F478408

General Info

Members Datasets Scaffolds Average Seq Length
738 292 1476 297

Family's Representative Sequence

Representative Sequence 3300048911|Ga0496108_0000325|Ga0496108_0000325_36364_37335
Length 323
Sequence MPVAGRPTPRHPPQLREAGETNPMSTIGSPALTEAELKLLQALVYQECGMHFDDRRTHFLEDRLQRRLKECQLDSFYSYYRLLISQDGKHELARLLENLTVNETSFFRNKAQLDLFHKTILEDMLHYKQERRDYSLRFWSAGCSTGQEPYTIAMLVADALAYYYLRNPLPFDMPLPKPLIPPPWRVEIMASDISYSVLRAAQEGVYSETQMASVDYSYRLRYFDKVGDRYAIKKAVKELVHIDFHNLKTEFLPQRNDVIFCRNVMMYFDEAEQKRLIDKFYRCLNPNGFVLVGHAESLLGLTDKFQMVHRNAGTAYQRVEGRL

Samples

Sample ID Description Type Environment
1 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
116 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
117 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
121 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
122 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
123 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
124 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
187 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
192 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
193 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
197 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
198 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
199 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
200 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
201 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
202 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
203 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
204 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
208 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
209 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
210 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
211 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
214 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
215 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
216 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
217 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
218 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
219 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
220 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
222 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
223 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
224 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
225 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
228 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
229 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
230 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
231 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
232 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
233 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
234 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
235 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
236 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
237 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
238 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
239 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
240 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
241 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
242 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
243 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
244 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
245 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
246 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
247 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
248 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
249 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
250 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
251 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
252 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
253 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
254 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
255 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
256 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
257 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
258 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
259 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
260 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
261 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
262 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
263 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
264 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
265 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
266 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
270 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
271 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
272 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
273 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
276 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
277 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
278 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
279 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
280 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
281 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
282 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
284 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
285 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
286 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
287 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
288 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
289 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
290 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
291 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
292 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.51
Metatranscriptomes 1.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.88
Rhizosphere 94.17
Stem 0
Stem Tuber 0
Unclassified 15.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496108_0000325 3300048911 Bacteria 40507
2 MBSR1b_contig_10381525 2162886012 Unclassified 2906
3 MBSR1b_contig_11555807 2162886012 Unclassified 3601
4 MBSR1b_contig_2529071 2162886012 Unclassified 3228
5 LJNas_1000457 3300000546 Bacteria 7167
6 JGI24743J22301_10011188 3300001991 Bacteria 1612
7 JGI24034J26672_10007821 3300002239 Bacteria 1556
8 rootL2_10145897 3300003322 Unclassified 2511
9 Ga0058862_12832003 3300004803 Bacteria 1402
10 Ga0065712_10108699 3300005290 Unclassified 1869
11 Ga0065715_10092393 3300005293 Bacteria 5145
12 Ga0065715_10103892 3300005293 Bacteria 3001
13 Ga0070658_10239815 3300005327 Bacteria 1536
14 Ga0070676_10002790 3300005328 Bacteria 9022
15 Ga0070683_100008507 3300005329 Bacteria 8718
16 Ga0070683_100105812 3300005329 Bacteria 2652
17 Ga0070683_100122059 3300005329 Bacteria 2462
18 Ga0070683_100124740 3300005329 Bacteria 2434
19 Ga0070683_100468831 3300005329 Bacteria 1202
20 Ga0070690_100003796 3300005330 Bacteria 8322
21 Ga0070690_100045779 3300005330 Bacteria 2780
22 Ga0070670_100014317 3300005331 Bacteria 6805
23 Ga0068869_100000550 3300005334 Bacteria 20980
24 Ga0068869_100352568 3300005334 Bacteria 1200
25 Ga0070666_10385987 3300005335 Unclassified 1006
26 Ga0070680_100000966 3300005336 Bacteria 20343
27 Ga0070680_100141560 3300005336 Bacteria 2017
28 Ga0070680_100196197 3300005336 Unclassified 1702
29 Ga0070680_100239700 3300005336 Bacteria 1533
30 Ga0070682_100049035 3300005337 Bacteria 2631
31 Ga0070682_100080276 3300005337 Unclassified 2109
32 Ga0070682_100293572 3300005337 Bacteria 1190
33 Ga0068868_100008835 3300005338 Bacteria 7218
34 Ga0068868_100026818 3300005338 Bacteria 4393
35 Ga0068868_100054761 3300005338 Bacteria 3145
36 Ga0068868_100163328 3300005338 Unclassified 1841
37 Ga0070660_100045003 3300005339 Bacteria 3377
38 Ga0070660_100110819 3300005339 Unclassified 2183
39 Ga0070689_100060534 3300005340 Bacteria 2944
40 Ga0070687_100011158 3300005343 Bacteria 3919
41 Ga0070661_100046715 3300005344 Bacteria 3168
42 Ga0070661_100060426 3300005344 Bacteria 2781
43 Ga0070692_10143438 3300005345 Bacteria 1354
44 Ga0070668_100009738 3300005347 Bacteria 7125
45 Ga0070668_100185171 3300005347 Unclassified 1703
46 Ga0070669_100018549 3300005353 Bacteria 4971
47 Ga0070669_100317896 3300005353 Unclassified 1256
48 Ga0070675_100128770 3300005354 Unclassified 2155
49 Ga0070675_100465650 3300005354 Unclassified 1135
50 Ga0070674_100130686 3300005356 Unclassified 1871
51 Ga0070673_100010535 3300005364 Bacteria 6261
52 Ga0070673_100457358 3300005364 Bacteria 1149
53 Ga0070688_100033125 3300005365 Bacteria 3122
54 Ga0070659_100005924 3300005366 Bacteria 8812
55 Ga0070667_100274459 3300005367 Unclassified 1512
56 Ga0070709_10001876 3300005434 Bacteria 11392
57 Ga0070709_10015209 3300005434 Bacteria 4373
58 Ga0070709_10018335 3300005434 Bacteria 4029
59 Ga0070709_10049172 3300005434 Bacteria 2635
60 Ga0070709_10052546 3300005434 Bacteria 2561
61 Ga0070709_10289532 3300005434 Bacteria 1193
62 Ga0070714_100000172 3300005435 Bacteria 52540
63 Ga0070714_100034727 3300005435 Bacteria 4223
64 Ga0070714_100045723 3300005435 Bacteria 3712
65 Ga0070714_100383852 3300005435 Bacteria 1325
66 Ga0070714_100424847 3300005435 Bacteria 1259
67 Ga0070714_100523397 3300005435 Bacteria 1133
68 Ga0070713_100000342 3300005436 Bacteria 30393
69 Ga0070713_100000510 3300005436 Bacteria 24756
70 Ga0070713_100012080 3300005436 Bacteria 6322
71 Ga0070713_100014913 3300005436 Bacteria 5785
72 Ga0070713_100017439 3300005436 Bacteria 5430
73 Ga0070713_100021804 3300005436 Bacteria 4937
74 Ga0070713_100023895 3300005436 Bacteria 4752
75 Ga0070713_100038892 3300005436 Bacteria 3858
76 Ga0070713_100062715 3300005436 Bacteria 3114
77 Ga0070713_100209423 3300005436 Bacteria 1764
78 Ga0070713_100269550 3300005436 Bacteria 1558
79 Ga0070713_100303520 3300005436 Bacteria 1470
80 Ga0070713_100390775 3300005436 Bacteria 1298
81 Ga0070710_10001792 3300005437 Bacteria 10163
82 Ga0070710_10009246 3300005437 Bacteria 4817
83 Ga0070710_10064133 3300005437 Bacteria 2100
84 Ga0070710_10152561 3300005437 Unclassified 1426
85 Ga0070711_100000099 3300005439 Bacteria 45540
86 Ga0070711_100009364 3300005439 Bacteria 6031
87 Ga0070711_100024722 3300005439 Bacteria 3923
88 Ga0070711_100058468 3300005439 Bacteria 2673
89 Ga0070711_100098019 3300005439 Bacteria 2127
90 Ga0070711_100105675 3300005439 Bacteria 2057
91 Ga0070700_100040780 3300005441 Unclassified 2844
92 Ga0070694_100143215 3300005444 Bacteria 1738
93 Ga0070708_100002020 3300005445 Bacteria 15621
94 Ga0070708_100012504 3300005445 Bacteria 6928
95 Ga0070708_100027025 3300005445 Bacteria 4919
96 Ga0070708_100089495 3300005445 Unclassified 2801
97 Ga0070708_100189985 3300005445 Bacteria 1921
98 Ga0070708_100202432 3300005445 Bacteria 1859
99 Ga0070708_100332005 3300005445 Bacteria 1433
100 Ga0070708_100449384 3300005445 Bacteria 1216
101 Ga0070663_100055535 3300005455 Bacteria 2835
102 Ga0070678_100235151 3300005456 Bacteria 1529
103 Ga0070662_100028395 3300005457 Bacteria 3892
104 Ga0070662_100056858 3300005457 Unclassified 2841
105 Ga0070681_10001869 3300005458 Bacteria 19012
106 Ga0070681_10030858 3300005458 Bacteria 5380
107 Ga0070681_10040824 3300005458 Bacteria 4648
108 Ga0070681_10135010 3300005458 Bacteria 2398
109 Ga0070681_10136281 3300005458 Bacteria 2386
110 Ga0070681_10221731 3300005458 Bacteria 1806
111 Ga0070681_10271021 3300005458 Bacteria 1609
112 Ga0070681_10284010 3300005458 Bacteria 1566
113 Ga0070681_10285434 3300005458 Bacteria 1561
114 Ga0068867_100011942 3300005459 Bacteria 6136
115 Ga0068867_100088440 3300005459 Bacteria 2347
116 Ga0070685_10005938 3300005466 Bacteria 6213
117 Ga0070685_10176446 3300005466 Bacteria 1372
118 Ga0070706_100000173 3300005467 Bacteria 81500
119 Ga0070706_100013420 3300005467 Bacteria 7574
120 Ga0070706_100105960 3300005467 Unclassified 2616
121 Ga0070706_100159416 3300005467 Bacteria 2107
122 Ga0070707_100000719 3300005468 Bacteria 33081
123 Ga0070707_100002543 3300005468 Bacteria 17343
124 Ga0070707_100031701 3300005468 Bacteria 5036
125 Ga0070707_100072085 3300005468 Bacteria 3329
126 Ga0070707_100151074 3300005468 Unclassified 2261
127 Ga0070707_100770743 3300005468 Bacteria 925
128 Ga0070698_100000162 3300005471 Bacteria 61345
129 Ga0070698_100007167 3300005471 Bacteria 12080
130 Ga0070698_100046263 3300005471 Bacteria 4449
131 Ga0070698_100063129 3300005471 Bacteria 3736
132 Ga0070699_100001096 3300005518 Bacteria 25207
133 Ga0070699_100002540 3300005518 Bacteria 16392
134 Ga0070699_100198433 3300005518 Unclassified 1784
135 Ga0070699_100282924 3300005518 Unclassified 1486
136 Ga0070699_100360994 3300005518 Unclassified 1310
137 Ga0070699_100658660 3300005518 Bacteria 956
138 Ga0070679_100000510 3300005530 Bacteria 33022
139 Ga0070679_100000520 3300005530 Bacteria 32710
140 Ga0070679_100030148 3300005530 Bacteria 5354
141 Ga0070679_100190458 3300005530 Bacteria 2020
142 Ga0070679_100770500 3300005530 Bacteria 905
143 Ga0070684_100005565 3300005535 Bacteria 9670
144 Ga0070684_100006304 3300005535 Bacteria 9166
145 Ga0070684_100254228 3300005535 Bacteria 1606
146 Ga0070684_100334411 3300005535 Bacteria 1392
147 Ga0070697_100000194 3300005536 Bacteria 49634
148 Ga0070697_100002639 3300005536 Bacteria 13795
149 Ga0070697_100029174 3300005536 Bacteria 4421
150 Ga0068853_100017447 3300005539 Bacteria 5924
151 Ga0068853_100019840 3300005539 Bacteria 5584
152 Ga0068853_100056849 3300005539 Bacteria 3374
153 Ga0068853_100060553 3300005539 Unclassified 3271
154 Ga0070672_100025283 3300005543 Bacteria 4401
155 Ga0070686_100019750 3300005544 Bacteria 3976
156 Ga0070704_100454610 3300005549 Bacteria 1103
157 Ga0068855_100054000 3300005563 Bacteria 4725
158 Ga0068855_100070492 3300005563 Bacteria 4066
159 Ga0068855_100143113 3300005563 Bacteria 2724
160 Ga0068855_100312429 3300005563 Unclassified 1738
161 Ga0070664_100012980 3300005564 Bacteria 6778
162 Ga0068857_100002662 3300005577 Bacteria 14661
163 Ga0068857_100166016 3300005577 Bacteria 2005
164 Ga0068854_100019451 3300005578 Bacteria 4577
165 Ga0068854_100056700 3300005578 Unclassified 2824
166 Ga0068854_100076758 3300005578 Unclassified 2456
167 Ga0068854_100204328 3300005578 Bacteria 1555
168 Ga0068856_100078529 3300005614 Unclassified 3272
169 Ga0068856_100108659 3300005614 Bacteria 2770
170 Ga0068856_100208281 3300005614 Unclassified 1970
171 Ga0068856_100210396 3300005614 Bacteria 1960
172 Ga0068856_100540491 3300005614 Unclassified 1186
173 Ga0070702_100004820 3300005615 Bacteria 6201
174 Ga0068852_100008725 3300005616 Bacteria 7494
175 Ga0068852_100066133 3300005616 Bacteria 3156
176 Ga0068852_100122769 3300005616 Bacteria 2381
177 Ga0068859_100061519 3300005617 Bacteria 3783
178 Ga0068859_100180875 3300005617 Unclassified 2191
179 Ga0068864_100027756 3300005618 Bacteria 4783
180 Ga0068864_100050144 3300005618 Bacteria 3592
181 Ga0068864_100056258 3300005618 Bacteria 3399
182 Ga0068866_10001944 3300005718 Bacteria 8612
183 Ga0068851_10006235 3300005834 Bacteria 5441
184 Ga0068851_10008933 3300005834 Unclassified 4647
185 Ga0068870_10025939 3300005840 Bacteria 2915
186 Ga0068863_100015876 3300005841 Bacteria 7223
187 Ga0068863_100036664 3300005841 Bacteria 4671
188 Ga0068863_100062287 3300005841 Bacteria 3528
189 Ga0068863_100082639 3300005841 Bacteria 3044
190 Ga0068863_100345653 3300005841 Bacteria 1448
191 Ga0068858_100018536 3300005842 Bacteria 6516
192 Ga0068858_100105877 3300005842 Bacteria 2625
193 Ga0068858_100573562 3300005842 Unclassified 1093
194 Ga0068860_100034790 3300005843 Bacteria 4833
195 Ga0068860_100058239 3300005843 Bacteria 3672
196 Ga0068862_100038124 3300005844 Bacteria 4075
197 Ga0081455_10124268 3300005937 Bacteria 2028
198 Ga0070717_10000837 3300006028 Bacteria 20360
199 Ga0070717_10012939 3300006028 Bacteria 6373
200 Ga0070717_10045526 3300006028 Bacteria 3587
201 Ga0070717_10050844 3300006028 Bacteria 3408
202 Ga0070717_10054722 3300006028 Bacteria 3291
203 Ga0070717_10126995 3300006028 Bacteria 2190
204 Ga0070717_10130489 3300006028 Bacteria 2161
205 Ga0070717_10156475 3300006028 Bacteria 1975
206 Ga0070717_10193292 3300006028 Unclassified 1779
207 Ga0070715_10005176 3300006163 Bacteria 4332
208 Ga0070715_10024056 3300006163 Unclassified 2394
209 Ga0070716_100000315 3300006173 Bacteria 19472
210 Ga0070716_100009262 3300006173 Bacteria 4907
211 Ga0070716_100015509 3300006173 Bacteria 3916
212 Ga0070716_100115425 3300006173 Bacteria 1671
213 Ga0070716_100188957 3300006173 Bacteria 1359
214 Ga0070712_100000546 3300006175 Bacteria 21742
215 Ga0070712_100003075 3300006175 Bacteria 10319
216 Ga0070712_100005278 3300006175 Bacteria 7994
217 Ga0070712_100025709 3300006175 Bacteria 3915
218 Ga0070712_100036638 3300006175 Bacteria 3339
219 Ga0070712_100190548 3300006175 Bacteria 1604
220 Ga0070712_100204899 3300006175 Bacteria 1552
221 Ga0070712_100225602 3300006175 Bacteria 1485
222 Ga0070712_100346634 3300006175 Bacteria 1214
223 Ga0070712_100433194 3300006175 Bacteria 1092
224 Ga0097621_100058974 3300006237 Bacteria 3141
225 Ga0097621_100116896 3300006237 Bacteria 2259
226 Ga0097621_100161306 3300006237 Unclassified 1927
227 Ga0097621_100265093 3300006237 Unclassified 1508
228 Ga0068871_100174696 3300006358 Unclassified 1843
229 Ga0075433_10001164 3300006852 Bacteria 19108
230 Ga0075433_10170259 3300006852 Bacteria 1938
231 Ga0075434_100000041 3300006871 Bacteria 59536
232 Ga0075434_100072900 3300006871 Bacteria 3426
233 Ga0068865_100037031 3300006881 Unclassified 3292
234 Ga0075436_100017155 3300006914 Bacteria 4956
235 Ga0075436_100203583 3300006914 Bacteria 1402
236 Ga0097620_100061520 3300006931 Bacteria 3783
237 Ga0097620_100180848 3300006931 Unclassified 2191
238 Ga0075435_100000105 3300007076 Bacteria 45736
239 Ga0075435_100024950 3300007076 Bacteria 4648
240 Ga0075435_100056238 3300007076 Bacteria 3180
241 Ga0075435_100332039 3300007076 Unclassified 1302
242 Ga0099794_10003333 3300007265 Bacteria 6103
243 Ga0099794_10012324 3300007265 Unclassified 3686
244 Ga0099794_10098222 3300007265 Bacteria 1460
245 Ga0105250_10069312 3300009092 Unclassified 1424
246 Ga0105240_10006795 3300009093 Bacteria 16736
247 Ga0105240_10020033 3300009093 Bacteria 8930
248 Ga0105240_10020074 3300009093 Bacteria 8921
249 Ga0105240_10084816 3300009093 Bacteria 3883
250 Ga0105240_10257351 3300009093 Bacteria 2015
251 Ga0105245_10003453 3300009098 Bacteria 14159
252 Ga0105245_10058109 3300009098 Bacteria 3481
253 Ga0105245_10067483 3300009098 Bacteria 3239
254 Ga0105245_10075850 3300009098 Bacteria 3062
255 Ga0105247_10006289 3300009101 Bacteria 7361
256 Ga0105241_10005248 3300009174 Bacteria 9568
257 Ga0105241_10009745 3300009174 Bacteria 7060
258 Ga0105241_10010180 3300009174 Bacteria 6907
259 Ga0105241_10089286 3300009174 Bacteria 2428
260 Ga0105241_10196006 3300009174 Bacteria 1684
261 Ga0105241_10244496 3300009174 Bacteria 1518
262 Ga0105242_10416482 3300009176 Unclassified 1258
263 Ga0105248_10010789 3300009177 Bacteria 10087
264 Ga0105248_10168359 3300009177 Bacteria 2470
265 Ga0105248_10230295 3300009177 Unclassified 2086
266 Ga0105248_10353125 3300009177 Unclassified 1655
267 Ga0105248_10735084 3300009177 Unclassified 1113
268 Ga0105237_10090858 3300009545 Unclassified 3043
269 Ga0105237_10116949 3300009545 Bacteria 2660
270 Ga0105237_10162375 3300009545 Bacteria 2233
271 Ga0105238_10005181 3300009551 Bacteria 12883
272 Ga0105238_10107430 3300009551 Bacteria 2771
273 Ga0105238_10113491 3300009551 Unclassified 2689
274 Ga0105238_10170043 3300009551 Bacteria 2155
275 Ga0105238_10316294 3300009551 Unclassified 1547
276 Ga0105249_10011376 3300009553 Bacteria 7814
277 Ga0105249_10105191 3300009553 Unclassified 2660
278 Ga0099796_10013449 3300010159 Bacteria 2338
279 Ga0105239_10038771 3300010375 Bacteria 5220
280 Ga0105239_10753082 3300010375 Bacteria 1115
281 Ga0105239_10770551 3300010375 Bacteria 1102
282 Ga0105246_10035400 3300011119 Bacteria 3337
283 Ga0157373_10004158 3300013100 Bacteria 10914
284 Ga0157373_10045027 3300013100 Bacteria 3150
285 Ga0157371_10004724 3300013102 Bacteria 11769
286 Ga0157370_10105012 3300013104 Bacteria 2645
287 Ga0157370_10141224 3300013104 Bacteria 2244
288 Ga0157369_10026010 3300013105 Bacteria 6494
289 Ga0157369_10032939 3300013105 Bacteria 5695
290 Ga0157369_10037623 3300013105 Bacteria 5297
291 Ga0157369_10102992 3300013105 Bacteria 3040
292 Ga0157369_10137163 3300013105 Bacteria 2589
293 Ga0157369_10217159 3300013105 Bacteria 2002
294 Ga0157369_10347333 3300013105 Bacteria 1541
295 Ga0157374_10022187 3300013296 Bacteria 5661
296 Ga0157374_10046665 3300013296 Bacteria 4013
297 Ga0157374_10065747 3300013296 Bacteria 3406
298 Ga0157374_10108358 3300013296 Bacteria 2670
299 Ga0157374_10115790 3300013296 Bacteria 2582
300 Ga0157374_10271062 3300013296 Unclassified 1674
301 Ga0157378_10018892 3300013297 Bacteria 6058
302 Ga0157378_10074344 3300013297 Bacteria 3058
303 Ga0157378_10113990 3300013297 Bacteria 2483
304 Ga0157378_10437812 3300013297 Bacteria 1295
305 Ga0163162_10132089 3300013306 Bacteria 2606
306 Ga0163162_10148808 3300013306 Bacteria 2458
307 Ga0157372_10142621 3300013307 Bacteria 2761
308 Ga0157372_10144089 3300013307 Bacteria 2747
309 Ga0157372_10223391 3300013307 Bacteria 2183
310 Ga0157372_10252204 3300013307 Bacteria 2048
311 Ga0157372_10581714 3300013307 Bacteria 1305
312 Ga0157372_10598251 3300013307 Bacteria 1285
313 Ga0157375_10111416 3300013308 Bacteria 2835
314 Ga0163163_10002469 3300014325 Bacteria 15630
315 Ga0163163_10002705 3300014325 Bacteria 14974
316 Ga0163163_10005504 3300014325 Bacteria 10962
317 Ga0163163_10007476 3300014325 Bacteria 9642
318 Ga0163163_10011914 3300014325 Bacteria 7911
319 Ga0163163_10172295 3300014325 Bacteria 2211
320 Ga0182008_10004982 3300014497 Bacteria 7644
321 Ga0182008_10188387 3300014497 Bacteria 1046
322 Ga0157377_10001020 3300014745 Bacteria 11815
323 Ga0157377_10258259 3300014745 Unclassified 1132
324 Ga0157379_10014150 3300014968 Bacteria 6996
325 Ga0157379_10019365 3300014968 Bacteria 6011
326 Ga0157379_10024289 3300014968 Bacteria 5382
327 Ga0157376_10009736 3300014969 Bacteria 6997
328 Ga0157376_10059670 3300014969 Bacteria 3199
329 Ga0157376_10078340 3300014969 Unclassified 2830
330 Ga0157376_10412477 3300014969 Unclassified 1309
331 Ga0182006_1057591 3300015261 Unclassified 1477
332 Ga0182006_1063624 3300015261 Unclassified 1385
333 Ga0182007_10003288 3300015262 Bacteria 7672
334 Ga0182007_10005070 3300015262 Bacteria 5851
335 Ga0182005_1010937 3300015265 Bacteria 2600
336 Ga0163161_10007272 3300017792 Bacteria 7645
337 Ga0154015_1151417 3300020610 Bacteria 4162
338 Ga0213874_10011227 3300021377 Bacteria 2263
339 Ga0213874_10013760 3300021377 Bacteria 2104
340 Ga0224570_100845 3300022730 Bacteria 2445
341 Ga0224571_100909 3300022734 Unclassified 1773
342 Ga0224572_1003971 3300024225 Bacteria 2539
343 Ga0228598_1000222 3300024227 Bacteria 10731
344 Ga0228598_1002594 3300024227 Bacteria 3926
345 Ga0228598_1003622 3300024227 Bacteria 3313
346 Ga0207697_10025446 3300025315 Bacteria 2419
347 Ga0207656_10043180 3300025321 Bacteria 1921
348 Ga0207682_10063620 3300025893 Bacteria 1549
349 Ga0207692_10122553 3300025898 Bacteria 1458
350 Ga0207692_10127192 3300025898 Unclassified 1435
351 Ga0207692_10134960 3300025898 Bacteria 1398
352 Ga0207692_10248277 3300025898 Bacteria 1065
353 Ga0207642_10012636 3300025899 Bacteria 3055
354 Ga0207688_10024685 3300025901 Bacteria 3298
355 Ga0207680_10094776 3300025903 Unclassified 1906
356 Ga0207680_10368309 3300025903 Unclassified 1011
357 Ga0207647_10003441 3300025904 Bacteria 11878
358 Ga0207647_10008016 3300025904 Bacteria 7596
359 Ga0207685_10000821 3300025905 Bacteria 5770
360 Ga0207685_10010386 3300025905 Unclassified 2748
361 Ga0207685_10100487 3300025905 Bacteria 1236
362 Ga0207699_10001324 3300025906 Bacteria 11774
363 Ga0207699_10007254 3300025906 Bacteria 5412
364 Ga0207699_10023775 3300025906 Bacteria 3340
365 Ga0207699_10033998 3300025906 Bacteria 2886
366 Ga0207699_10041331 3300025906 Bacteria 2662
367 Ga0207699_10051403 3300025906 Bacteria 2435
368 Ga0207699_10078206 3300025906 Bacteria 2043
369 Ga0207699_10107456 3300025906 Bacteria 1782
370 Ga0207699_10118986 3300025906 Bacteria 1705
371 Ga0207699_10128681 3300025906 Bacteria 1648
372 Ga0207699_10138055 3300025906 Bacteria 1599
373 Ga0207699_10199769 3300025906 Bacteria 1354
374 Ga0207645_10000181 3300025907 Bacteria 50200
375 Ga0207643_10001458 3300025908 Bacteria 13565
376 Ga0207684_10000217 3300025910 Bacteria 88691
377 Ga0207684_10000267 3300025910 Bacteria 77172
378 Ga0207684_10031119 3300025910 Bacteria 4542
379 Ga0207684_10111242 3300025910 Unclassified 2344
380 Ga0207654_10136729 3300025911 Bacteria 1558
381 Ga0207654_10200913 3300025911 Bacteria 1312
382 Ga0207707_10012342 3300025912 Bacteria 7424
383 Ga0207707_10014434 3300025912 Bacteria 6882
384 Ga0207707_10025947 3300025912 Bacteria 5123
385 Ga0207707_10037745 3300025912 Bacteria 4221
386 Ga0207707_10053833 3300025912 Bacteria 3503
387 Ga0207707_10216738 3300025912 Bacteria 1666
388 Ga0207695_10015503 3300025913 Bacteria 8969
389 Ga0207695_10216134 3300025913 Bacteria 1826
390 Ga0207695_10265463 3300025913 Bacteria 1613
391 Ga0207671_10052924 3300025914 Unclassified 3009
392 Ga0207671_10192972 3300025914 Bacteria 1589
393 Ga0207693_10000089 3300025915 Bacteria 81143
394 Ga0207693_10000106 3300025915 Bacteria 75776
395 Ga0207693_10009582 3300025915 Bacteria 7887
396 Ga0207693_10029248 3300025915 Bacteria 4353
397 Ga0207693_10041981 3300025915 Bacteria 3600
398 Ga0207693_10089412 3300025915 Bacteria 2413
399 Ga0207693_10095356 3300025915 Bacteria 2332
400 Ga0207693_10114199 3300025915 Bacteria 2119
401 Ga0207693_10132917 3300025915 Bacteria 1956
402 Ga0207693_10185688 3300025915 Unclassified 1637
403 Ga0207693_10241303 3300025915 Bacteria 1418
404 Ga0207663_10002155 3300025916 Bacteria 9394
405 Ga0207663_10017636 3300025916 Bacteria 3983
406 Ga0207663_10127279 3300025916 Unclassified 1754
407 Ga0207663_10240979 3300025916 Bacteria 1326
408 Ga0207663_10321959 3300025916 Bacteria 1162
409 Ga0207660_10000386 3300025917 Bacteria 28948
410 Ga0207660_10181183 3300025917 Bacteria 1636
411 Ga0207660_10305961 3300025917 Unclassified 1267
412 Ga0207662_10013877 3300025918 Bacteria 4510
413 Ga0207657_10000535 3300025919 Bacteria 40427
414 Ga0207657_10001828 3300025919 Bacteria 22959
415 Ga0207649_10000350 3300025920 Bacteria 34881
416 Ga0207652_10000313 3300025921 Bacteria 50018
417 Ga0207652_10050618 3300025921 Bacteria 3560
418 Ga0207652_10077577 3300025921 Bacteria 2899
419 Ga0207652_10172465 3300025921 Bacteria 1941
420 Ga0207646_10000296 3300025922 Bacteria 67683
421 Ga0207646_10001311 3300025922 Bacteria 30882
422 Ga0207646_10047963 3300025922 Bacteria 3829
423 Ga0207646_10055621 3300025922 Bacteria 3538
424 Ga0207646_10146400 3300025922 Unclassified 2129
425 Ga0207646_10176492 3300025922 Bacteria 1930
426 Ga0207646_10224130 3300025922 Bacteria 1698
427 Ga0207681_10089797 3300025923 Unclassified 2191
428 Ga0207681_10256425 3300025923 Unclassified 1368
429 Ga0207694_10044564 3300025924 Bacteria 3425
430 Ga0207694_10162381 3300025924 Unclassified 1805
431 Ga0207650_10000223 3300025925 Bacteria 64087
432 Ga0207650_10328683 3300025925 Bacteria 1253
433 Ga0207659_10007479 3300025926 Bacteria 6721
434 Ga0207687_10001701 3300025927 Bacteria 15166
435 Ga0207687_10166810 3300025927 Unclassified 1695
436 Ga0207700_10000289 3300025928 Bacteria 29760
437 Ga0207700_10001827 3300025928 Bacteria 12063
438 Ga0207700_10001971 3300025928 Bacteria 11690
439 Ga0207700_10005081 3300025928 Bacteria 7824
440 Ga0207700_10005232 3300025928 Bacteria 7732
441 Ga0207700_10060430 3300025928 Bacteria 2870
442 Ga0207700_10078662 3300025928 Bacteria 2566
443 Ga0207700_10481931 3300025928 Bacteria 1096
444 Ga0207700_10557662 3300025928 Bacteria 1017
445 Ga0207664_10000118 3300025929 Bacteria 69258
446 Ga0207664_10177474 3300025929 Bacteria 1827
447 Ga0207664_10238198 3300025929 Bacteria 1584
448 Ga0207664_10326294 3300025929 Bacteria 1355
449 Ga0207664_10465897 3300025929 Bacteria 1129
450 Ga0207644_10010014 3300025931 Bacteria 6240
451 Ga0207690_10130674 3300025932 Unclassified 1837
452 Ga0207690_10137663 3300025932 Bacteria 1795
453 Ga0207690_10184015 3300025932 Bacteria 1575
454 Ga0207706_10009803 3300025933 Bacteria 8789
455 Ga0207706_10016556 3300025933 Bacteria 6656
456 Ga0207670_10028033 3300025936 Bacteria 3569
457 Ga0207704_10101902 3300025938 Bacteria 1916
458 Ga0207665_10001184 3300025939 Bacteria 17548
459 Ga0207665_10001526 3300025939 Bacteria 15570
460 Ga0207665_10003365 3300025939 Bacteria 10702
461 Ga0207665_10025014 3300025939 Bacteria 3937
462 Ga0207665_10029557 3300025939 Bacteria 3622
463 Ga0207665_10096517 3300025939 Bacteria 2056
464 Ga0207665_10249788 3300025939 Bacteria 1310
465 Ga0207691_10000345 3300025940 Bacteria 46775
466 Ga0207711_10057834 3300025941 Unclassified 3334
467 Ga0207711_10142033 3300025941 Unclassified 2161
468 Ga0207711_10382228 3300025941 Bacteria 1307
469 Ga0207689_10000499 3300025942 Bacteria 37043
470 Ga0207689_10004722 3300025942 Bacteria 12297
471 Ga0207661_10006500 3300025944 Bacteria 8264
472 Ga0207661_10115990 3300025944 Bacteria 2273
473 Ga0207661_10127164 3300025944 Bacteria 2178
474 Ga0207679_10000115 3300025945 Bacteria 64466
475 Ga0207667_10024023 3300025949 Bacteria 6704
476 Ga0207667_10152110 3300025949 Unclassified 2381
477 Ga0207667_10221587 3300025949 Unclassified 1938
478 Ga0207667_10305379 3300025949 Bacteria 1626
479 Ga0207651_10003270 3300025960 Bacteria 7932
480 Ga0207651_10414021 3300025960 Bacteria 1149
481 Ga0207712_10083293 3300025961 Unclassified 2334
482 Ga0207640_10042800 3300025981 Bacteria 2890
483 Ga0207640_10060894 3300025981 Unclassified 2497
484 Ga0207640_10093081 3300025981 Bacteria 2093
485 Ga0207658_10061088 3300025986 Unclassified 2814
486 Ga0207677_10002530 3300026023 Bacteria 9583
487 Ga0207677_10264018 3300026023 Bacteria 1405
488 Ga0207703_10068035 3300026035 Bacteria 2933
489 Ga0207639_10007368 3300026041 Bacteria 7501
490 Ga0207639_10151559 3300026041 Unclassified 1942
491 Ga0207678_10000130 3300026067 Bacteria 63279
492 Ga0207708_10053203 3300026075 Unclassified 3084
493 Ga0207702_10156112 3300026078 Unclassified 2080
494 Ga0207702_10312437 3300026078 Bacteria 1494
495 Ga0207641_10000287 3300026088 Bacteria 63251
496 Ga0207641_10048218 3300026088 Bacteria 3595
497 Ga0207641_10124770 3300026088 Bacteria 2304
498 Ga0207641_10153880 3300026088 Bacteria 2085
499 Ga0207648_10001253 3300026089 Bacteria 28381
500 Ga0207648_10060156 3300026089 Bacteria 3313
501 Ga0207676_10000115 3300026095 Bacteria 71633
502 Ga0207676_10115468 3300026095 Bacteria 2254
503 Ga0207676_10365792 3300026095 Unclassified 1338
504 Ga0207674_10001340 3300026116 Bacteria 31912
505 Ga0207674_10091093 3300026116 Bacteria 3040
506 Ga0207674_10102775 3300026116 Bacteria 2837
507 Ga0207683_10000217 3300026121 Bacteria 50192
508 Ga0207698_10038291 3300026142 Bacteria 3542
509 Ga0207698_10123110 3300026142 Bacteria 2199
510 Ga0207698_10341285 3300026142 Unclassified 1411
511 Ga0209588_1043516 3300027671 Bacteria 1451
512 Ga0265356_1000336 3300028017 Bacteria 8653
513 Ga0265356_1001239 3300028017 Bacteria 3865
514 Ga0265355_1000515 3300028036 Bacteria 2056
515 Ga0268266_10008412 3300028379 Bacteria 9174
516 Ga0268265_10137853 3300028380 Unclassified 2038
517 Ga0268265_10248615 3300028380 Bacteria 1573
518 Ga0268264_10014054 3300028381 Bacteria 6580
519 Ga0268264_10030440 3300028381 Bacteria 4423
520 Ga0265319_1020505 3300028563 Bacteria 2448
521 Ga0265338_10015046 3300028800 Bacteria 8540
522 Ga0265338_10030980 3300028800 Bacteria 5254
523 Ga0265338_10045521 3300028800 Bacteria 4032
524 Ga0265338_10046475 3300028800 Bacteria 3978
525 Ga0265338_10176189 3300028800 Bacteria 1634
526 Ga0265762_1000608 3300030760 Bacteria 6313
527 Ga0265762_1021513 3300030760 Bacteria 1190
528 Ga0265770_1017026 3300030878 Unclassified 1119
529 Ga0265760_10000331 3300031090 Bacteria 13250
530 Ga0265760_10000650 3300031090 Bacteria 9848
531 Ga0265760_10001481 3300031090 Bacteria 6917
532 Ga0265760_10004482 3300031090 Bacteria 4009
533 Ga0265760_10012473 3300031090 Bacteria 2430
534 Ga0265760_10023198 3300031090 Bacteria 1802
535 Ga0265325_10008604 3300031241 Bacteria 6012
536 Ga0265325_10104212 3300031241 Bacteria 1385
537 Ga0265340_10065999 3300031247 Bacteria 1723
538 Ga0265339_10005007 3300031249 Bacteria 8914
539 Ga0265339_10095478 3300031249 Unclassified 1553
540 Ga0265316_10002496 3300031344 Bacteria 19052
541 Ga0265316_10045238 3300031344 Unclassified 3496
542 Ga0265316_10068611 3300031344 Bacteria 2738
543 Ga0307408_100007923 3300031548 Bacteria 7024
544 Ga0307408_100061387 3300031548 Bacteria 2744
545 Ga0307408_100089449 3300031548 Bacteria 2321
546 Ga0265314_10002671 3300031711 Bacteria 17879
547 Ga0265314_10131280 3300031711 Bacteria 1562
548 Ga0265314_10214500 3300031711 Unclassified 1128
549 Ga0265314_10216439 3300031711 Unclassified 1121
550 Ga0307410_10026323 3300031852 Bacteria 3660
551 Ga0307410_10214071 3300031852 Bacteria 1478
552 Ga0307410_10312864 3300031852 Bacteria 1243
553 Ga0307407_10251647 3300031903 Bacteria 1211
554 Ga0307409_100006898 3300031995 Bacteria 6734
555 Ga0307409_100009620 3300031995 Bacteria 5953
556 Ga0307416_100037366 3300032002 Bacteria 3736
557 Ga0307416_100134877 3300032002 Bacteria 2231
558 Ga0307411_10045107 3300032005 Bacteria 2834
559 Ga0307415_100005529 3300032126 Bacteria 6721
560 Ga0307415_100152167 3300032126 Bacteria 1782
561 Ga0373926_0005908 3300035083 Bacteria 4047
562 Ga0373926_0012041 3300035083 Unclassified 2920
563 Ga0373934_0004825 3300035086 Bacteria 4988
564 Ga0373934_0119387 3300035086 Bacteria 1072
565 Ga0373944_0027690 3300035089 Bacteria 1682
566 Ga0373923_0014035 3300035111 Unclassified 3000
567 Ga0373923_0018837 3300035111 Unclassified 2664
568 Ga0373923_0026834 3300035111 Bacteria 2293
569 Ga0373936_0002361 3300035113 Bacteria 7064
570 Ga0373936_0003897 3300035113 Bacteria 5619
571 Ga0373945_0000938 3300035116 Bacteria 8686
572 Ga0373954_0013396 3300035118 Bacteria 3654
573 Ga0373956_0027367 3300035119 Bacteria 2475
574 Ga0373956_0060763 3300035119 Bacteria 1711
575 Ga0373956_0063953 3300035119 Bacteria 1670
576 Ga0373957_0017954 3300035120 Bacteria 2471
577 Ga0373943_0000054 3300035170 Bacteria 38966
578 Ga0373943_0051067 3300035170 Bacteria 2034
579 Ga0373946_0024678 3300035171 Unclassified 2359
580 Ga0373946_0035108 3300035171 Bacteria 2028
581 Ga0373955_0087177 3300035172 Bacteria 1774
582 Ga0373955_0123386 3300035172 Unclassified 1507
583 Ga0373924_0000069 3300035410 Bacteria 27343
584 Ga0373924_0013406 3300035410 Unclassified 3080
585 Ga0373935_0004095 3300035692 Bacteria 8527
586 Ga0373935_0004100 3300035692 Bacteria 8523
587 Ga0373935_0172120 3300035692 Bacteria 1482
588 Ga0373927_0003435 3300035695 Bacteria 11345
589 Ga0373927_0029772 3300035695 Bacteria 3561
590 Ga0373933_0000116 3300035724 Bacteria 51474
591 Ga0373933_0039746 3300035724 Bacteria 2768
592 Ga0373933_0056429 3300035724 Bacteria 2358
593 Ga0373947_0000496 3300035725 Bacteria 22749
594 Ga0373947_0071534 3300035725 Bacteria 2127
595 Ga0373947_0195915 3300035725 Bacteria 1320
596 Ga0373937_0000001 3300036401 Bacteria 478903
597 Ga0373937_0000038 3300036401 Bacteria 110582
598 Ga0373937_0012481 3300036401 Bacteria 7475
599 Ga0373937_0122709 3300036401 Unclassified 2422
600 Ga0373937_0159617 3300036401 Bacteria 2114
601 Ga0373937_0164449 3300036401 Bacteria 2080
602 Ga0373937_0242905 3300036401 Bacteria 1697
603 Ga0373937_0513774 3300036401 Bacteria 1138
604 Ga0373925_0004981 3300037068 Bacteria 9972
605 Ga0373925_0040640 3300037068 Bacteria 3444
606 Ga0373925_0240196 3300037068 Bacteria 1450
607 Ga0395898_0080946 3300037466 Bacteria 3132
608 Ga0395898_0238555 3300037466 Bacteria 1734
609 Ga0395898_0248697 3300037466 Bacteria 1696
610 Ga0395905_0004834 3300037471 Bacteria 13892
611 Ga0395905_0007187 3300037471 Bacteria 11120
612 Ga0395905_0272328 3300037471 Bacteria 1579
613 Ga0436365_1581751 3300039437 Bacteria 1756
614 Ga0436360_0737567 3300039438 Bacteria 1283
615 Ga0436363_0122844 3300039450 Bacteria 2074
616 Ga0436363_0123919 3300039450 Bacteria 3063
617 Ga0436363_1694091 3300039450 Bacteria 2791
618 Ga0451577_0163976 3300042876 Bacteria 2002
619 Ga0451577_0276542 3300042876 Bacteria 1521
620 Ga0453683_0067903 3300044673 Bacteria 2229
621 Ga0466963_0148138 3300044694 Bacteria 1629
622 Ga0453684_0232109 3300044712 Bacteria 2130
623 Ga0466957_0001150 3300044842 Bacteria 13690
624 Ga0451576_0024281 3300045051 Bacteria 6549
625 Ga0451576_0035030 3300045051 Bacteria 5328
626 Ga0451576_0343955 3300045051 Unclassified 1562
627 Ga0451576_0427990 3300045051 Bacteria 1389
628 Ga0466967_0018559 3300045976 Bacteria 5564
629 Ga0466967_0053617 3300045976 Bacteria 3545
630 Ga0466967_0256991 3300045976 Bacteria 1670
631 Ga0495592_0242591 3300046454 Bacteria 1195
632 Ga0495651_0000126 3300046462 Bacteria 56547
633 Ga0495651_0005907 3300046462 Bacteria 9338
634 Ga0495580_0000031 3300046472 Bacteria 76248
635 Ga0495580_0003785 3300046472 Bacteria 12813
636 Ga0495580_0004216 3300046472 Bacteria 12090
637 Ga0495580_0009936 3300046472 Bacteria 7449
638 Ga0495580_0034929 3300046472 Bacteria 3617
639 Ga0495580_0071429 3300046472 Unclassified 2425
640 Ga0495580_0076801 3300046472 Bacteria 2329
641 Ga0495580_0099784 3300046472 Unclassified 2020
642 Ga0495580_0164642 3300046472 Bacteria 1534
643 Ga0495582_0057712 3300046473 Bacteria 2140
644 Ga0495582_0121408 3300046473 Bacteria 1472
645 Ga0495639_0021466 3300046475 Bacteria 2827
646 Ga0495639_0183508 3300046475 Bacteria 1019
647 Ga0495664_0031134 3300046477 Bacteria 3127
648 Ga0495630_0046159 3300046517 Unclassified 3256
649 Ga0495630_0192220 3300046517 Unclassified 1557
650 Ga0495630_0340385 3300046517 Bacteria 1148
651 Ga0495652_0238731 3300046529 Bacteria 1354
652 Ga0495665_0004297 3300046531 Bacteria 7702
653 Ga0495665_0062748 3300046531 Bacteria 1962
654 Ga0495665_0122979 3300046531 Bacteria 1359
655 Ga0495587_0001501 3300046536 Bacteria 15508
656 Ga0495645_0022674 3300046543 Bacteria 4543
657 Ga0495667_0002288 3300046559 Bacteria 12842
658 Ga0495667_0070713 3300046559 Bacteria 2276
659 Ga0495667_0172976 3300046559 Bacteria 1387
660 Ga0495668_0041644 3300046616 Bacteria 2558
661 Ga0495635_0036482 3300046663 Bacteria 3407
662 Ga0495635_0040993 3300046663 Bacteria 3199
663 Ga0495635_0274398 3300046663 Bacteria 1134
664 Ga0495657_0145156 3300046675 Bacteria 1477
665 Ga0495623_0009392 3300046679 Bacteria 6351
666 Ga0495623_0028518 3300046679 Bacteria 3591
667 Ga0495646_0145875 3300046680 Bacteria 1320
668 Ga0495658_0048926 3300046683 Bacteria 2386
669 Ga0495669_0060122 3300046684 Bacteria 1717
670 Ga0495613_0216415 3300046689 Bacteria 1346
671 Ga0495624_0061461 3300046690 Bacteria 2354
672 Ga0495581_0052450 3300047315 Bacteria 2356
673 Ga0495636_0101441 3300047318 Bacteria 1259
674 Ga0495680_0000253 3300047322 Bacteria 59346
675 Ga0495680_0133332 3300047322 Bacteria 1823
676 Ga0495675_0006968 3300047444 Bacteria 6948
677 Ga0495675_0081481 3300047444 Bacteria 2038
678 Ga0495675_0199845 3300047444 Bacteria 1217
679 Ga0495593_0111828 3300047673 Bacteria 1394
680 Ga0495602_0000086 3300048088 Bacteria 90226
681 Ga0495602_0034218 3300048088 Bacteria 4757
682 Ga0495602_0093945 3300048088 Bacteria 2480
683 Ga0495602_0168717 3300048088 Bacteria 1701
684 Ga0495602_0270240 3300048088 Bacteria 1257
685 Ga0496100_0045324 3300048903 Bacteria 2822
686 Ga0496101_0271352 3300048904 Unclassified 1324
687 Ga0496102_0026278 3300048905 Bacteria 5191
688 Ga0496102_0528596 3300048905 Unclassified 1102
689 Ga0496103_0022010 3300048906 Bacteria 3837
690 Ga0496104_0014823 3300048907 Bacteria 7044
691 Ga0496104_0039786 3300048907 Bacteria 4403
692 Ga0496105_0059929 3300048908 Bacteria 3140
693 Ga0496106_0143049 3300048909 Unclassified 1882
694 Ga0496106_0219100 3300048909 Unclassified 1517
695 Ga0496107_0149337 3300048910 Unclassified 1728
696 Ga0496108_0215781 3300048911 Unclassified 1666
697 Ga0496109_0000117 3300048912 Bacteria 82245
698 Ga0496110_0004256 3300048913 Bacteria 11075
699 Ga0496110_0270704 3300048913 Unclassified 1546
700 Ga0496111_0005575 3300048914 Bacteria 8092
701 Ga0496111_0031940 3300048914 Bacteria 3753
702 Ga0496111_0116292 3300048914 Unclassified 1972
703 Ga0496112_0000283 3300048915 Bacteria 32864
704 Ga0496112_0012306 3300048915 Bacteria 7857
705 Ga0496112_0016326 3300048915 Bacteria 6953
706 Ga0496112_0024877 3300048915 Bacteria 5744
707 Ga0496112_0026656 3300048915 Bacteria 5566
708 Ga0496112_0068132 3300048915 Bacteria 3514
709 Ga0496112_0127183 3300048915 Bacteria 2519
710 Ga0496112_0210830 3300048915 Bacteria 1900
711 Ga0496112_0310943 3300048915 Bacteria 1521
712 Ga0496112_0353510 3300048915 Unclassified 1411
713 Ga0496112_0561621 3300048915 Bacteria 1075
714 Ga0496113_0002193 3300048916 Bacteria 11259
715 Ga0496113_0017207 3300048916 Bacteria 5013
716 Ga0496113_0058319 3300048916 Bacteria 2904
717 Ga0496113_0587831 3300048916 Bacteria 892
718 Ga0496115_0085529 3300048918 Bacteria 2572
719 Ga0496115_0190834 3300048918 Bacteria 1693
720 Ga0501298_008435 3300049521 Bacteria 1731
721 Ga0501299_016015 3300049522 Bacteria 1323
722 Ga0501043_0007160 3300049579 Bacteria 8867
723 Ga0501234_005607 3300049707 Bacteria 1963
724 Ga0501264_002418 3300049761 Bacteria 1746
725 nmdc:mga05p37_149937_c1 3300050507 Bacteria 2853
726 nmdc:mga0n895_47_c1 3300050512 Bacteria 73703
727 nmdc:mga0n895_72112_c1 3300050512 Bacteria 3426
728 nmdc:mga0rr50_14437_c1 3300050513 Bacteria 5181
729 nmdc:mga0rr50_284_c1 3300050513 Bacteria 27442
730 nmdc:mga0rr50_36759_c1 3300050513 Bacteria 3529
731 nmdc:mga08x19_14300_c1 3300050514 Bacteria 4813
732 nmdc:mga08x19_7601_c1 3300050514 Bacteria 6437
733 nmdc:mga08x19_8169_c1 3300050514 Bacteria 6219
734 nmdc:mga0a205_378_c1 3300050515 Bacteria 33792
735 nmdc:mga0a205_57122_c1 3300050515 Bacteria 3768
736 Ga0495601_0113659 3300053077 Bacteria 1755
737 Ga0495612_0025171 3300053078 Unclassified 2390
738 Ga0495619_0184431 3300053085 Bacteria 1444
739 Ga0496108_0000325
740 MBSR1b_contig_10381525
741 MBSR1b_contig_11555807
742 MBSR1b_contig_2529071
743 LJNas_1000457
744 JGI24743J22301_10011188
745 JGI24034J26672_10007821
746 rootL2_10145897
747 Ga0058862_12832003
748 Ga0065712_10108699
749 Ga0065715_10092393
750 Ga0065715_10103892
751 Ga0070658_10239815
752 Ga0070676_10002790
753 Ga0070683_100008507
754 Ga0070683_100105812
755 Ga0070683_100122059
756 Ga0070683_100124740
757 Ga0070683_100468831
758 Ga0070690_100003796
759 Ga0070690_100045779
760 Ga0070670_100014317
761 Ga0068869_100000550
762 Ga0068869_100352568
763 Ga0070666_10385987
764 Ga0070680_100000966
765 Ga0070680_100141560
766 Ga0070680_100196197
767 Ga0070680_100239700
768 Ga0070682_100049035
769 Ga0070682_100080276
770 Ga0070682_100293572
771 Ga0068868_100008835
772 Ga0068868_100026818
773 Ga0068868_100054761
774 Ga0068868_100163328
775 Ga0070660_100045003
776 Ga0070660_100110819
777 Ga0070689_100060534
778 Ga0070687_100011158
779 Ga0070661_100046715
780 Ga0070661_100060426
781 Ga0070692_10143438
782 Ga0070668_100009738
783 Ga0070668_100185171
784 Ga0070669_100018549
785 Ga0070669_100317896
786 Ga0070675_100128770
787 Ga0070675_100465650
788 Ga0070674_100130686
789 Ga0070673_100010535
790 Ga0070673_100457358
791 Ga0070688_100033125
792 Ga0070659_100005924
793 Ga0070667_100274459
794 Ga0070709_10001876
795 Ga0070709_10015209
796 Ga0070709_10018335
797 Ga0070709_10049172
798 Ga0070709_10052546
799 Ga0070709_10289532
800 Ga0070714_100000172
801 Ga0070714_100034727
802 Ga0070714_100045723
803 Ga0070714_100383852
804 Ga0070714_100424847
805 Ga0070714_100523397
806 Ga0070713_100000342
807 Ga0070713_100000510
808 Ga0070713_100012080
809 Ga0070713_100014913
810 Ga0070713_100017439
811 Ga0070713_100021804
812 Ga0070713_100023895
813 Ga0070713_100038892
814 Ga0070713_100062715
815 Ga0070713_100209423
816 Ga0070713_100269550
817 Ga0070713_100303520
818 Ga0070713_100390775
819 Ga0070710_10001792
820 Ga0070710_10009246
821 Ga0070710_10064133
822 Ga0070710_10152561
823 Ga0070711_100000099
824 Ga0070711_100009364
825 Ga0070711_100024722
826 Ga0070711_100058468
827 Ga0070711_100098019
828 Ga0070711_100105675
829 Ga0070700_100040780
830 Ga0070694_100143215
831 Ga0070708_100002020
832 Ga0070708_100012504
833 Ga0070708_100027025
834 Ga0070708_100089495
835 Ga0070708_100189985
836 Ga0070708_100202432
837 Ga0070708_100332005
838 Ga0070708_100449384
839 Ga0070663_100055535
840 Ga0070678_100235151
841 Ga0070662_100028395
842 Ga0070662_100056858
843 Ga0070681_10001869
844 Ga0070681_10030858
845 Ga0070681_10040824
846 Ga0070681_10135010
847 Ga0070681_10136281
848 Ga0070681_10221731
849 Ga0070681_10271021
850 Ga0070681_10284010
851 Ga0070681_10285434
852 Ga0068867_100011942
853 Ga0068867_100088440
854 Ga0070685_10005938
855 Ga0070685_10176446
856 Ga0070706_100000173
857 Ga0070706_100013420
858 Ga0070706_100105960
859 Ga0070706_100159416
860 Ga0070707_100000719
861 Ga0070707_100002543
862 Ga0070707_100031701
863 Ga0070707_100072085
864 Ga0070707_100151074
865 Ga0070707_100770743
866 Ga0070698_100000162
867 Ga0070698_100007167
868 Ga0070698_100046263
869 Ga0070698_100063129
870 Ga0070699_100001096
871 Ga0070699_100002540
872 Ga0070699_100198433
873 Ga0070699_100282924
874 Ga0070699_100360994
875 Ga0070699_100658660
876 Ga0070679_100000510
877 Ga0070679_100000520
878 Ga0070679_100030148
879 Ga0070679_100190458
880 Ga0070679_100770500
881 Ga0070684_100005565
882 Ga0070684_100006304
883 Ga0070684_100254228
884 Ga0070684_100334411
885 Ga0070697_100000194
886 Ga0070697_100002639
887 Ga0070697_100029174
888 Ga0068853_100017447
889 Ga0068853_100019840
890 Ga0068853_100056849
891 Ga0068853_100060553
892 Ga0070672_100025283
893 Ga0070686_100019750
894 Ga0070704_100454610
895 Ga0068855_100054000
896 Ga0068855_100070492
897 Ga0068855_100143113
898 Ga0068855_100312429
899 Ga0070664_100012980
900 Ga0068857_100002662
901 Ga0068857_100166016
902 Ga0068854_100019451
903 Ga0068854_100056700
904 Ga0068854_100076758
905 Ga0068854_100204328
906 Ga0068856_100078529
907 Ga0068856_100108659
908 Ga0068856_100208281
909 Ga0068856_100210396
910 Ga0068856_100540491
911 Ga0070702_100004820
912 Ga0068852_100008725
913 Ga0068852_100066133
914 Ga0068852_100122769
915 Ga0068859_100061519
916 Ga0068859_100180875
917 Ga0068864_100027756
918 Ga0068864_100050144
919 Ga0068864_100056258
920 Ga0068866_10001944
921 Ga0068851_10006235
922 Ga0068851_10008933
923 Ga0068870_10025939
924 Ga0068863_100015876
925 Ga0068863_100036664
926 Ga0068863_100062287
927 Ga0068863_100082639
928 Ga0068863_100345653
929 Ga0068858_100018536
930 Ga0068858_100105877
931 Ga0068858_100573562
932 Ga0068860_100034790
933 Ga0068860_100058239
934 Ga0068862_100038124
935 Ga0081455_10124268
936 Ga0070717_10000837
937 Ga0070717_10012939
938 Ga0070717_10045526
939 Ga0070717_10050844
940 Ga0070717_10054722
941 Ga0070717_10126995
942 Ga0070717_10130489
943 Ga0070717_10156475
944 Ga0070717_10193292
945 Ga0070715_10005176
946 Ga0070715_10024056
947 Ga0070716_100000315
948 Ga0070716_100009262
949 Ga0070716_100015509
950 Ga0070716_100115425
951 Ga0070716_100188957
952 Ga0070712_100000546
953 Ga0070712_100003075
954 Ga0070712_100005278
955 Ga0070712_100025709
956 Ga0070712_100036638
957 Ga0070712_100190548
958 Ga0070712_100204899
959 Ga0070712_100225602
960 Ga0070712_100346634
961 Ga0070712_100433194
962 Ga0097621_100058974
963 Ga0097621_100116896
964 Ga0097621_100161306
965 Ga0097621_100265093
966 Ga0068871_100174696
967 Ga0075433_10001164
968 Ga0075433_10170259
969 Ga0075434_100000041
970 Ga0075434_100072900
971 Ga0068865_100037031
972 Ga0075436_100017155
973 Ga0075436_100203583
974 Ga0097620_100061520
975 Ga0097620_100180848
976 Ga0075435_100000105
977 Ga0075435_100024950
978 Ga0075435_100056238
979 Ga0075435_100332039
980 Ga0099794_10003333
981 Ga0099794_10012324
982 Ga0099794_10098222
983 Ga0105250_10069312
984 Ga0105240_10006795
985 Ga0105240_10020033
986 Ga0105240_10020074
987 Ga0105240_10084816
988 Ga0105240_10257351
989 Ga0105245_10003453
990 Ga0105245_10058109
991 Ga0105245_10067483
992 Ga0105245_10075850
993 Ga0105247_10006289
994 Ga0105241_10005248
995 Ga0105241_10009745
996 Ga0105241_10010180
997 Ga0105241_10089286
998 Ga0105241_10196006
999 Ga0105241_10244496
1000 Ga0105242_10416482
1001 Ga0105248_10010789
1002 Ga0105248_10168359
1003 Ga0105248_10230295
1004 Ga0105248_10353125
1005 Ga0105248_10735084
1006 Ga0105237_10090858
1007 Ga0105237_10116949
1008 Ga0105237_10162375
1009 Ga0105238_10005181
1010 Ga0105238_10107430
1011 Ga0105238_10113491
1012 Ga0105238_10170043
1013 Ga0105238_10316294
1014 Ga0105249_10011376
1015 Ga0105249_10105191
1016 Ga0099796_10013449
1017 Ga0105239_10038771
1018 Ga0105239_10753082
1019 Ga0105239_10770551
1020 Ga0105246_10035400
1021 Ga0157373_10004158
1022 Ga0157373_10045027
1023 Ga0157371_10004724
1024 Ga0157370_10105012
1025 Ga0157370_10141224
1026 Ga0157369_10026010
1027 Ga0157369_10032939
1028 Ga0157369_10037623
1029 Ga0157369_10102992
1030 Ga0157369_10137163
1031 Ga0157369_10217159
1032 Ga0157369_10347333
1033 Ga0157374_10022187
1034 Ga0157374_10046665
1035 Ga0157374_10065747
1036 Ga0157374_10108358
1037 Ga0157374_10115790
1038 Ga0157374_10271062
1039 Ga0157378_10018892
1040 Ga0157378_10074344
1041 Ga0157378_10113990
1042 Ga0157378_10437812
1043 Ga0163162_10132089
1044 Ga0163162_10148808
1045 Ga0157372_10142621
1046 Ga0157372_10144089
1047 Ga0157372_10223391
1048 Ga0157372_10252204
1049 Ga0157372_10581714
1050 Ga0157372_10598251
1051 Ga0157375_10111416
1052 Ga0163163_10002469
1053 Ga0163163_10002705
1054 Ga0163163_10005504
1055 Ga0163163_10007476
1056 Ga0163163_10011914
1057 Ga0163163_10172295
1058 Ga0182008_10004982
1059 Ga0182008_10188387
1060 Ga0157377_10001020
1061 Ga0157377_10258259
1062 Ga0157379_10014150
1063 Ga0157379_10019365
1064 Ga0157379_10024289
1065 Ga0157376_10009736
1066 Ga0157376_10059670
1067 Ga0157376_10078340
1068 Ga0157376_10412477
1069 Ga0182006_1057591
1070 Ga0182006_1063624
1071 Ga0182007_10003288
1072 Ga0182007_10005070
1073 Ga0182005_1010937
1074 Ga0163161_10007272
1075 Ga0154015_1151417
1076 Ga0213874_10011227
1077 Ga0213874_10013760
1078 Ga0224570_100845
1079 Ga0224571_100909
1080 Ga0224572_1003971
1081 Ga0228598_1000222
1082 Ga0228598_1002594
1083 Ga0228598_1003622
1084 Ga0207697_10025446
1085 Ga0207656_10043180
1086 Ga0207682_10063620
1087 Ga0207692_10122553
1088 Ga0207692_10127192
1089 Ga0207692_10134960
1090 Ga0207692_10248277
1091 Ga0207642_10012636
1092 Ga0207688_10024685
1093 Ga0207680_10094776
1094 Ga0207680_10368309
1095 Ga0207647_10003441
1096 Ga0207647_10008016
1097 Ga0207685_10000821
1098 Ga0207685_10010386
1099 Ga0207685_10100487
1100 Ga0207699_10001324
1101 Ga0207699_10007254
1102 Ga0207699_10023775
1103 Ga0207699_10033998
1104 Ga0207699_10041331
1105 Ga0207699_10051403
1106 Ga0207699_10078206
1107 Ga0207699_10107456
1108 Ga0207699_10118986
1109 Ga0207699_10128681
1110 Ga0207699_10138055
1111 Ga0207699_10199769
1112 Ga0207645_10000181
1113 Ga0207643_10001458
1114 Ga0207684_10000217
1115 Ga0207684_10000267
1116 Ga0207684_10031119
1117 Ga0207684_10111242
1118 Ga0207654_10136729
1119 Ga0207654_10200913
1120 Ga0207707_10012342
1121 Ga0207707_10014434
1122 Ga0207707_10025947
1123 Ga0207707_10037745
1124 Ga0207707_10053833
1125 Ga0207707_10216738
1126 Ga0207695_10015503
1127 Ga0207695_10216134
1128 Ga0207695_10265463
1129 Ga0207671_10052924
1130 Ga0207671_10192972
1131 Ga0207693_10000089
1132 Ga0207693_10000106
1133 Ga0207693_10009582
1134 Ga0207693_10029248
1135 Ga0207693_10041981
1136 Ga0207693_10089412
1137 Ga0207693_10095356
1138 Ga0207693_10114199
1139 Ga0207693_10132917
1140 Ga0207693_10185688
1141 Ga0207693_10241303
1142 Ga0207663_10002155
1143 Ga0207663_10017636
1144 Ga0207663_10127279
1145 Ga0207663_10240979
1146 Ga0207663_10321959
1147 Ga0207660_10000386
1148 Ga0207660_10181183
1149 Ga0207660_10305961
1150 Ga0207662_10013877
1151 Ga0207657_10000535
1152 Ga0207657_10001828
1153 Ga0207649_10000350
1154 Ga0207652_10000313
1155 Ga0207652_10050618
1156 Ga0207652_10077577
1157 Ga0207652_10172465
1158 Ga0207646_10000296
1159 Ga0207646_10001311
1160 Ga0207646_10047963
1161 Ga0207646_10055621
1162 Ga0207646_10146400
1163 Ga0207646_10176492
1164 Ga0207646_10224130
1165 Ga0207681_10089797
1166 Ga0207681_10256425
1167 Ga0207694_10044564
1168 Ga0207694_10162381
1169 Ga0207650_10000223
1170 Ga0207650_10328683
1171 Ga0207659_10007479
1172 Ga0207687_10001701
1173 Ga0207687_10166810
1174 Ga0207700_10000289
1175 Ga0207700_10001827
1176 Ga0207700_10001971
1177 Ga0207700_10005081
1178 Ga0207700_10005232
1179 Ga0207700_10060430
1180 Ga0207700_10078662
1181 Ga0207700_10481931
1182 Ga0207700_10557662
1183 Ga0207664_10000118
1184 Ga0207664_10177474
1185 Ga0207664_10238198
1186 Ga0207664_10326294
1187 Ga0207664_10465897
1188 Ga0207644_10010014
1189 Ga0207690_10130674
1190 Ga0207690_10137663
1191 Ga0207690_10184015
1192 Ga0207706_10009803
1193 Ga0207706_10016556
1194 Ga0207670_10028033
1195 Ga0207704_10101902
1196 Ga0207665_10001184
1197 Ga0207665_10001526
1198 Ga0207665_10003365
1199 Ga0207665_10025014
1200 Ga0207665_10029557
1201 Ga0207665_10096517
1202 Ga0207665_10249788
1203 Ga0207691_10000345
1204 Ga0207711_10057834
1205 Ga0207711_10142033
1206 Ga0207711_10382228
1207 Ga0207689_10000499
1208 Ga0207689_10004722
1209 Ga0207661_10006500
1210 Ga0207661_10115990
1211 Ga0207661_10127164
1212 Ga0207679_10000115
1213 Ga0207667_10024023
1214 Ga0207667_10152110
1215 Ga0207667_10221587
1216 Ga0207667_10305379
1217 Ga0207651_10003270
1218 Ga0207651_10414021
1219 Ga0207712_10083293
1220 Ga0207640_10042800
1221 Ga0207640_10060894
1222 Ga0207640_10093081
1223 Ga0207658_10061088
1224 Ga0207677_10002530
1225 Ga0207677_10264018
1226 Ga0207703_10068035
1227 Ga0207639_10007368
1228 Ga0207639_10151559
1229 Ga0207678_10000130
1230 Ga0207708_10053203
1231 Ga0207702_10156112
1232 Ga0207702_10312437
1233 Ga0207641_10000287
1234 Ga0207641_10048218
1235 Ga0207641_10124770
1236 Ga0207641_10153880
1237 Ga0207648_10001253
1238 Ga0207648_10060156
1239 Ga0207676_10000115
1240 Ga0207676_10115468
1241 Ga0207676_10365792
1242 Ga0207674_10001340
1243 Ga0207674_10091093
1244 Ga0207674_10102775
1245 Ga0207683_10000217
1246 Ga0207698_10038291
1247 Ga0207698_10123110
1248 Ga0207698_10341285
1249 Ga0209588_1043516
1250 Ga0265356_1000336
1251 Ga0265356_1001239
1252 Ga0265355_1000515
1253 Ga0268266_10008412
1254 Ga0268265_10137853
1255 Ga0268265_10248615
1256 Ga0268264_10014054
1257 Ga0268264_10030440
1258 Ga0265319_1020505
1259 Ga0265338_10015046
1260 Ga0265338_10030980
1261 Ga0265338_10045521
1262 Ga0265338_10046475
1263 Ga0265338_10176189
1264 Ga0265762_1000608
1265 Ga0265762_1021513
1266 Ga0265770_1017026
1267 Ga0265760_10000331
1268 Ga0265760_10000650
1269 Ga0265760_10001481
1270 Ga0265760_10004482
1271 Ga0265760_10012473
1272 Ga0265760_10023198
1273 Ga0265325_10008604
1274 Ga0265325_10104212
1275 Ga0265340_10065999
1276 Ga0265339_10005007
1277 Ga0265339_10095478
1278 Ga0265316_10002496
1279 Ga0265316_10045238
1280 Ga0265316_10068611
1281 Ga0307408_100007923
1282 Ga0307408_100061387
1283 Ga0307408_100089449
1284 Ga0265314_10002671
1285 Ga0265314_10131280
1286 Ga0265314_10214500
1287 Ga0265314_10216439
1288 Ga0307410_10026323
1289 Ga0307410_10214071
1290 Ga0307410_10312864
1291 Ga0307407_10251647
1292 Ga0307409_100006898
1293 Ga0307409_100009620
1294 Ga0307416_100037366
1295 Ga0307416_100134877
1296 Ga0307411_10045107
1297 Ga0307415_100005529
1298 Ga0307415_100152167
1299 Ga0373926_0005908
1300 Ga0373926_0012041
1301 Ga0373934_0004825
1302 Ga0373934_0119387
1303 Ga0373944_0027690
1304 Ga0373923_0014035
1305 Ga0373923_0018837
1306 Ga0373923_0026834
1307 Ga0373936_0002361
1308 Ga0373936_0003897
1309 Ga0373945_0000938
1310 Ga0373954_0013396
1311 Ga0373956_0027367
1312 Ga0373956_0060763
1313 Ga0373956_0063953
1314 Ga0373957_0017954
1315 Ga0373943_0000054
1316 Ga0373943_0051067
1317 Ga0373946_0024678
1318 Ga0373946_0035108
1319 Ga0373955_0087177
1320 Ga0373955_0123386
1321 Ga0373924_0000069
1322 Ga0373924_0013406
1323 Ga0373935_0004095
1324 Ga0373935_0004100
1325 Ga0373935_0172120
1326 Ga0373927_0003435
1327 Ga0373927_0029772
1328 Ga0373933_0000116
1329 Ga0373933_0039746
1330 Ga0373933_0056429
1331 Ga0373947_0000496
1332 Ga0373947_0071534
1333 Ga0373947_0195915
1334 Ga0373937_0000001
1335 Ga0373937_0000038
1336 Ga0373937_0012481
1337 Ga0373937_0122709
1338 Ga0373937_0159617
1339 Ga0373937_0164449
1340 Ga0373937_0242905
1341 Ga0373937_0513774
1342 Ga0373925_0004981
1343 Ga0373925_0040640
1344 Ga0373925_0240196
1345 Ga0395898_0080946
1346 Ga0395898_0238555
1347 Ga0395898_0248697
1348 Ga0395905_0004834
1349 Ga0395905_0007187
1350 Ga0395905_0272328
1351 Ga0436365_1581751
1352 Ga0436360_0737567
1353 Ga0436363_0122844
1354 Ga0436363_0123919
1355 Ga0436363_1694091
1356 Ga0451577_0163976
1357 Ga0451577_0276542
1358 Ga0453683_0067903
1359 Ga0466963_0148138
1360 Ga0453684_0232109
1361 Ga0466957_0001150
1362 Ga0451576_0024281
1363 Ga0451576_0035030
1364 Ga0451576_0343955
1365 Ga0451576_0427990
1366 Ga0466967_0018559
1367 Ga0466967_0053617
1368 Ga0466967_0256991
1369 Ga0495592_0242591
1370 Ga0495651_0000126
1371 Ga0495651_0005907
1372 Ga0495580_0000031
1373 Ga0495580_0003785
1374 Ga0495580_0004216
1375 Ga0495580_0009936
1376 Ga0495580_0034929
1377 Ga0495580_0071429
1378 Ga0495580_0076801
1379 Ga0495580_0099784
1380 Ga0495580_0164642
1381 Ga0495582_0057712
1382 Ga0495582_0121408
1383 Ga0495639_0021466
1384 Ga0495639_0183508
1385 Ga0495664_0031134
1386 Ga0495630_0046159
1387 Ga0495630_0192220
1388 Ga0495630_0340385
1389 Ga0495652_0238731
1390 Ga0495665_0004297
1391 Ga0495665_0062748
1392 Ga0495665_0122979
1393 Ga0495587_0001501
1394 Ga0495645_0022674
1395 Ga0495667_0002288
1396 Ga0495667_0070713
1397 Ga0495667_0172976
1398 Ga0495668_0041644
1399 Ga0495635_0036482
1400 Ga0495635_0040993
1401 Ga0495635_0274398
1402 Ga0495657_0145156
1403 Ga0495623_0009392
1404 Ga0495623_0028518
1405 Ga0495646_0145875
1406 Ga0495658_0048926
1407 Ga0495669_0060122
1408 Ga0495613_0216415
1409 Ga0495624_0061461
1410 Ga0495581_0052450
1411 Ga0495636_0101441
1412 Ga0495680_0000253
1413 Ga0495680_0133332
1414 Ga0495675_0006968
1415 Ga0495675_0081481
1416 Ga0495675_0199845
1417 Ga0495593_0111828
1418 Ga0495602_0000086
1419 Ga0495602_0034218
1420 Ga0495602_0093945
1421 Ga0495602_0168717
1422 Ga0495602_0270240
1423 Ga0496100_0045324
1424 Ga0496101_0271352
1425 Ga0496102_0026278
1426 Ga0496102_0528596
1427 Ga0496103_0022010
1428 Ga0496104_0014823
1429 Ga0496104_0039786
1430 Ga0496105_0059929
1431 Ga0496106_0143049
1432 Ga0496106_0219100
1433 Ga0496107_0149337
1434 Ga0496108_0215781
1435 Ga0496109_0000117
1436 Ga0496110_0004256
1437 Ga0496110_0270704
1438 Ga0496111_0005575
1439 Ga0496111_0031940
1440 Ga0496111_0116292
1441 Ga0496112_0000283
1442 Ga0496112_0012306
1443 Ga0496112_0016326
1444 Ga0496112_0024877
1445 Ga0496112_0026656
1446 Ga0496112_0068132
1447 Ga0496112_0127183
1448 Ga0496112_0210830
1449 Ga0496112_0310943
1450 Ga0496112_0353510
1451 Ga0496112_0561621
1452 Ga0496113_0002193
1453 Ga0496113_0017207
1454 Ga0496113_0058319
1455 Ga0496113_0587831
1456 Ga0496115_0085529
1457 Ga0496115_0190834
1458 Ga0501298_008435
1459 Ga0501299_016015
1460 Ga0501043_0007160
1461 Ga0501234_005607
1462 Ga0501264_002418
1463 nmdc:mga05p37_149937_c1
1464 nmdc:mga0n895_47_c1
1465 nmdc:mga0n895_72112_c1
1466 nmdc:mga0rr50_14437_c1
1467 nmdc:mga0rr50_284_c1
1468 nmdc:mga0rr50_36759_c1
1469 nmdc:mga08x19_14300_c1
1470 nmdc:mga08x19_7601_c1
1471 nmdc:mga08x19_8169_c1
1472 nmdc:mga0a205_378_c1
1473 nmdc:mga0a205_57122_c1
1474 Ga0495601_0113659
1475 Ga0495612_0025171
1476 Ga0495619_0184431

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01739

CheR

CheR methyltransferase, SAM binding domain

180

314

0.96

PF03705

CheR_N

CheR methyltransferase, all-alpha domain

35

86

0.96

PF01739

CheR

CheR methyltransferase, SAM binding domain

102

166

0.87

PF08241

Methyltransf_11

Methyltransferase domain

185

292

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xlx-assembly1.cif.gz_D crystal structure of the c-terminal domain of cher1 containing sah 0.8979 81 296
5xlx-assembly1.cif.gz_D crystal structure of the c-terminal domain of cher1 containing sah 0.8936 81 296
1bc5-assembly1.cif.gz_A chemotaxis receptor recognition by protein methyltransferase cher 0.8489 5 296
1bc5-assembly1.cif.gz_A chemotaxis receptor recognition by protein methyltransferase cher 0.8403 5 296
5ftw-assembly1.cif.gz_A crystal structure of glutamate o-methyltransferase in complex with s- adenosyl-l-homocysteine (sah) from bacillus subtilis 0.8193 12 296
ID Description Score Start End Superfamily
1bc5A01 Mainly Alpha;Orthogonal Bundle;Chemotaxis Receptor Methyltransferase Cher; domain 1;Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.8902 5 77 1.10.155.10
1bc5A01 Mainly Alpha;Orthogonal Bundle;Chemotaxis Receptor Methyltransferase Cher; domain 1;Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.8581 5 77 1.10.155.10
5ftwA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8579 78 296 3.40.50.150
5ftwA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8538 78 296 3.40.50.150
1af7A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.833 78 294 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A5C6AAG3-F1-model_v4 Alkaline phosphatase synthesis transcriptional regulatory protein PhoP 0.9611 166 269 GO:0000160
GO:0008757
AF-A0A2U3KRD1-F1-model_v4 MCP methyltransferase, CheR-type 0.9594 98 300 GO:0008757
GO:0032259
AF-A0A378V4S5-F1-model_v4 Chemotaxis protein CheR (EC 2.1.1.80) 0.9467 163 299 GO:0006355
GO:0008983
GO:0032259
AF-A0A4V5TN03-F1-model_v4 Protein-glutamate O-methyltransferase CheR (EC 2.1.1.80) 0.9397 162 240 GO:0008983
GO:0032259
AF-A0A7V0SEE8-F1-model_v4 Protein-glutamate O-methyltransferase CheR 0.9368 159 300 GO:0008757

Map