | Bacteria | 1236 |
| 362 | Ga0207699_10001324 | 3300025906 | Bacteria | 11774 |
| 363 | Ga0207699_10007254 | 3300025906 | Bacteria | 5412 |
| 364 | Ga0207699_10023775 | 3300025906 | Bacteria | 3340 |
| 365 | Ga0207699_10033998 | 3300025906 | Bacteria | 2886 |
| 366 | Ga0207699_10041331 | 3300025906 | Bacteria | 2662 |
| 367 | Ga0207699_10051403 | 3300025906 | Bacteria | 2435 |
| 368 | Ga0207699_10078206 | 3300025906 | Bacteria | 2043 |
| 369 | Ga0207699_10107456 | 3300025906 | Bacteria | 1782 |
| 370 | Ga0207699_10118986 | 3300025906 | Bacteria | 1705 |
| 371 | Ga0207699_10128681 | 3300025906 | Bacteria | 1648 |
| 372 | Ga0207699_10138055 | 3300025906 | Bacteria | 1599 |
| 373 | Ga0207699_10199769 | 3300025906 | Bacteria | 1354 |
| 374 | Ga0207645_10000181 | 3300025907 | Bacteria | 50200 |
| 375 | Ga0207643_10001458 | 3300025908 | Bacteria | 13565 |
| 376 | Ga0207684_10000217 | 3300025910 | Bacteria | 88691 |
| 377 | Ga0207684_10000267 | 3300025910 | Bacteria | 77172 |
| 378 | Ga0207684_10031119 | 3300025910 | Bacteria | 4542 |
| 379 | Ga0207684_10111242 | 3300025910 | Unclassified | 2344 |
| 380 | Ga0207654_10136729 | 3300025911 | Bacteria | 1558 |
| 381 | Ga0207654_10200913 | 3300025911 | Bacteria | 1312 |
| 382 | Ga0207707_10012342 | 3300025912 | Bacteria | 7424 |
| 383 | Ga0207707_10014434 | 3300025912 | Bacteria | 6882 |
| 384 | Ga0207707_10025947 | 3300025912 | Bacteria | 5123 |
| 385 | Ga0207707_10037745 | 3300025912 | Bacteria | 4221 |
| 386 | Ga0207707_10053833 | 3300025912 | Bacteria | 3503 |
| 387 | Ga0207707_10216738 | 3300025912 | Bacteria | 1666 |
| 388 | Ga0207695_10015503 | 3300025913 | Bacteria | 8969 |
| 389 | Ga0207695_10216134 | 3300025913 | Bacteria | 1826 |
| 390 | Ga0207695_10265463 | 3300025913 | Bacteria | 1613 |
| 391 | Ga0207671_10052924 | 3300025914 | Unclassified | 3009 |
| 392 | Ga0207671_10192972 | 3300025914 | Bacteria | 1589 |
| 393 | Ga0207693_10000089 | 3300025915 | Bacteria | 81143 |
| 394 | Ga0207693_10000106 | 3300025915 | Bacteria | 75776 |
| 395 | Ga0207693_10009582 | 3300025915 | Bacteria | 7887 |
| 396 | Ga0207693_10029248 | 3300025915 | Bacteria | 4353 |
| 397 | Ga0207693_10041981 | 3300025915 | Bacteria | 3600 |
| 398 | Ga0207693_10089412 | 3300025915 | Bacteria | 2413 |
| 399 | Ga0207693_10095356 | 3300025915 | Bacteria | 2332 |
| 400 | Ga0207693_10114199 | 3300025915 | Bacteria | 2119 |
| 401 | Ga0207693_10132917 | 3300025915 | Bacteria | 1956 |
| 402 | Ga0207693_10185688 | 3300025915 | Unclassified | 1637 |
| 403 | Ga0207693_10241303 | 3300025915 | Bacteria | 1418 |
| 404 | Ga0207663_10002155 | 3300025916 | Bacteria | 9394 |
| 405 | Ga0207663_10017636 | 3300025916 | Bacteria | 3983 |
| 406 | Ga0207663_10127279 | 3300025916 | Unclassified | 1754 |
| 407 | Ga0207663_10240979 | 3300025916 | Bacteria | 1326 |
| 408 | Ga0207663_10321959 | 3300025916 | Bacteria | 1162 |
| 409 | Ga0207660_10000386 | 3300025917 | Bacteria | 28948 |
| 410 | Ga0207660_10181183 | 3300025917 | Bacteria | 1636 |
| 411 | Ga0207660_10305961 | 3300025917 | Unclassified | 1267 |
| 412 | Ga0207662_10013877 | 3300025918 | Bacteria | 4510 |
| 413 | Ga0207657_10000535 | 3300025919 | Bacteria | 40427 |
| 414 | Ga0207657_10001828 | 3300025919 | Bacteria | 22959 |
| 415 | Ga0207649_10000350 | 3300025920 | Bacteria | 34881 |
| 416 | Ga0207652_10000313 | 3300025921 | Bacteria | 50018 |
| 417 | Ga0207652_10050618 | 3300025921 | Bacteria | 3560 |
| 418 | Ga0207652_10077577 | 3300025921 | Bacteria | 2899 |
| 419 | Ga0207652_10172465 | 3300025921 | Bacteria | 1941 |
| 420 | Ga0207646_10000296 | 3300025922 | Bacteria | 67683 |
| 421 | Ga0207646_10001311 | 3300025922 | Bacteria | 30882 |
| 422 | Ga0207646_10047963 | 3300025922 | Bacteria | 3829 |
| 423 | Ga0207646_10055621 | 3300025922 | Bacteria | 3538 |
| 424 | Ga0207646_10146400 | 3300025922 | Unclassified | 2129 |
| 425 | Ga0207646_10176492 | 3300025922 | Bacteria | 1930 |
| 426 | Ga0207646_10224130 | 3300025922 | Bacteria | 1698 |
| 427 | Ga0207681_10089797 | 3300025923 | Unclassified | 2191 |
| 428 | Ga0207681_10256425 | 3300025923 | Unclassified | 1368 |
| 429 | Ga0207694_10044564 | 3300025924 | Bacteria | 3425 |
| 430 | Ga0207694_10162381 | 3300025924 | Unclassified | 1805 |
| 431 | Ga0207650_10000223 | 3300025925 | Bacteria | 64087 |
| 432 | Ga0207650_10328683 | 3300025925 | Bacteria | 1253 |
| 433 | Ga0207659_10007479 | 3300025926 | Bacteria | 6721 |
| 434 | Ga0207687_10001701 | 3300025927 | Bacteria | 15166 |
| 435 | Ga0207687_10166810 | 3300025927 | Unclassified | 1695 |
| 436 | Ga0207700_10000289 | 3300025928 | Bacteria | 29760 |
| 437 | Ga0207700_10001827 | 3300025928 | Bacteria | 12063 |
| 438 | Ga0207700_10001971 | 3300025928 | Bacteria | 11690 |
| 439 | Ga0207700_10005081 | 3300025928 | Bacteria | 7824 |
| 440 | Ga0207700_10005232 | 3300025928 | Bacteria | 7732 |
| 441 | Ga0207700_10060430 | 3300025928 | Bacteria | 2870 |
| 442 | Ga0207700_10078662 | 3300025928 | Bacteria | 2566 |
| 443 | Ga0207700_10481931 | 3300025928 | Bacteria | 1096 |
| 444 | Ga0207700_10557662 | 3300025928 | Bacteria | 1017 |
| 445 | Ga0207664_10000118 | 3300025929 | Bacteria | 69258 |
| 446 | Ga0207664_10177474 | 3300025929 | Bacteria | 1827 |
| 447 | Ga0207664_10238198 | 3300025929 | Bacteria | 1584 |
| 448 | Ga0207664_10326294 | 3300025929 | Bacteria | 1355 |
| 449 | Ga0207664_10465897 | 3300025929 | Bacteria | 1129 |
| 450 | Ga0207644_10010014 | 3300025931 | Bacteria | 6240 |
| 451 | Ga0207690_10130674 | 3300025932 | Unclassified | 1837 |
| 452 | Ga0207690_10137663 | 3300025932 | Bacteria | 1795 |
| 453 | Ga0207690_10184015 | 3300025932 | Bacteria | 1575 |
| 454 | Ga0207706_10009803 | 3300025933 | Bacteria | 8789 |
| 455 | Ga0207706_10016556 | 3300025933 | Bacteria | 6656 |
| 456 | Ga0207670_10028033 | 3300025936 | Bacteria | 3569 |
| 457 | Ga0207704_10101902 | 3300025938 | Bacteria | 1916 |
| 458 | Ga0207665_10001184 | 3300025939 | Bacteria | 17548 |
| 459 | Ga0207665_10001526 | 3300025939 | Bacteria | 15570 |
| 460 | Ga0207665_10003365 | 3300025939 | Bacteria | 10702 |
| 461 | Ga0207665_10025014 | 3300025939 | Bacteria | 3937 |
| 462 | Ga0207665_10029557 | 3300025939 | Bacteria | 3622 |
| 463 | Ga0207665_10096517 | 3300025939 | Bacteria | 2056 |
| 464 | Ga0207665_10249788 | 3300025939 | Bacteria | 1310 |
| 465 | Ga0207691_10000345 | 3300025940 | Bacteria | 46775 |
| 466 | Ga0207711_10057834 | 3300025941 | Unclassified | 3334 |
| 467 | Ga0207711_10142033 | 3300025941 | Unclassified | 2161 |
| 468 | Ga0207711_10382228 | 3300025941 | Bacteria | 1307 |
| 469 | Ga0207689_10000499 | 3300025942 | Bacteria | 37043 |
| 470 | Ga0207689_10004722 | 3300025942 | Bacteria | 12297 |
| 471 | Ga0207661_10006500 | 3300025944 | Bacteria | 8264 |
| 472 | Ga0207661_10115990 | 3300025944 | Bacteria | 2273 |
| 473 | Ga0207661_10127164 | 3300025944 | Bacteria | 2178 |
| 474 | Ga0207679_10000115 | 3300025945 | Bacteria | 64466 |
| 475 | Ga0207667_10024023 | 3300025949 | Bacteria | 6704 |
| 476 | Ga0207667_10152110 | 3300025949 | Unclassified | 2381 |
| 477 | Ga0207667_10221587 | 3300025949 | Unclassified | 1938 |
| 478 | Ga0207667_10305379 | 3300025949 | Bacteria | 1626 |
| 479 | Ga0207651_10003270 | 3300025960 | Bacteria | 7932 |
| 480 | Ga0207651_10414021 | 3300025960 | Bacteria | 1149 |
| 481 | Ga0207712_10083293 | 3300025961 | Unclassified | 2334 |
| 482 | Ga0207640_10042800 | 3300025981 | Bacteria | 2890 |
| 483 | Ga0207640_10060894 | 3300025981 | Unclassified | 2497 |
| 484 | Ga0207640_10093081 | 3300025981 | Bacteria | 2093 |
| 485 | Ga0207658_10061088 | 3300025986 | Unclassified | 2814 |
| 486 | Ga0207677_10002530 | 3300026023 | Bacteria | 9583 |
| 487 | Ga0207677_10264018 | 3300026023 | Bacteria | 1405 |
| 488 | Ga0207703_10068035 | 3300026035 | Bacteria | 2933 |
| 489 | Ga0207639_10007368 | 3300026041 | Bacteria | 7501 |
| 490 | Ga0207639_10151559 | 3300026041 | Unclassified | 1942 |
| 491 | Ga0207678_10000130 | 3300026067 | Bacteria | 63279 |
| 492 | Ga0207708_10053203 | 3300026075 | Unclassified | 3084 |
| 493 | Ga0207702_10156112 | 3300026078 | Unclassified | 2080 |
| 494 | Ga0207702_10312437 | 3300026078 | Bacteria | 1494 |
| 495 | Ga0207641_10000287 | 3300026088 | Bacteria | 63251 |
| 496 | Ga0207641_10048218 | 3300026088 | Bacteria | 3595 |
| 497 | Ga0207641_10124770 | 3300026088 | Bacteria | 2304 |
| 498 | Ga0207641_10153880 | 3300026088 | Bacteria | 2085 |
| 499 | Ga0207648_10001253 | 3300026089 | Bacteria | 28381 |
| 500 | Ga0207648_10060156 | 3300026089 | Bacteria | 3313 |
| 501 | Ga0207676_10000115 | 3300026095 | Bacteria | 71633 |
| 502 | Ga0207676_10115468 | 3300026095 | Bacteria | 2254 |
| 503 | Ga0207676_10365792 | 3300026095 | Unclassified | 1338 |
| 504 | Ga0207674_10001340 | 3300026116 | Bacteria | 31912 |
| 505 | Ga0207674_10091093 | 3300026116 | Bacteria | 3040 |
| 506 | Ga0207674_10102775 | 3300026116 | Bacteria | 2837 |
| 507 | Ga0207683_10000217 | 3300026121 | Bacteria | 50192 |
| 508 | Ga0207698_10038291 | 3300026142 | Bacteria | 3542 |
| 509 | Ga0207698_10123110 | 3300026142 | Bacteria | 2199 |
| 510 | Ga0207698_10341285 | 3300026142 | Unclassified | 1411 |
| 511 | Ga0209588_1043516 | 3300027671 | Bacteria | 1451 |
| 512 | Ga0265356_1000336 | 3300028017 | Bacteria | 8653 |
| 513 | Ga0265356_1001239 | 3300028017 | Bacteria | 3865 |
| 514 | Ga0265355_1000515 | 3300028036 | Bacteria | 2056 |
| 515 | Ga0268266_10008412 | 3300028379 | Bacteria | 9174 |
| 516 | Ga0268265_10137853 | 3300028380 | Unclassified | 2038 |
| 517 | Ga0268265_10248615 | 3300028380 | Bacteria | 1573 |
| 518 | Ga0268264_10014054 | 3300028381 | Bacteria | 6580 |
| 519 | Ga0268264_10030440 | 3300028381 | Bacteria | 4423 |
| 520 | Ga0265319_1020505 | 3300028563 | Bacteria | 2448 |
| 521 | Ga0265338_10015046 | 3300028800 | Bacteria | 8540 |
| 522 | Ga0265338_10030980 | 3300028800 | Bacteria | 5254 |
| 523 | Ga0265338_10045521 | 3300028800 | Bacteria | 4032 |
| 524 | Ga0265338_10046475 | 3300028800 | Bacteria | 3978 |
| 525 | Ga0265338_10176189 | 3300028800 | Bacteria | 1634 |
| 526 | Ga0265762_1000608 | 3300030760 | Bacteria | 6313 |
| 527 | Ga0265762_1021513 | 3300030760 | Bacteria | 1190 |
| 528 | Ga0265770_1017026 | 3300030878 | Unclassified | 1119 |
| 529 | Ga0265760_10000331 | 3300031090 | Bacteria | 13250 |
| 530 | Ga0265760_10000650 | 3300031090 | Bacteria | 9848 |
| 531 | Ga0265760_10001481 | 3300031090 | Bacteria | 6917 |
| 532 | Ga0265760_10004482 | 3300031090 | Bacteria | 4009 |
| 533 | Ga0265760_10012473 | 3300031090 | Bacteria | 2430 |
| 534 | Ga0265760_10023198 | 3300031090 | Bacteria | 1802 |
| 535 | Ga0265325_10008604 | 3300031241 | Bacteria | 6012 |
| 536 | Ga0265325_10104212 | 3300031241 | Bacteria | 1385 |
| 537 | Ga0265340_10065999 | 3300031247 | Bacteria | 1723 |
| 538 | Ga0265339_10005007 | 3300031249 | Bacteria | 8914 |
| 539 | Ga0265339_10095478 | 3300031249 | Unclassified | 1553 |
| 540 | Ga0265316_10002496 | 3300031344 | Bacteria | 19052 |
| 541 | Ga0265316_10045238 | 3300031344 | Unclassified | 3496 |
| 542 | Ga0265316_10068611 | 3300031344 | Bacteria | 2738 |
| 543 | Ga0307408_100007923 | 3300031548 | Bacteria | 7024 |
| 544 | Ga0307408_100061387 | 3300031548 | Bacteria | 2744 |
| 545 | Ga0307408_100089449 | 3300031548 | Bacteria | 2321 |
| 546 | Ga0265314_10002671 | 3300031711 | Bacteria | 17879 |
| 547 | Ga0265314_10131280 | 3300031711 | Bacteria | 1562 |
| 548 | Ga0265314_10214500 | 3300031711 | Unclassified | 1128 |
| 549 | Ga0265314_10216439 | 3300031711 | Unclassified | 1121 |
| 550 | Ga0307410_10026323 | 3300031852 | Bacteria | 3660 |
| 551 | Ga0307410_10214071 | 3300031852 | Bacteria | 1478 |
| 552 | Ga0307410_10312864 | 3300031852 | Bacteria | 1243 |
| 553 | Ga0307407_10251647 | 3300031903 | Bacteria | 1211 |
| 554 | Ga0307409_100006898 | 3300031995 | Bacteria | 6734 |
| 555 | Ga0307409_100009620 | 3300031995 | Bacteria | 5953 |
| 556 | Ga0307416_100037366 | 3300032002 | Bacteria | 3736 |
| 557 | Ga0307416_100134877 | 3300032002 | Bacteria | 2231 |
| 558 | Ga0307411_10045107 | 3300032005 | Bacteria | 2834 |
| 559 | Ga0307415_100005529 | 3300032126 | Bacteria | 6721 |
| 560 | Ga0307415_100152167 | 3300032126 | Bacteria | 1782 |
| 561 | Ga0373926_0005908 | 3300035083 | Bacteria | 4047 |
| 562 | Ga0373926_0012041 | 3300035083 | Unclassified | 2920 |
| 563 | Ga0373934_0004825 | 3300035086 | Bacteria | 4988 |
| 564 | Ga0373934_0119387 | 3300035086 | Bacteria | 1072 |
| 565 | Ga0373944_0027690 | 3300035089 | Bacteria | 1682 |
| 566 | Ga0373923_0014035 | 3300035111 | Unclassified | 3000 |
| 567 | Ga0373923_0018837 | 3300035111 | Unclassified | 2664 |
| 568 | Ga0373923_0026834 | 3300035111 | Bacteria | 2293 |
| 569 | Ga0373936_0002361 | 3300035113 | Bacteria | 7064 |
| 570 | Ga0373936_0003897 | 3300035113 | Bacteria | 5619 |
| 571 | Ga0373945_0000938 | 3300035116 | Bacteria | 8686 |
| 572 | Ga0373954_0013396 | 3300035118 | Bacteria | 3654 |
| 573 | Ga0373956_0027367 | 3300035119 | Bacteria | 2475 |
| 574 | Ga0373956_0060763 | 3300035119 | Bacteria | 1711 |
| 575 | Ga0373956_0063953 | 3300035119 | Bacteria | 1670 |
| 576 | Ga0373957_0017954 | 3300035120 | Bacteria | 2471 |
| 577 | Ga0373943_0000054 | 3300035170 | Bacteria | 38966 |
| 578 | Ga0373943_0051067 | 3300035170 | Bacteria | 2034 |
| 579 | Ga0373946_0024678 | 3300035171 | Unclassified | 2359 |
| 580 | Ga0373946_0035108 | 3300035171 | Bacteria | 2028 |
| 581 | Ga0373955_0087177 | 3300035172 | Bacteria | 1774 |
| 582 | Ga0373955_0123386 | 3300035172 | Unclassified | 1507 |
| 583 | Ga0373924_0000069 | 3300035410 | Bacteria | 27343 |
| 584 | Ga0373924_0013406 | 3300035410 | Unclassified | 3080 |
| 585 | Ga0373935_0004095 | 3300035692 | Bacteria | 8527 |
| 586 | Ga0373935_0004100 | 3300035692 | Bacteria | 8523 |
| 587 | Ga0373935_0172120 | 3300035692 | Bacteria | 1482 |
| 588 | Ga0373927_0003435 | 3300035695 | Bacteria | 11345 |
| 589 | Ga0373927_0029772 | 3300035695 | Bacteria | 3561 |
| 590 | Ga0373933_0000116 | 3300035724 | Bacteria | 51474 |
| 591 | Ga0373933_0039746 | 3300035724 | Bacteria | 2768 |
| 592 | Ga0373933_0056429 | 3300035724 | Bacteria | 2358 |
| 593 | Ga0373947_0000496 | 3300035725 | Bacteria | 22749 |
| 594 | Ga0373947_0071534 | 3300035725 | Bacteria | 2127 |
| 595 | Ga0373947_0195915 | 3300035725 | Bacteria | 1320 |
| 596 | Ga0373937_0000001 | 3300036401 | Bacteria | 478903 |
| 597 | Ga0373937_0000038 | 3300036401 | Bacteria | 110582 |
| 598 | Ga0373937_0012481 | 3300036401 | Bacteria | 7475 |
| 599 | Ga0373937_0122709 | 3300036401 | Unclassified | 2422 |
| 600 | Ga0373937_0159617 | 3300036401 | Bacteria | 2114 |
| 601 | Ga0373937_0164449 | 3300036401 | Bacteria | 2080 |
| 602 | Ga0373937_0242905 | 3300036401 | Bacteria | 1697 |
| 603 | Ga0373937_0513774 | 3300036401 | Bacteria | 1138 |
| 604 | Ga0373925_0004981 | 3300037068 | Bacteria | 9972 |
| 605 | Ga0373925_0040640 | 3300037068 | Bacteria | 3444 |
| 606 | Ga0373925_0240196 | 3300037068 | Bacteria | 1450 |
| 607 | Ga0395898_0080946 | 3300037466 | Bacteria | 3132 |
| 608 | Ga0395898_0238555 | 3300037466 | Bacteria | 1734 |
| 609 | Ga0395898_0248697 | 3300037466 | Bacteria | 1696 |
| 610 | Ga0395905_0004834 | 3300037471 | Bacteria | 13892 |
| 611 | Ga0395905_0007187 | 3300037471 | Bacteria | 11120 |
| 612 | Ga0395905_0272328 | 3300037471 | Bacteria | 1579 |
| 613 | Ga0436365_1581751 | 3300039437 | Bacteria | 1756 |
| 614 | Ga0436360_0737567 | 3300039438 | Bacteria | 1283 |
| 615 | Ga0436363_0122844 | 3300039450 | Bacteria | 2074 |
| 616 | Ga0436363_0123919 | 3300039450 | Bacteria | 3063 |
| 617 | Ga0436363_1694091 | 3300039450 | Bacteria | 2791 |
| 618 | Ga0451577_0163976 | 3300042876 | Bacteria | 2002 |
| 619 | Ga0451577_0276542 | 3300042876 | Bacteria | 1521 |
| 620 | Ga0453683_0067903 | 3300044673 | Bacteria | 2229 |
| 621 | Ga0466963_0148138 | 3300044694 | Bacteria | 1629 |
| 622 | Ga0453684_0232109 | 3300044712 | Bacteria | 2130 |
| 623 | Ga0466957_0001150 | 3300044842 | Bacteria | 13690 |
| 624 | Ga0451576_0024281 | 3300045051 | Bacteria | 6549 |
| 625 | Ga0451576_0035030 | 3300045051 | Bacteria | 5328 |
| 626 | Ga0451576_0343955 | 3300045051 | Unclassified | 1562 |
| 627 | Ga0451576_0427990 | 3300045051 | Bacteria | 1389 |
| 628 | Ga0466967_0018559 | 3300045976 | Bacteria | 5564 |
| 629 | Ga0466967_0053617 | 3300045976 | Bacteria | 3545 |
| 630 | Ga0466967_0256991 | 3300045976 | Bacteria | 1670 |
| 631 | Ga0495592_0242591 | 3300046454 | Bacteria | 1195 |
| 632 | Ga0495651_0000126 | 3300046462 | Bacteria | 56547 |
| 633 | Ga0495651_0005907 | 3300046462 | Bacteria | 9338 |
| 634 | Ga0495580_0000031 | 3300046472 | Bacteria | 76248 |
| 635 | Ga0495580_0003785 | 3300046472 | Bacteria | 12813 |
| 636 | Ga0495580_0004216 | 3300046472 | Bacteria | 12090 |
| 637 | Ga0495580_0009936 | 3300046472 | Bacteria | 7449 |
| 638 | Ga0495580_0034929 | 3300046472 | Bacteria | 3617 |
| 639 | Ga0495580_0071429 | 3300046472 | Unclassified | 2425 |
| 640 | Ga0495580_0076801 | 3300046472 | Bacteria | 2329 |
| 641 | Ga0495580_0099784 | 3300046472 | Unclassified | 2020 |
| 642 | Ga0495580_0164642 | 3300046472 | Bacteria | 1534 |
| 643 | Ga0495582_0057712 | 3300046473 | Bacteria | 2140 |
| 644 | Ga0495582_0121408 | 3300046473 | Bacteria | 1472 |
| 645 | Ga0495639_0021466 | 3300046475 | Bacteria | 2827 |
| 646 | Ga0495639_0183508 | 3300046475 | Bacteria | 1019 |
| 647 | Ga0495664_0031134 | 3300046477 | Bacteria | 3127 |
| 648 | Ga0495630_0046159 | 3300046517 | Unclassified | 3256 |
| 649 | Ga0495630_0192220 | 3300046517 | Unclassified | 1557 |
| 650 | Ga0495630_0340385 | 3300046517 | Bacteria | 1148 |
| 651 | Ga0495652_0238731 | 3300046529 | Bacteria | 1354 |
| 652 | Ga0495665_0004297 | 3300046531 | Bacteria | 7702 |
| 653 | Ga0495665_0062748 | 3300046531 | Bacteria | 1962 |
| 654 | Ga0495665_0122979 | 3300046531 | Bacteria | 1359 |
| 655 | Ga0495587_0001501 | 3300046536 | Bacteria | 15508 |
| 656 | Ga0495645_0022674 | 3300046543 | Bacteria | 4543 |
| 657 | Ga0495667_0002288 | 3300046559 | Bacteria | 12842 |
| 658 | Ga0495667_0070713 | 3300046559 | Bacteria | 2276 |
| 659 | Ga0495667_0172976 | 3300046559 | Bacteria | 1387 |
| 660 | Ga0495668_0041644 | 3300046616 | Bacteria | 2558 |
| 661 | Ga0495635_0036482 | 3300046663 | Bacteria | 3407 |
| 662 | Ga0495635_0040993 | 3300046663 | Bacteria | 3199 |
| 663 | Ga0495635_0274398 | 3300046663 | Bacteria | 1134 |
| 664 | Ga0495657_0145156 | 3300046675 | Bacteria | 1477 |
| 665 | Ga0495623_0009392 | 3300046679 | Bacteria | 6351 |
| 666 | Ga0495623_0028518 | 3300046679 | Bacteria | 3591 |
| 667 | Ga0495646_0145875 | 3300046680 | Bacteria | 1320 |
| 668 | Ga0495658_0048926 | 3300046683 | Bacteria | 2386 |
| 669 | Ga0495669_0060122 | 3300046684 | Bacteria | 1717 |
| 670 | Ga0495613_0216415 | 3300046689 | Bacteria | 1346 |
| 671 | Ga0495624_0061461 | 3300046690 | Bacteria | 2354 |
| 672 | Ga0495581_0052450 | 3300047315 | Bacteria | 2356 |
| 673 | Ga0495636_0101441 | 3300047318 | Bacteria | 1259 |
| 674 | Ga0495680_0000253 | 3300047322 | Bacteria | 59346 |
| 675 | Ga0495680_0133332 | 3300047322 | Bacteria | 1823 |
| 676 | Ga0495675_0006968 | 3300047444 | Bacteria | 6948 |
| 677 | Ga0495675_0081481 | 3300047444 | Bacteria | 2038 |
| 678 | Ga0495675_0199845 | 3300047444 | Bacteria | 1217 |
| 679 | Ga0495593_0111828 | 3300047673 | Bacteria | 1394 |
| 680 | Ga0495602_0000086 | 3300048088 | Bacteria | 90226 |
| 681 | Ga0495602_0034218 | 3300048088 | Bacteria | 4757 |
| 682 | Ga0495602_0093945 | 3300048088 | Bacteria | 2480 |
| 683 | Ga0495602_0168717 | 3300048088 | Bacteria | 1701 |
| 684 | Ga0495602_0270240 | 3300048088 | Bacteria | 1257 |
| 685 | Ga0496100_0045324 | 3300048903 | Bacteria | 2822 |
| 686 | Ga0496101_0271352 | 3300048904 | Unclassified | 1324 |
| 687 | Ga0496102_0026278 | 3300048905 | Bacteria | 5191 |
| 688 | Ga0496102_0528596 | 3300048905 | Unclassified | 1102 |
| 689 | Ga0496103_0022010 | 3300048906 | Bacteria | 3837 |
| 690 | Ga0496104_0014823 | 3300048907 | Bacteria | 7044 |
| 691 | Ga0496104_0039786 | 3300048907 | Bacteria | 4403 |
| 692 | Ga0496105_0059929 | 3300048908 | Bacteria | 3140 |
| 693 | Ga0496106_0143049 | 3300048909 | Unclassified | 1882 |
| 694 | Ga0496106_0219100 | 3300048909 | Unclassified | 1517 |
| 695 | Ga0496107_0149337 | 3300048910 | Unclassified | 1728 |
| 696 | Ga0496108_0215781 | 3300048911 | Unclassified | 1666 |
| 697 | Ga0496109_0000117 | 3300048912 | Bacteria | 82245 |
| 698 | Ga0496110_0004256 | 3300048913 | Bacteria | 11075 |
| 699 | Ga0496110_0270704 | 3300048913 | Unclassified | 1546 |
| 700 | Ga0496111_0005575 | 3300048914 | Bacteria | 8092 |
| 701 | Ga0496111_0031940 | 3300048914 | Bacteria | 3753 |
| 702 | Ga0496111_0116292 | 3300048914 | Unclassified | 1972 |
| 703 | Ga0496112_0000283 | 3300048915 | Bacteria | 32864 |
| 704 | Ga0496112_0012306 | 3300048915 | Bacteria | 7857 |
| 705 | Ga0496112_0016326 | 3300048915 | Bacteria | 6953 |
| 706 | Ga0496112_0024877 | 3300048915 | Bacteria | 5744 |
| 707 | Ga0496112_0026656 | 3300048915 | Bacteria | 5566 |
| 708 | Ga0496112_0068132 | 3300048915 | Bacteria | 3514 |
| 709 | Ga0496112_0127183 | 3300048915 | Bacteria | 2519 |
| 710 | Ga0496112_0210830 | 3300048915 | Bacteria | 1900 |
| 711 | Ga0496112_0310943 | 3300048915 | Bacteria | 1521 |
| 712 | Ga0496112_0353510 | 3300048915 | Unclassified | 1411 |
| 713 | Ga0496112_0561621 | 3300048915 | Bacteria | 1075 |
| 714 | Ga0496113_0002193 | 3300048916 | Bacteria | 11259 |
| 715 | Ga0496113_0017207 | 3300048916 | Bacteria | 5013 |
| 716 | Ga0496113_0058319 | 3300048916 | Bacteria | 2904 |
| 717 | Ga0496113_0587831 | 3300048916 | Bacteria | 892 |
| 718 | Ga0496115_0085529 | 3300048918 | Bacteria | 2572 |
| 719 | Ga0496115_0190834 | 3300048918 | Bacteria | 1693 |
| 720 | Ga0501298_008435 | 3300049521 | Bacteria | 1731 |
| 721 | Ga0501299_016015 | 3300049522 | Bacteria | 1323 |
| 722 | Ga0501043_0007160 | 3300049579 | Bacteria | 8867 |
| 723 | Ga0501234_005607 | 3300049707 | Bacteria | 1963 |
| 724 | Ga0501264_002418 | 3300049761 | Bacteria | 1746 |
| 725 | nmdc:mga05p37_149937_c1 | 3300050507 | Bacteria | 2853 |
| 726 | nmdc:mga0n895_47_c1 | 3300050512 | Bacteria | 73703 |
| 727 | nmdc:mga0n895_72112_c1 | 3300050512 | Bacteria | 3426 |
| 728 | nmdc:mga0rr50_14437_c1 | 3300050513 | Bacteria | 5181 |
| 729 | nmdc:mga0rr50_284_c1 | 3300050513 | Bacteria | 27442 |
| 730 | nmdc:mga0rr50_36759_c1 | 3300050513 | Bacteria | 3529 |
| 731 | nmdc:mga08x19_14300_c1 | 3300050514 | Bacteria | 4813 |
| 732 | nmdc:mga08x19_7601_c1 | 3300050514 | Bacteria | 6437 |
| 733 | nmdc:mga08x19_8169_c1 | 3300050514 | Bacteria | 6219 |
| 734 | nmdc:mga0a205_378_c1 | 3300050515 | Bacteria | 33792 |
| 735 | nmdc:mga0a205_57122_c1 | 3300050515 | Bacteria | 3768 |
| 736 | Ga0495601_0113659 | 3300053077 | Bacteria | 1755 |
| 737 | Ga0495612_0025171 | 3300053078 | Unclassified | 2390 |
| 738 | Ga0495619_0184431 | 3300053085 | Bacteria | 1444 |
| 739 | Ga0496108_0000325 | |||
| 740 | MBSR1b_contig_10381525 | |||
| 741 | MBSR1b_contig_11555807 | |||
| 742 | MBSR1b_contig_2529071 | |||
| 743 | LJNas_1000457 | |||
| 744 | JGI24743J22301_10011188 | |||
| 745 | JGI24034J26672_10007821 | |||
| 746 | rootL2_10145897 | |||
| 747 | Ga0058862_12832003 | |||
| 748 | Ga0065712_10108699 | |||
| 749 | Ga0065715_10092393 | |||
| 750 | Ga0065715_10103892 | |||
| 751 | Ga0070658_10239815 | |||
| 752 | Ga0070676_10002790 | |||
| 753 | Ga0070683_100008507 | |||
| 754 | Ga0070683_100105812 | |||
| 755 | Ga0070683_100122059 | |||
| 756 | Ga0070683_100124740 | |||
| 757 | Ga0070683_100468831 | |||
| 758 | Ga0070690_100003796 | |||
| 759 | Ga0070690_100045779 | |||
| 760 | Ga0070670_100014317 | |||
| 761 | Ga0068869_100000550 | |||
| 762 | Ga0068869_100352568 | |||
| 763 | Ga0070666_10385987 | |||
| 764 | Ga0070680_100000966 | |||
| 765 | Ga0070680_100141560 | |||
| 766 | Ga0070680_100196197 | |||
| 767 | Ga0070680_100239700 | |||
| 768 | Ga0070682_100049035 | |||
| 769 | Ga0070682_100080276 | |||
| 770 | Ga0070682_100293572 | |||
| 771 | Ga0068868_100008835 | |||
| 772 | Ga0068868_100026818 | |||
| 773 | Ga0068868_100054761 | |||
| 774 | Ga0068868_100163328 | |||
| 775 | Ga0070660_100045003 | |||
| 776 | Ga0070660_100110819 | |||
| 777 | Ga0070689_100060534 | |||
| 778 | Ga0070687_100011158 | |||
| 779 | Ga0070661_100046715 | |||
| 780 | Ga0070661_100060426 | |||
| 781 | Ga0070692_10143438 | |||
| 782 | Ga0070668_100009738 | |||
| 783 | Ga0070668_100185171 | |||
| 784 | Ga0070669_100018549 | |||
| 785 | Ga0070669_100317896 | |||
| 786 | Ga0070675_100128770 | |||
| 787 | Ga0070675_100465650 | |||
| 788 | Ga0070674_100130686 | |||
| 789 | Ga0070673_100010535 | |||
| 790 | Ga0070673_100457358 | |||
| 791 | Ga0070688_100033125 | |||
| 792 | Ga0070659_100005924 | |||
| 793 | Ga0070667_100274459 | |||
| 794 | Ga0070709_10001876 | |||
| 795 | Ga0070709_10015209 | |||
| 796 | Ga0070709_10018335 | |||
| 797 | Ga0070709_10049172 | |||
| 798 | Ga0070709_10052546 | |||
| 799 | Ga0070709_10289532 | |||
| 800 | Ga0070714_100000172 | |||
| 801 | Ga0070714_100034727 | |||
| 802 | Ga0070714_100045723 | |||
| 803 | Ga0070714_100383852 | |||
| 804 | Ga0070714_100424847 | |||
| 805 | Ga0070714_100523397 | |||
| 806 | Ga0070713_100000342 | |||
| 807 | Ga0070713_100000510 | |||
| 808 | Ga0070713_100012080 | |||
| 809 | Ga0070713_100014913 | |||
| 810 | Ga0070713_100017439 | |||
| 811 | Ga0070713_100021804 | |||
| 812 | Ga0070713_100023895 | |||
| 813 | Ga0070713_100038892 | |||
| 814 | Ga0070713_100062715 | |||
| 815 | Ga0070713_100209423 | |||
| 816 | Ga0070713_100269550 | |||
| 817 | Ga0070713_100303520 | |||
| 818 | Ga0070713_100390775 | |||
| 819 | Ga0070710_10001792 | |||
| 820 | Ga0070710_10009246 | |||
| 821 | Ga0070710_10064133 | |||
| 822 | Ga0070710_10152561 | |||
| 823 | Ga0070711_100000099 | |||
| 824 | Ga0070711_100009364 | |||
| 825 | Ga0070711_100024722 | |||
| 826 | Ga0070711_100058468 | |||
| 827 | Ga0070711_100098019 | |||
| 828 | Ga0070711_100105675 | |||
| 829 | Ga0070700_100040780 | |||
| 830 | Ga0070694_100143215 | |||
| 831 | Ga0070708_100002020 | |||
| 832 | Ga0070708_100012504 | |||
| 833 | Ga0070708_100027025 | |||
| 834 | Ga0070708_100089495 | |||
| 835 | Ga0070708_100189985 | |||
| 836 | Ga0070708_100202432 | |||
| 837 | Ga0070708_100332005 | |||
| 838 | Ga0070708_100449384 | |||
| 839 | Ga0070663_100055535 | |||
| 840 | Ga0070678_100235151 | |||
| 841 | Ga0070662_100028395 | |||
| 842 | Ga0070662_100056858 | |||
| 843 | Ga0070681_10001869 | |||
| 844 | Ga0070681_10030858 | |||
| 845 | Ga0070681_10040824 | |||
| 846 | Ga0070681_10135010 | |||
| 847 | Ga0070681_10136281 | |||
| 848 | Ga0070681_10221731 | |||
| 849 | Ga0070681_10271021 | |||
| 850 | Ga0070681_10284010 | |||
| 851 | Ga0070681_10285434 | |||
| 852 | Ga0068867_100011942 | |||
| 853 | Ga0068867_100088440 | |||
| 854 | Ga0070685_10005938 | |||
| 855 | Ga0070685_10176446 | |||
| 856 | Ga0070706_100000173 | |||
| 857 | Ga0070706_100013420 | |||
| 858 | Ga0070706_100105960 | |||
| 859 | Ga0070706_100159416 | |||
| 860 | Ga0070707_100000719 | |||
| 861 | Ga0070707_100002543 | |||
| 862 | Ga0070707_100031701 | |||
| 863 | Ga0070707_100072085 | |||
| 864 | Ga0070707_100151074 | |||
| 865 | Ga0070707_100770743 | |||
| 866 | Ga0070698_100000162 | |||
| 867 | Ga0070698_100007167 | |||
| 868 | Ga0070698_100046263 | |||
| 869 | Ga0070698_100063129 | |||
| 870 | Ga0070699_100001096 | |||
| 871 | Ga0070699_100002540 | |||
| 872 | Ga0070699_100198433 | |||
| 873 | Ga0070699_100282924 | |||
| 874 | Ga0070699_100360994 | |||
| 875 | Ga0070699_100658660 | |||
| 876 | Ga0070679_100000510 | |||
| 877 | Ga0070679_100000520 | |||
| 878 | Ga0070679_100030148 | |||
| 879 | Ga0070679_100190458 | |||
| 880 | Ga0070679_100770500 | |||
| 881 | Ga0070684_100005565 | |||
| 882 | Ga0070684_100006304 | |||
| 883 | Ga0070684_100254228 | |||
| 884 | Ga0070684_100334411 | |||
| 885 | Ga0070697_100000194 | |||
| 886 | Ga0070697_100002639 | |||
| 887 | Ga0070697_100029174 | |||
| 888 | Ga0068853_100017447 | |||
| 889 | Ga0068853_100019840 | |||
| 890 | Ga0068853_100056849 | |||
| 891 | Ga0068853_100060553 | |||
| 892 | Ga0070672_100025283 | |||
| 893 | Ga0070686_100019750 | |||
| 894 | Ga0070704_100454610 | |||
| 895 | Ga0068855_100054000 | |||
| 896 | Ga0068855_100070492 | |||
| 897 | Ga0068855_100143113 | |||
| 898 | Ga0068855_100312429 | |||
| 899 | Ga0070664_100012980 | |||
| 900 | Ga0068857_100002662 | |||
| 901 | Ga0068857_100166016 | |||
| 902 | Ga0068854_100019451 | |||
| 903 | Ga0068854_100056700 | |||
| 904 | Ga0068854_100076758 | |||
| 905 | Ga0068854_100204328 | |||
| 906 | Ga0068856_100078529 | |||
| 907 | Ga0068856_100108659 | |||
| 908 | Ga0068856_100208281 | |||
| 909 | Ga0068856_100210396 | |||
| 910 | Ga0068856_100540491 | |||
| 911 | Ga0070702_100004820 | |||
| 912 | Ga0068852_100008725 | |||
| 913 | Ga0068852_100066133 | |||
| 914 | Ga0068852_100122769 | |||
| 915 | Ga0068859_100061519 | |||
| 916 | Ga0068859_100180875 | |||
| 917 | Ga0068864_100027756 | |||
| 918 | Ga0068864_100050144 | |||
| 919 | Ga0068864_100056258 | |||
| 920 | Ga0068866_10001944 | |||
| 921 | Ga0068851_10006235 | |||
| 922 | Ga0068851_10008933 | |||
| 923 | Ga0068870_10025939 | |||
| 924 | Ga0068863_100015876 | |||
| 925 | Ga0068863_100036664 | |||
| 926 | Ga0068863_100062287 | |||
| 927 | Ga0068863_100082639 | |||
| 928 | Ga0068863_100345653 | |||
| 929 | Ga0068858_100018536 | |||
| 930 | Ga0068858_100105877 | |||
| 931 | Ga0068858_100573562 | |||
| 932 | Ga0068860_100034790 | |||
| 933 | Ga0068860_100058239 | |||
| 934 | Ga0068862_100038124 | |||
| 935 | Ga0081455_10124268 | |||
| 936 | Ga0070717_10000837 | |||
| 937 | Ga0070717_10012939 | |||
| 938 | Ga0070717_10045526 | |||
| 939 | Ga0070717_10050844 | |||
| 940 | Ga0070717_10054722 | |||
| 941 | Ga0070717_10126995 | |||
| 942 | Ga0070717_10130489 | |||
| 943 | Ga0070717_10156475 | |||
| 944 | Ga0070717_10193292 | |||
| 945 | Ga0070715_10005176 | |||
| 946 | Ga0070715_10024056 | |||
| 947 | Ga0070716_100000315 | |||
| 948 | Ga0070716_100009262 | |||
| 949 | Ga0070716_100015509 | |||
| 950 | Ga0070716_100115425 | |||
| 951 | Ga0070716_100188957 | |||
| 952 | Ga0070712_100000546 | |||
| 953 | Ga0070712_100003075 | |||
| 954 | Ga0070712_100005278 | |||
| 955 | Ga0070712_100025709 | |||
| 956 | Ga0070712_100036638 | |||
| 957 | Ga0070712_100190548 | |||
| 958 | Ga0070712_100204899 | |||
| 959 | Ga0070712_100225602 | |||
| 960 | Ga0070712_100346634 | |||
| 961 | Ga0070712_100433194 | |||
| 962 | Ga0097621_100058974 | |||
| 963 | Ga0097621_100116896 | |||
| 964 | Ga0097621_100161306 | |||
| 965 | Ga0097621_100265093 | |||
| 966 | Ga0068871_100174696 | |||
| 967 | Ga0075433_10001164 | |||
| 968 | Ga0075433_10170259 | |||
| 969 | Ga0075434_100000041 | |||
| 970 | Ga0075434_100072900 | |||
| 971 | Ga0068865_100037031 | |||
| 972 | Ga0075436_100017155 | |||
| 973 | Ga0075436_100203583 | |||
| 974 | Ga0097620_100061520 | |||
| 975 | Ga0097620_100180848 | |||
| 976 | Ga0075435_100000105 | |||
| 977 | Ga0075435_100024950 | |||
| 978 | Ga0075435_100056238 | |||
| 979 | Ga0075435_100332039 | |||
| 980 | Ga0099794_10003333 | |||
| 981 | Ga0099794_10012324 | |||
| 982 | Ga0099794_10098222 | |||
| 983 | Ga0105250_10069312 | |||
| 984 | Ga0105240_10006795 | |||
| 985 | Ga0105240_10020033 | |||
| 986 | Ga0105240_10020074 | |||
| 987 | Ga0105240_10084816 | |||
| 988 | Ga0105240_10257351 | |||
| 989 | Ga0105245_10003453 | |||
| 990 | Ga0105245_10058109 | |||
| 991 | Ga0105245_10067483 | |||
| 992 | Ga0105245_10075850 | |||
| 993 | Ga0105247_10006289 | |||
| 994 | Ga0105241_10005248 | |||
| 995 | Ga0105241_10009745 | |||
| 996 | Ga0105241_10010180 | |||
| 997 | Ga0105241_10089286 | |||
| 998 | Ga0105241_10196006 | |||
| 999 | Ga0105241_10244496 | |||
| 1000 | Ga0105242_10416482 | |||
| 1001 | Ga0105248_10010789 | |||
| 1002 | Ga0105248_10168359 | |||
| 1003 | Ga0105248_10230295 | |||
| 1004 | Ga0105248_10353125 | |||
| 1005 | Ga0105248_10735084 | |||
| 1006 | Ga0105237_10090858 | |||
| 1007 | Ga0105237_10116949 | |||
| 1008 | Ga0105237_10162375 | |||
| 1009 | Ga0105238_10005181 | |||
| 1010 | Ga0105238_10107430 | |||
| 1011 | Ga0105238_10113491 | |||
| 1012 | Ga0105238_10170043 | |||
| 1013 | Ga0105238_10316294 | |||
| 1014 | Ga0105249_10011376 | |||
| 1015 | Ga0105249_10105191 | |||
| 1016 | Ga0099796_10013449 | |||
| 1017 | Ga0105239_10038771 | |||
| 1018 | Ga0105239_10753082 | |||
| 1019 | Ga0105239_10770551 | |||
| 1020 | Ga0105246_10035400 | |||
| 1021 | Ga0157373_10004158 | |||
| 1022 | Ga0157373_10045027 | |||
| 1023 | Ga0157371_10004724 | |||
| 1024 | Ga0157370_10105012 | |||
| 1025 | Ga0157370_10141224 | |||
| 1026 | Ga0157369_10026010 | |||
| 1027 | Ga0157369_10032939 | |||
| 1028 | Ga0157369_10037623 | |||
| 1029 | Ga0157369_10102992 | |||
| 1030 | Ga0157369_10137163 | |||
| 1031 | Ga0157369_10217159 | |||
| 1032 | Ga0157369_10347333 | |||
| 1033 | Ga0157374_10022187 | |||
| 1034 | Ga0157374_10046665 | |||
| 1035 | Ga0157374_10065747 | |||
| 1036 | Ga0157374_10108358 | |||
| 1037 | Ga0157374_10115790 | |||
| 1038 | Ga0157374_10271062 | |||
| 1039 | Ga0157378_10018892 | |||
| 1040 | Ga0157378_10074344 | |||
| 1041 | Ga0157378_10113990 | |||
| 1042 | Ga0157378_10437812 | |||
| 1043 | Ga0163162_10132089 | |||
| 1044 | Ga0163162_10148808 | |||
| 1045 | Ga0157372_10142621 | |||
| 1046 | Ga0157372_10144089 | |||
| 1047 | Ga0157372_10223391 | |||
| 1048 | Ga0157372_10252204 | |||
| 1049 | Ga0157372_10581714 | |||
| 1050 | Ga0157372_10598251 | |||
| 1051 | Ga0157375_10111416 | |||
| 1052 | Ga0163163_10002469 | |||
| 1053 | Ga0163163_10002705 | |||
| 1054 | Ga0163163_10005504 | |||
| 1055 | Ga0163163_10007476 | |||
| 1056 | Ga0163163_10011914 | |||
| 1057 | Ga0163163_10172295 | |||
| 1058 | Ga0182008_10004982 | |||
| 1059 | Ga0182008_10188387 | |||
| 1060 | Ga0157377_10001020 | |||
| 1061 | Ga0157377_10258259 | |||
| 1062 | Ga0157379_10014150 | |||
| 1063 | Ga0157379_10019365 | |||
| 1064 | Ga0157379_10024289 | |||
| 1065 | Ga0157376_10009736 | |||
| 1066 | Ga0157376_10059670 | |||
| 1067 | Ga0157376_10078340 | |||
| 1068 | Ga0157376_10412477 | |||
| 1069 | Ga0182006_1057591 | |||
| 1070 | Ga0182006_1063624 | |||
| 1071 | Ga0182007_10003288 | |||
| 1072 | Ga0182007_10005070 | |||
| 1073 | Ga0182005_1010937 | |||
| 1074 | Ga0163161_10007272 | |||
| 1075 | Ga0154015_1151417 | |||
| 1076 | Ga0213874_10011227 | |||
| 1077 | Ga0213874_10013760 | |||
| 1078 | Ga0224570_100845 | |||
| 1079 | Ga0224571_100909 | |||
| 1080 | Ga0224572_1003971 | |||
| 1081 | Ga0228598_1000222 | |||
| 1082 | Ga0228598_1002594 | |||
| 1083 | Ga0228598_1003622 | |||
| 1084 | Ga0207697_10025446 | |||
| 1085 | Ga0207656_10043180 | |||
| 1086 | Ga0207682_10063620 | |||
| 1087 | Ga0207692_10122553 | |||
| 1088 | Ga0207692_10127192 | |||
| 1089 | Ga0207692_10134960 | |||
| 1090 | Ga0207692_10248277 | |||
| 1091 | Ga0207642_10012636 | |||
| 1092 | Ga0207688_10024685 | |||
| 1093 | Ga0207680_10094776 | |||
| 1094 | Ga0207680_10368309 | |||
| 1095 | Ga0207647_10003441 | |||
| 1096 | Ga0207647_10008016 | |||
| 1097 | Ga0207685_10000821 | |||
| 1098 | Ga0207685_10010386 | |||
| 1099 | Ga0207685_10100487 | |||
| 1100 | Ga0207699_10001324 | |||
| 1101 | Ga0207699_10007254 | |||
| 1102 | Ga0207699_10023775 | |||
| 1103 | Ga0207699_10033998 | |||
| 1104 | Ga0207699_10041331 | |||
| 1105 | Ga0207699_10051403 | |||
| 1106 | Ga0207699_10078206 | |||
| 1107 | Ga0207699_10107456 | |||
| 1108 | Ga0207699_10118986 | |||
| 1109 | Ga0207699_10128681 | |||
| 1110 | Ga0207699_10138055 | |||
| 1111 | Ga0207699_10199769 | |||
| 1112 | Ga0207645_10000181 | |||
| 1113 | Ga0207643_10001458 | |||
| 1114 | Ga0207684_10000217 | |||
| 1115 | Ga0207684_10000267 | |||
| 1116 | Ga0207684_10031119 | |||
| 1117 | Ga0207684_10111242 | |||
| 1118 | Ga0207654_10136729 | |||
| 1119 | Ga0207654_10200913 | |||
| 1120 | Ga0207707_10012342 | |||
| 1121 | Ga0207707_10014434 | |||
| 1122 | Ga0207707_10025947 | |||
| 1123 | Ga0207707_10037745 | |||
| 1124 | Ga0207707_10053833 | |||
| 1125 | Ga0207707_10216738 | |||
| 1126 | Ga0207695_10015503 | |||
| 1127 | Ga0207695_10216134 | |||
| 1128 | Ga0207695_10265463 | |||
| 1129 | Ga0207671_10052924 | |||
| 1130 | Ga0207671_10192972 | |||
| 1131 | Ga0207693_10000089 | |||
| 1132 | Ga0207693_10000106 | |||
| 1133 | Ga0207693_10009582 | |||
| 1134 | Ga0207693_10029248 | |||
| 1135 | Ga0207693_10041981 | |||
| 1136 | Ga0207693_10089412 | |||
| 1137 | Ga0207693_10095356 | |||
| 1138 | Ga0207693_10114199 | |||
| 1139 | Ga0207693_10132917 | |||
| 1140 | Ga0207693_10185688 | |||
| 1141 | Ga0207693_10241303 | |||
| 1142 | Ga0207663_10002155 | |||
| 1143 | Ga0207663_10017636 | |||
| 1144 | Ga0207663_10127279 | |||
| 1145 | Ga0207663_10240979 | |||
| 1146 | Ga0207663_10321959 | |||
| 1147 | Ga0207660_10000386 | |||
| 1148 | Ga0207660_10181183 | |||
| 1149 | Ga0207660_10305961 | |||
| 1150 | Ga0207662_10013877 | |||
| 1151 | Ga0207657_10000535 | |||
| 1152 | Ga0207657_10001828 | |||
| 1153 | Ga0207649_10000350 | |||
| 1154 | Ga0207652_10000313 | |||
| 1155 | Ga0207652_10050618 | |||
| 1156 | Ga0207652_10077577 | |||
| 1157 | Ga0207652_10172465 | |||
| 1158 | Ga0207646_10000296 | |||
| 1159 | Ga0207646_10001311 | |||
| 1160 | Ga0207646_10047963 | |||
| 1161 | Ga0207646_10055621 | |||
| 1162 | Ga0207646_10146400 | |||
| 1163 | Ga0207646_10176492 | |||
| 1164 | Ga0207646_10224130 | |||
| 1165 | Ga0207681_10089797 | |||
| 1166 | Ga0207681_10256425 | |||
| 1167 | Ga0207694_10044564 | |||
| 1168 | Ga0207694_10162381 | |||
| 1169 | Ga0207650_10000223 | |||
| 1170 | Ga0207650_10328683 | |||
| 1171 | Ga0207659_10007479 | |||
| 1172 | Ga0207687_10001701 | |||
| 1173 | Ga0207687_10166810 | |||
| 1174 | Ga0207700_10000289 | |||
| 1175 | Ga0207700_10001827 | |||
| 1176 | Ga0207700_10001971 | |||
| 1177 | Ga0207700_10005081 | |||
| 1178 | Ga0207700_10005232 | |||
| 1179 | Ga0207700_10060430 | |||
| 1180 | Ga0207700_10078662 | |||
| 1181 | Ga0207700_10481931 | |||
| 1182 | Ga0207700_10557662 | |||
| 1183 | Ga0207664_10000118 | |||
| 1184 | Ga0207664_10177474 | |||
| 1185 | Ga0207664_10238198 | |||
| 1186 | Ga0207664_10326294 | |||
| 1187 | Ga0207664_10465897 | |||
| 1188 | Ga0207644_10010014 | |||
| 1189 | Ga0207690_10130674 | |||
| 1190 | Ga0207690_10137663 | |||
| 1191 | Ga0207690_10184015 | |||
| 1192 | Ga0207706_10009803 | |||
| 1193 | Ga0207706_10016556 | |||
| 1194 | Ga0207670_10028033 | |||
| 1195 | Ga0207704_10101902 | |||
| 1196 | Ga0207665_10001184 | |||
| 1197 | Ga0207665_10001526 | |||
| 1198 | Ga0207665_10003365 | |||
| 1199 | Ga0207665_10025014 | |||
| 1200 | Ga0207665_10029557 | |||
| 1201 | Ga0207665_10096517 | |||
| 1202 | Ga0207665_10249788 | |||
| 1203 | Ga0207691_10000345 | |||
| 1204 | Ga0207711_10057834 | |||
| 1205 | Ga0207711_10142033 | |||
| 1206 | Ga0207711_10382228 | |||
| 1207 | Ga0207689_10000499 | |||
| 1208 | Ga0207689_10004722 | |||
| 1209 | Ga0207661_10006500 | |||
| 1210 | Ga0207661_10115990 | |||
| 1211 | Ga0207661_10127164 | |||
| 1212 | Ga0207679_10000115 | |||
| 1213 | Ga0207667_10024023 | |||
| 1214 | Ga0207667_10152110 | |||
| 1215 | Ga0207667_10221587 | |||
| 1216 | Ga0207667_10305379 | |||
| 1217 | Ga0207651_10003270 | |||
| 1218 | Ga0207651_10414021 | |||
| 1219 | Ga0207712_10083293 | |||
| 1220 | Ga0207640_10042800 | |||
| 1221 | Ga0207640_10060894 | |||
| 1222 | Ga0207640_10093081 | |||
| 1223 | Ga0207658_10061088 | |||
| 1224 | Ga0207677_10002530 | |||
| 1225 | Ga0207677_10264018 | |||
| 1226 | Ga0207703_10068035 | |||
| 1227 | Ga0207639_10007368 | |||
| 1228 | Ga0207639_10151559 | |||
| 1229 | Ga0207678_10000130 | |||
| 1230 | Ga0207708_10053203 | |||
| 1231 | Ga0207702_10156112 | |||
| 1232 | Ga0207702_10312437 | |||
| 1233 | Ga0207641_10000287 | |||
| 1234 | Ga0207641_10048218 | |||
| 1235 | Ga0207641_10124770 | |||
| 1236 | Ga0207641_10153880 | |||
| 1237 | Ga0207648_10001253 | |||
| 1238 | Ga0207648_10060156 | |||
| 1239 | Ga0207676_10000115 | |||
| 1240 | Ga0207676_10115468 | |||
| 1241 | Ga0207676_10365792 | |||
| 1242 | Ga0207674_10001340 | |||
| 1243 | Ga0207674_10091093 | |||
| 1244 | Ga0207674_10102775 | |||
| 1245 | Ga0207683_10000217 | |||
| 1246 | Ga0207698_10038291 | |||
| 1247 | Ga0207698_10123110 | |||
| 1248 | Ga0207698_10341285 | |||
| 1249 | Ga0209588_1043516 | |||
| 1250 | Ga0265356_1000336 | |||
| 1251 | Ga0265356_1001239 | |||
| 1252 | Ga0265355_1000515 | |||
| 1253 | Ga0268266_10008412 | |||
| 1254 | Ga0268265_10137853 | |||
| 1255 | Ga0268265_10248615 | |||
| 1256 | Ga0268264_10014054 | |||
| 1257 | Ga0268264_10030440 | |||
| 1258 | Ga0265319_1020505 | |||
| 1259 | Ga0265338_10015046 | |||
| 1260 | Ga0265338_10030980 | |||
| 1261 | Ga0265338_10045521 | |||
| 1262 | Ga0265338_10046475 | |||
| 1263 | Ga0265338_10176189 | |||
| 1264 | Ga0265762_1000608 | |||
| 1265 | Ga0265762_1021513 | |||
| 1266 | Ga0265770_1017026 | |||
| 1267 | Ga0265760_10000331 | |||
| 1268 | Ga0265760_10000650 | |||
| 1269 | Ga0265760_10001481 | |||
| 1270 | Ga0265760_10004482 | |||
| 1271 | Ga0265760_10012473 | |||
| 1272 | Ga0265760_10023198 | |||
| 1273 | Ga0265325_10008604 | |||
| 1274 | Ga0265325_10104212 | |||
| 1275 | Ga0265340_10065999 | |||
| 1276 | Ga0265339_10005007 | |||
| 1277 | Ga0265339_10095478 | |||
| 1278 | Ga0265316_10002496 | |||
| 1279 | Ga0265316_10045238 | |||
| 1280 | Ga0265316_10068611 | |||
| 1281 | Ga0307408_100007923 | |||
| 1282 | Ga0307408_100061387 | |||
| 1283 | Ga0307408_100089449 | |||
| 1284 | Ga0265314_10002671 | |||
| 1285 | Ga0265314_10131280 | |||
| 1286 | Ga0265314_10214500 | |||
| 1287 | Ga0265314_10216439 | |||
| 1288 | Ga0307410_10026323 | |||
| 1289 | Ga0307410_10214071 | |||
| 1290 | Ga0307410_10312864 | |||
| 1291 | Ga0307407_10251647 | |||
| 1292 | Ga0307409_100006898 | |||
| 1293 | Ga0307409_100009620 | |||
| 1294 | Ga0307416_100037366 | |||
| 1295 | Ga0307416_100134877 | |||
| 1296 | Ga0307411_10045107 | |||
| 1297 | Ga0307415_100005529 | |||
| 1298 | Ga0307415_100152167 | |||
| 1299 | Ga0373926_0005908 | |||
| 1300 | Ga0373926_0012041 | |||
| 1301 | Ga0373934_0004825 | |||
| 1302 | Ga0373934_0119387 | |||
| 1303 | Ga0373944_0027690 | |||
| 1304 | Ga0373923_0014035 | |||
| 1305 | Ga0373923_0018837 | |||
| 1306 | Ga0373923_0026834 | |||
| 1307 | Ga0373936_0002361 | |||
| 1308 | Ga0373936_0003897 | |||
| 1309 | Ga0373945_0000938 | |||
| 1310 | Ga0373954_0013396 | |||
| 1311 | Ga0373956_0027367 | |||
| 1312 | Ga0373956_0060763 | |||
| 1313 | Ga0373956_0063953 | |||
| 1314 | Ga0373957_0017954 | |||
| 1315 | Ga0373943_0000054 | |||
| 1316 | Ga0373943_0051067 | |||
| 1317 | Ga0373946_0024678 | |||
| 1318 | Ga0373946_0035108 | |||
| 1319 | Ga0373955_0087177 | |||
| 1320 | Ga0373955_0123386 | |||
| 1321 | Ga0373924_0000069 | |||
| 1322 | Ga0373924_0013406 | |||
| 1323 | Ga0373935_0004095 | |||
| 1324 | Ga0373935_0004100 | |||
| 1325 | Ga0373935_0172120 | |||
| 1326 | Ga0373927_0003435 | |||
| 1327 | Ga0373927_0029772 | |||
| 1328 | Ga0373933_0000116 | |||
| 1329 | Ga0373933_0039746 | |||
| 1330 | Ga0373933_0056429 | |||
| 1331 | Ga0373947_0000496 | |||
| 1332 | Ga0373947_0071534 | |||
| 1333 | Ga0373947_0195915 | |||
| 1334 | Ga0373937_0000001 | |||
| 1335 | Ga0373937_0000038 | |||
| 1336 | Ga0373937_0012481 | |||
| 1337 | Ga0373937_0122709 | |||
| 1338 | Ga0373937_0159617 | |||
| 1339 | Ga0373937_0164449 | |||
| 1340 | Ga0373937_0242905 | |||
| 1341 | Ga0373937_0513774 | |||
| 1342 | Ga0373925_0004981 | |||
| 1343 | Ga0373925_0040640 | |||
| 1344 | Ga0373925_0240196 | |||
| 1345 | Ga0395898_0080946 | |||
| 1346 | Ga0395898_0238555 | |||
| 1347 | Ga0395898_0248697 | |||
| 1348 | Ga0395905_0004834 | |||
| 1349 | Ga0395905_0007187 | |||
| 1350 | Ga0395905_0272328 | |||
| 1351 | Ga0436365_1581751 | |||
| 1352 | Ga0436360_0737567 | |||
| 1353 | Ga0436363_0122844 | |||
| 1354 | Ga0436363_0123919 | |||
| 1355 | Ga0436363_1694091 | |||
| 1356 | Ga0451577_0163976 | |||
| 1357 | Ga0451577_0276542 | |||
| 1358 | Ga0453683_0067903 | |||
| 1359 | Ga0466963_0148138 | |||
| 1360 | Ga0453684_0232109 | |||
| 1361 | Ga0466957_0001150 | |||
| 1362 | Ga0451576_0024281 | |||
| 1363 | Ga0451576_0035030 | |||
| 1364 | Ga0451576_0343955 | |||
| 1365 | Ga0451576_0427990 | |||
| 1366 | Ga0466967_0018559 | |||
| 1367 | Ga0466967_0053617 | |||
| 1368 | Ga0466967_0256991 | |||
| 1369 | Ga0495592_0242591 | |||
| 1370 | Ga0495651_0000126 | |||
| 1371 | Ga0495651_0005907 | |||
| 1372 | Ga0495580_0000031 | |||
| 1373 | Ga0495580_0003785 | |||
| 1374 | Ga0495580_0004216 | |||
| 1375 | Ga0495580_0009936 | |||
| 1376 | Ga0495580_0034929 | |||
| 1377 | Ga0495580_0071429 | |||
| 1378 | Ga0495580_0076801 | |||
| 1379 | Ga0495580_0099784 | |||
| 1380 | Ga0495580_0164642 | |||
| 1381 | Ga0495582_0057712 | |||
| 1382 | Ga0495582_0121408 | |||
| 1383 | Ga0495639_0021466 | |||
| 1384 | Ga0495639_0183508 | |||
| 1385 | Ga0495664_0031134 | |||
| 1386 | Ga0495630_0046159 | |||
| 1387 | Ga0495630_0192220 | |||
| 1388 | Ga0495630_0340385 | |||
| 1389 | Ga0495652_0238731 | |||
| 1390 | Ga0495665_0004297 | |||
| 1391 | Ga0495665_0062748 | |||
| 1392 | Ga0495665_0122979 | |||
| 1393 | Ga0495587_0001501 | |||
| 1394 | Ga0495645_0022674 | |||
| 1395 | Ga0495667_0002288 | |||
| 1396 | Ga0495667_0070713 | |||
| 1397 | Ga0495667_0172976 | |||
| 1398 | Ga0495668_0041644 | |||
| 1399 | Ga0495635_0036482 | |||
| 1400 | Ga0495635_0040993 | |||
| 1401 | Ga0495635_0274398 | |||
| 1402 | Ga0495657_0145156 | |||
| 1403 | Ga0495623_0009392 | |||
| 1404 | Ga0495623_0028518 | |||
| 1405 | Ga0495646_0145875 | |||
| 1406 | Ga0495658_0048926 | |||
| 1407 | Ga0495669_0060122 | |||
| 1408 | Ga0495613_0216415 | |||
| 1409 | Ga0495624_0061461 | |||
| 1410 | Ga0495581_0052450 | |||
| 1411 | Ga0495636_0101441 | |||
| 1412 | Ga0495680_0000253 | |||
| 1413 | Ga0495680_0133332 | |||
| 1414 | Ga0495675_0006968 | |||
| 1415 | Ga0495675_0081481 | |||
| 1416 | Ga0495675_0199845 | |||
| 1417 | Ga0495593_0111828 | |||
| 1418 | Ga0495602_0000086 | |||
| 1419 | Ga0495602_0034218 | |||
| 1420 | Ga0495602_0093945 | |||
| 1421 | Ga0495602_0168717 | |||
| 1422 | Ga0495602_0270240 | |||
| 1423 | Ga0496100_0045324 | |||
| 1424 | Ga0496101_0271352 | |||
| 1425 | Ga0496102_0026278 | |||
| 1426 | Ga0496102_0528596 | |||
| 1427 | Ga0496103_0022010 | |||
| 1428 | Ga0496104_0014823 | |||
| 1429 | Ga0496104_0039786 | |||
| 1430 | Ga0496105_0059929 | |||
| 1431 | Ga0496106_0143049 | |||
| 1432 | Ga0496106_0219100 | |||
| 1433 | Ga0496107_0149337 | |||
| 1434 | Ga0496108_0215781 | |||
| 1435 | Ga0496109_0000117 | |||
| 1436 | Ga0496110_0004256 | |||
| 1437 | Ga0496110_0270704 | |||
| 1438 | Ga0496111_0005575 | |||
| 1439 | Ga0496111_0031940 | |||
| 1440 | Ga0496111_0116292 | |||
| 1441 | Ga0496112_0000283 | |||
| 1442 | Ga0496112_0012306 | |||
| 1443 | Ga0496112_0016326 | |||
| 1444 | Ga0496112_0024877 | |||
| 1445 | Ga0496112_0026656 | |||
| 1446 | Ga0496112_0068132 | |||
| 1447 | Ga0496112_0127183 | |||
| 1448 | Ga0496112_0210830 | |||
| 1449 | Ga0496112_0310943 | |||
| 1450 | Ga0496112_0353510 | |||
| 1451 | Ga0496112_0561621 | |||
| 1452 | Ga0496113_0002193 | |||
| 1453 | Ga0496113_0017207 | |||
| 1454 | Ga0496113_0058319 | |||
| 1455 | Ga0496113_0587831 | |||
| 1456 | Ga0496115_0085529 | |||
| 1457 | Ga0496115_0190834 | |||
| 1458 | Ga0501298_008435 | |||
| 1459 | Ga0501299_016015 | |||
| 1460 | Ga0501043_0007160 | |||
| 1461 | Ga0501234_005607 | |||
| 1462 | Ga0501264_002418 | |||
| 1463 | nmdc:mga05p37_149937_c1 | |||
| 1464 | nmdc:mga0n895_47_c1 | |||
| 1465 | nmdc:mga0n895_72112_c1 | |||
| 1466 | nmdc:mga0rr50_14437_c1 | |||
| 1467 | nmdc:mga0rr50_284_c1 | |||
| 1468 | nmdc:mga0rr50_36759_c1 | |||
| 1469 | nmdc:mga08x19_14300_c1 | |||
| 1470 | nmdc:mga08x19_7601_c1 | |||
| 1471 | nmdc:mga08x19_8169_c1 | |||
| 1472 | nmdc:mga0a205_378_c1 | |||
| 1473 | nmdc:mga0a205_57122_c1 | |||
| 1474 | Ga0495601_0113659 | |||
| 1475 | Ga0495612_0025171 | |||
| 1476 | Ga0495619_0184431 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5xlx-assembly1.cif.gz_D | crystal structure of the c-terminal domain of cher1 containing sah | 0.8979 | 81 | 296 |
| 5xlx-assembly1.cif.gz_D | crystal structure of the c-terminal domain of cher1 containing sah | 0.8936 | 81 | 296 |
| 1bc5-assembly1.cif.gz_A | chemotaxis receptor recognition by protein methyltransferase cher | 0.8489 | 5 | 296 |
| 1bc5-assembly1.cif.gz_A | chemotaxis receptor recognition by protein methyltransferase cher | 0.8403 | 5 | 296 |
| 5ftw-assembly1.cif.gz_A | crystal structure of glutamate o-methyltransferase in complex with s- adenosyl-l-homocysteine (sah) from bacillus subtilis | 0.8193 | 12 | 296 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1bc5A01 | Mainly Alpha;Orthogonal Bundle;Chemotaxis Receptor Methyltransferase Cher; domain 1;Chemotaxis receptor methyltransferase CheR, N-terminal domain | 0.8902 | 5 | 77 | 1.10.155.10 |
| 1bc5A01 | Mainly Alpha;Orthogonal Bundle;Chemotaxis Receptor Methyltransferase Cher; domain 1;Chemotaxis receptor methyltransferase CheR, N-terminal domain | 0.8581 | 5 | 77 | 1.10.155.10 |
| 5ftwA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8579 | 78 | 296 | 3.40.50.150 |
| 5ftwA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8538 | 78 | 296 | 3.40.50.150 |
| 1af7A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.833 | 78 | 294 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5C6AAG3-F1-model_v4 | Alkaline phosphatase synthesis transcriptional regulatory protein PhoP | 0.9611 | 166 | 269 |
GO:0000160
GO:0008757 |
| AF-A0A2U3KRD1-F1-model_v4 | MCP methyltransferase, CheR-type | 0.9594 | 98 | 300 |
GO:0008757
GO:0032259 |
| AF-A0A378V4S5-F1-model_v4 | Chemotaxis protein CheR (EC 2.1.1.80) | 0.9467 | 163 | 299 |
GO:0006355
GO:0008983 GO:0032259 |
| AF-A0A4V5TN03-F1-model_v4 | Protein-glutamate O-methyltransferase CheR (EC 2.1.1.80) | 0.9397 | 162 | 240 |
GO:0008983
GO:0032259 |
| AF-A0A7V0SEE8-F1-model_v4 | Protein-glutamate O-methyltransferase CheR | 0.9368 | 159 | 300 |
GO:0008757
|