F478073
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 733 | 296 | 733 | 128 |
Family's Representative Sequence
| Representative Sequence | 3300006847|Ga0075431_101876898|Ga0075431_1018768981 |
| Length | 154 |
| Sequence | VARKQSPARLVVALSVAACLAIFLLYTSIAGGGTVSLRPSQLSGHTGTAQLFGVVLAPVSGDAHAGGLRFRLRDIDGKATVPVVYRGSVPDLFRVGRDVYLKGRMQNGVFIGDRDSLVTKCPSKYQPAKPAVRASGPGEGVWGNREVPPAHSAY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 180 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 183 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 185 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 186 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 187 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 188 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 189 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 190 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 192 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 193 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 194 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 195 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 196 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 197 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 198 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 200 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 201 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 202 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 203 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 204 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 205 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 210 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 211 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 212 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 213 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 214 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 215 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 216 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 217 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 218 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 271 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 272 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 273 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 274 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 275 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 276 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 279 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 280 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 281 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 282 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 283 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 284 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 285 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 286 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 287 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.32 |
| Metatranscriptomes | 0.68 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.68 |
| Nodule | 0 |
| Rhizoplane | 11.73 |
| Rhizosphere | 87.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10045839 | 3300001991 | Unclassified | 884 |
| 2 | JGI24744J21845_10000622 | 3300002077 | Bacteria | 6458 |
| 3 | JGI25407J50210_10146073 | 3300003373 | Unclassified | 582 |
| 4 | JGI25405J52794_10083919 | 3300003911 | Unclassified | 702 |
| 5 | Ga0070676_10190990 | 3300005328 | Bacteria | 1337 |
| 6 | Ga0070683_100003106 | 3300005329 | Bacteria | 13377 |
| 7 | Ga0070683_100137920 | 3300005329 | Unclassified | 2310 |
| 8 | Ga0070683_100507905 | 3300005329 | Bacteria | 1152 |
| 9 | Ga0070683_100619576 | 3300005329 | Bacteria | 1036 |
| 10 | Ga0070683_100937589 | 3300005329 | Bacteria | 831 |
| 11 | Ga0070683_100945383 | 3300005329 | Bacteria | 827 |
| 12 | Ga0070690_100007009 | 3300005330 | Bacteria | 6425 |
| 13 | Ga0070690_100007646 | 3300005330 | Bacteria | 6193 |
| 14 | Ga0070690_100589022 | 3300005330 | Bacteria | 843 |
| 15 | Ga0070670_101605766 | 3300005331 | Unclassified | 598 |
| 16 | Ga0068869_100229275 | 3300005334 | Bacteria | 1475 |
| 17 | Ga0068869_101011290 | 3300005334 | Bacteria | 724 |
| 18 | Ga0070680_100049628 | 3300005336 | Bacteria | 3422 |
| 19 | Ga0070680_100207710 | 3300005336 | Bacteria | 1652 |
| 20 | Ga0070680_100272761 | 3300005336 | Bacteria | 1432 |
| 21 | Ga0070680_101344892 | 3300005336 | Unclassified | 618 |
| 22 | Ga0070682_100007893 | 3300005337 | Bacteria | 5990 |
| 23 | Ga0070682_100214642 | 3300005337 | Bacteria | 1366 |
| 24 | Ga0070682_100809864 | 3300005337 | Bacteria | 762 |
| 25 | Ga0068868_100042584 | 3300005338 | Bacteria | 3545 |
| 26 | Ga0068868_100160946 | 3300005338 | Bacteria | 1854 |
| 27 | Ga0068868_100925271 | 3300005338 | Bacteria | 794 |
| 28 | Ga0068868_101460763 | 3300005338 | Bacteria | 639 |
| 29 | Ga0068868_101712880 | 3300005338 | Bacteria | 592 |
| 30 | Ga0068868_101941983 | 3300005338 | Unclassified | 558 |
| 31 | Ga0070660_100014662 | 3300005339 | Bacteria | 5654 |
| 32 | Ga0070660_100016236 | 3300005339 | Bacteria | 5399 |
| 33 | Ga0070660_100088499 | 3300005339 | Bacteria | 2439 |
| 34 | Ga0070689_100001929 | 3300005340 | Bacteria | 13414 |
| 35 | Ga0070689_100427957 | 3300005340 | Bacteria | 1123 |
| 36 | Ga0070691_10014538 | 3300005341 | Bacteria | 3613 |
| 37 | Ga0070691_10015360 | 3300005341 | Bacteria | 3519 |
| 38 | Ga0070691_10060012 | 3300005341 | Unclassified | 1828 |
| 39 | Ga0070691_10264227 | 3300005341 | Bacteria | 928 |
| 40 | Ga0070687_100016945 | 3300005343 | Bacteria | 3338 |
| 41 | Ga0070687_100143302 | 3300005343 | Bacteria | 1394 |
| 42 | Ga0070687_100258891 | 3300005343 | Bacteria | 1085 |
| 43 | Ga0070692_10003456 | 3300005345 | Bacteria | 6406 |
| 44 | Ga0070692_10016755 | 3300005345 | Bacteria | 3490 |
| 45 | Ga0070668_100054346 | 3300005347 | Bacteria | 3089 |
| 46 | Ga0070668_100955672 | 3300005347 | Unclassified | 768 |
| 47 | Ga0070669_100055884 | 3300005353 | Bacteria | 2893 |
| 48 | Ga0070675_100138657 | 3300005354 | Bacteria | 2077 |
| 49 | Ga0070675_100434258 | 3300005354 | Bacteria | 1176 |
| 50 | Ga0070671_100138439 | 3300005355 | Bacteria | 2053 |
| 51 | Ga0070671_100343898 | 3300005355 | Unclassified | 1273 |
| 52 | Ga0070674_100004383 | 3300005356 | Bacteria | 8043 |
| 53 | Ga0070674_100014406 | 3300005356 | Bacteria | 4917 |
| 54 | Ga0070674_101976768 | 3300005356 | Unclassified | 531 |
| 55 | Ga0070673_100012370 | 3300005364 | Bacteria | 5857 |
| 56 | Ga0070673_100173255 | 3300005364 | Bacteria | 1843 |
| 57 | Ga0070673_100367597 | 3300005364 | Unclassified | 1280 |
| 58 | Ga0070673_101651676 | 3300005364 | Unclassified | 606 |
| 59 | Ga0070688_100027090 | 3300005365 | Bacteria | 3411 |
| 60 | Ga0070688_100288853 | 3300005365 | Bacteria | 1181 |
| 61 | Ga0070688_100385078 | 3300005365 | Bacteria | 1034 |
| 62 | Ga0070659_100003504 | 3300005366 | Bacteria | 11176 |
| 63 | Ga0070659_100020196 | 3300005366 | Bacteria | 5058 |
| 64 | Ga0070659_100250168 | 3300005366 | Bacteria | 1469 |
| 65 | Ga0070659_100272169 | 3300005366 | Bacteria | 1407 |
| 66 | Ga0070659_100482819 | 3300005366 | Bacteria | 1055 |
| 67 | Ga0070667_100360629 | 3300005367 | Bacteria | 1317 |
| 68 | Ga0070667_100797232 | 3300005367 | Bacteria | 877 |
| 69 | Ga0070703_10042315 | 3300005406 | Bacteria | 1424 |
| 70 | Ga0070709_10006351 | 3300005434 | Bacteria | 6436 |
| 71 | Ga0070714_100432599 | 3300005435 | Unclassified | 1248 |
| 72 | Ga0070714_101321508 | 3300005435 | Unclassified | 704 |
| 73 | Ga0070713_100068611 | 3300005436 | Bacteria | 2988 |
| 74 | Ga0070710_10004670 | 3300005437 | Bacteria | 6478 |
| 75 | Ga0070710_11258686 | 3300005437 | Unclassified | 549 |
| 76 | Ga0070701_10002084 | 3300005438 | Bacteria | 7592 |
| 77 | Ga0070701_10080816 | 3300005438 | Bacteria | 1759 |
| 78 | Ga0070701_10140634 | 3300005438 | Unclassified | 1380 |
| 79 | Ga0070711_100174269 | 3300005439 | Bacteria | 1642 |
| 80 | Ga0070705_100071436 | 3300005440 | Bacteria | 2099 |
| 81 | Ga0070700_100196915 | 3300005441 | Bacteria | 1413 |
| 82 | Ga0070700_100447030 | 3300005441 | Unclassified | 983 |
| 83 | Ga0070700_100577814 | 3300005441 | Bacteria | 877 |
| 84 | Ga0070694_100006339 | 3300005444 | Bacteria | 7178 |
| 85 | Ga0070694_100015580 | 3300005444 | Bacteria | 4777 |
| 86 | Ga0070663_100009824 | 3300005455 | Bacteria | 5945 |
| 87 | Ga0070663_100478178 | 3300005455 | Bacteria | 1031 |
| 88 | Ga0070663_100688211 | 3300005455 | Bacteria | 868 |
| 89 | Ga0070678_100001355 | 3300005456 | Bacteria | 13027 |
| 90 | Ga0070678_100024433 | 3300005456 | Bacteria | 4045 |
| 91 | Ga0070678_100041323 | 3300005456 | Bacteria | 3268 |
| 92 | Ga0070678_100289181 | 3300005456 | Bacteria | 1389 |
| 93 | Ga0070678_100905202 | 3300005456 | Bacteria | 807 |
| 94 | Ga0070662_100014629 | 3300005457 | Bacteria | 5246 |
| 95 | Ga0070662_100032138 | 3300005457 | Bacteria | 3687 |
| 96 | Ga0070662_100066548 | 3300005457 | Unclassified | 2644 |
| 97 | Ga0070662_100568910 | 3300005457 | Viruses | 951 |
| 98 | Ga0070681_10281295 | 3300005458 | Bacteria | 1574 |
| 99 | Ga0070681_10628878 | 3300005458 | Bacteria | 988 |
| 100 | Ga0070681_11988529 | 3300005458 | Bacteria | 509 |
| 101 | Ga0068867_100004104 | 3300005459 | Bacteria | 10238 |
| 102 | Ga0070685_10060121 | 3300005466 | Bacteria | 2221 |
| 103 | Ga0070685_11477932 | 3300005466 | Unclassified | 523 |
| 104 | Ga0070706_100015559 | 3300005467 | Bacteria | 7027 |
| 105 | Ga0070698_100012651 | 3300005471 | Bacteria | 8935 |
| 106 | Ga0070698_100018972 | 3300005471 | Bacteria | 7234 |
| 107 | Ga0070679_100025017 | 3300005530 | Bacteria | 5854 |
| 108 | Ga0070679_100100735 | 3300005530 | Bacteria | 2875 |
| 109 | Ga0070679_100139700 | 3300005530 | Bacteria | 2403 |
| 110 | Ga0070679_100145965 | 3300005530 | Bacteria | 2344 |
| 111 | Ga0070679_100285032 | 3300005530 | Bacteria | 1604 |
| 112 | Ga0070679_100481822 | 3300005530 | Unclassified | 1185 |
| 113 | Ga0070679_101460179 | 3300005530 | Bacteria | 630 |
| 114 | Ga0070684_100059385 | 3300005535 | Bacteria | 3343 |
| 115 | Ga0070684_100190116 | 3300005535 | Bacteria | 1868 |
| 116 | Ga0070684_100955018 | 3300005535 | Bacteria | 804 |
| 117 | Ga0068853_100003775 | 3300005539 | Bacteria | 11609 |
| 118 | Ga0068853_100067026 | 3300005539 | Bacteria | 3118 |
| 119 | Ga0068853_100418115 | 3300005539 | Bacteria | 1257 |
| 120 | Ga0068853_100471891 | 3300005539 | Unclassified | 1182 |
| 121 | Ga0068853_100609799 | 3300005539 | Unclassified | 1037 |
| 122 | Ga0070672_100340238 | 3300005543 | Bacteria | 1278 |
| 123 | Ga0070686_100272113 | 3300005544 | Bacteria | 1246 |
| 124 | Ga0070695_100006793 | 3300005545 | Bacteria | 6774 |
| 125 | Ga0070695_100093867 | 3300005545 | Unclassified | 2008 |
| 126 | Ga0070695_100917705 | 3300005545 | Viruses | 708 |
| 127 | Ga0070695_101184591 | 3300005545 | Bacteria | 628 |
| 128 | Ga0070696_100008063 | 3300005546 | Bacteria | 7039 |
| 129 | Ga0070696_100013726 | 3300005546 | Bacteria | 5440 |
| 130 | Ga0070696_100016796 | 3300005546 | Bacteria | 4937 |
| 131 | Ga0070696_100081569 | 3300005546 | Bacteria | 2292 |
| 132 | Ga0070696_101531295 | 3300005546 | Unclassified | 571 |
| 133 | Ga0070693_100009252 | 3300005547 | Bacteria | 4894 |
| 134 | Ga0070693_100109962 | 3300005547 | Bacteria | 1694 |
| 135 | Ga0070693_100221042 | 3300005547 | Unclassified | 1241 |
| 136 | Ga0070665_100229666 | 3300005548 | Bacteria | 1856 |
| 137 | Ga0070704_100017949 | 3300005549 | Bacteria | 4513 |
| 138 | Ga0070704_100055926 | 3300005549 | Bacteria | 2799 |
| 139 | Ga0070704_101287460 | 3300005549 | Bacteria | 668 |
| 140 | Ga0070704_101468867 | 3300005549 | Bacteria | 626 |
| 141 | Ga0068855_100039995 | 3300005563 | Bacteria | 5566 |
| 142 | Ga0068855_100040250 | 3300005563 | Bacteria | 5547 |
| 143 | Ga0068855_100329890 | 3300005563 | Bacteria | 1685 |
| 144 | Ga0068855_100363210 | 3300005563 | Bacteria | 1593 |
| 145 | Ga0068855_100699520 | 3300005563 | Bacteria | 1085 |
| 146 | Ga0068855_100746606 | 3300005563 | Bacteria | 1044 |
| 147 | Ga0070664_100482268 | 3300005564 | Bacteria | 1141 |
| 148 | Ga0068857_100106802 | 3300005577 | Bacteria | 2514 |
| 149 | Ga0068854_100032576 | 3300005578 | Bacteria | 3627 |
| 150 | Ga0068854_100046824 | 3300005578 | Bacteria | 3080 |
| 151 | Ga0068854_100623591 | 3300005578 | Unclassified | 923 |
| 152 | Ga0068854_101765634 | 3300005578 | Unclassified | 567 |
| 153 | Ga0068856_100007081 | 3300005614 | Bacteria | 10950 |
| 154 | Ga0068856_100607644 | 3300005614 | Bacteria | 1114 |
| 155 | Ga0068856_101594374 | 3300005614 | Bacteria | 666 |
| 156 | Ga0068856_101634763 | 3300005614 | Viruses | 657 |
| 157 | Ga0070702_100007484 | 3300005615 | Bacteria | 5233 |
| 158 | Ga0070702_100021016 | 3300005615 | Bacteria | 3428 |
| 159 | Ga0070702_100077498 | 3300005615 | Bacteria | 1981 |
| 160 | Ga0070702_101076032 | 3300005615 | Unclassified | 641 |
| 161 | Ga0068852_100327449 | 3300005616 | Bacteria | 1490 |
| 162 | Ga0068852_100383002 | 3300005616 | Viruses | 1380 |
| 163 | Ga0068852_100597961 | 3300005616 | Bacteria | 1107 |
| 164 | Ga0068859_100120993 | 3300005617 | Bacteria | 2684 |
| 165 | Ga0068859_100483423 | 3300005617 | Bacteria | 1334 |
| 166 | Ga0068864_100081045 | 3300005618 | Bacteria | 2845 |
| 167 | Ga0068866_10012434 | 3300005718 | Bacteria | 3708 |
| 168 | Ga0068866_10013230 | 3300005718 | Bacteria | 3614 |
| 169 | Ga0068861_100003381 | 3300005719 | Bacteria | 10580 |
| 170 | Ga0068861_100018958 | 3300005719 | Bacteria | 4907 |
| 171 | Ga0068861_100077252 | 3300005719 | Bacteria | 2597 |
| 172 | Ga0068861_100295761 | 3300005719 | Bacteria | 1400 |
| 173 | Ga0068861_100634562 | 3300005719 | Bacteria | 985 |
| 174 | Ga0068870_11226170 | 3300005840 | Unclassified | 544 |
| 175 | Ga0068858_100550596 | 3300005842 | Bacteria | 1117 |
| 176 | Ga0068860_100475495 | 3300005843 | Bacteria | 1245 |
| 177 | Ga0068862_100069889 | 3300005844 | Bacteria | 3031 |
| 178 | Ga0068862_100479816 | 3300005844 | Bacteria | 1177 |
| 179 | Ga0068862_100702218 | 3300005844 | Bacteria | 980 |
| 180 | Ga0081455_10005481 | 3300005937 | Bacteria | 13915 |
| 181 | Ga0081455_10052374 | 3300005937 | Bacteria | 3495 |
| 182 | Ga0081538_10000544 | 3300005981 | Bacteria | 41533 |
| 183 | Ga0081538_10005013 | 3300005981 | Bacteria | 12060 |
| 184 | Ga0081538_10007205 | 3300005981 | Bacteria | 9655 |
| 185 | Ga0081538_10212254 | 3300005981 | Unclassified | 779 |
| 186 | Ga0081540_1002081 | 3300005983 | Bacteria | 16689 |
| 187 | Ga0081540_1010083 | 3300005983 | Bacteria | 6431 |
| 188 | Ga0081540_1020045 | 3300005983 | Bacteria | 4037 |
| 189 | Ga0070717_10159358 | 3300006028 | Bacteria | 1957 |
| 190 | Ga0070717_10355180 | 3300006028 | Bacteria | 1311 |
| 191 | Ga0075365_10088285 | 3300006038 | Bacteria | 2109 |
| 192 | Ga0075432_10007341 | 3300006058 | Bacteria | 3752 |
| 193 | Ga0070715_10118432 | 3300006163 | Bacteria | 1259 |
| 194 | Ga0070716_100295463 | 3300006173 | Bacteria | 1124 |
| 195 | Ga0070716_100700007 | 3300006173 | Bacteria | 774 |
| 196 | Ga0070716_101180602 | 3300006173 | Unclassified | 614 |
| 197 | Ga0070712_100016882 | 3300006175 | Bacteria | 4721 |
| 198 | Ga0070712_100567015 | 3300006175 | Bacteria | 958 |
| 199 | Ga0075367_10129912 | 3300006178 | Bacteria | 1557 |
| 200 | Ga0097621_100005876 | 3300006237 | Bacteria | 8669 |
| 201 | Ga0097621_100241507 | 3300006237 | Bacteria | 1579 |
| 202 | Ga0097621_100785022 | 3300006237 | Unclassified | 882 |
| 203 | Ga0068871_100138006 | 3300006358 | Bacteria | 2072 |
| 204 | Ga0075428_100285345 | 3300006844 | Bacteria | 1776 |
| 205 | Ga0075431_100006169 | 3300006847 | Bacteria | 11895 |
| 206 | Ga0075431_100278062 | 3300006847 | Bacteria | 1695 |
| 207 | Ga0075431_101876898 | 3300006847 | Unclassified | 555 |
| 208 | Ga0075434_100098662 | 3300006871 | Bacteria | 2926 |
| 209 | Ga0075434_100131466 | 3300006871 | Bacteria | 2522 |
| 210 | Ga0075434_100276366 | 3300006871 | Bacteria | 1699 |
| 211 | Ga0075429_100038949 | 3300006880 | Bacteria | 4137 |
| 212 | Ga0068865_100008007 | 3300006881 | Bacteria | 6525 |
| 213 | Ga0068865_100016053 | 3300006881 | Bacteria | 4784 |
| 214 | Ga0068865_100292648 | 3300006881 | Bacteria | 1300 |
| 215 | Ga0068865_101401149 | 3300006881 | Unclassified | 624 |
| 216 | Ga0075436_100011666 | 3300006914 | Bacteria | 6029 |
| 217 | Ga0097620_100120997 | 3300006931 | Bacteria | 2684 |
| 218 | Ga0097620_100483446 | 3300006931 | Bacteria | 1334 |
| 219 | Ga0075435_100054169 | 3300007076 | Bacteria | 3237 |
| 220 | Ga0075435_100893229 | 3300007076 | Bacteria | 775 |
| 221 | Ga0075435_101228836 | 3300007076 | Bacteria | 656 |
| 222 | Ga0105250_10187788 | 3300009092 | Bacteria | 869 |
| 223 | Ga0105240_10388353 | 3300009093 | Bacteria | 1575 |
| 224 | Ga0105240_10828223 | 3300009093 | Bacteria | 1000 |
| 225 | Ga0111539_10129955 | 3300009094 | Bacteria | 2950 |
| 226 | Ga0111539_10442063 | 3300009094 | Bacteria | 1514 |
| 227 | Ga0111539_11489475 | 3300009094 | Bacteria | 785 |
| 228 | Ga0105245_10026959 | 3300009098 | Bacteria | 5060 |
| 229 | Ga0105245_10033334 | 3300009098 | Bacteria | 4564 |
| 230 | Ga0105245_10038520 | 3300009098 | Bacteria | 4254 |
| 231 | Ga0105245_10039907 | 3300009098 | Bacteria | 4180 |
| 232 | Ga0105245_10431354 | 3300009098 | Unclassified | 1323 |
| 233 | Ga0105245_10676799 | 3300009098 | Bacteria | 1064 |
| 234 | Ga0114129_10118719 | 3300009147 | Bacteria | 3643 |
| 235 | Ga0105243_10068354 | 3300009148 | Bacteria | 2863 |
| 236 | Ga0105243_10106939 | 3300009148 | Bacteria | 2333 |
| 237 | Ga0105243_10403366 | 3300009148 | Bacteria | 1271 |
| 238 | Ga0105243_11004036 | 3300009148 | Unclassified | 837 |
| 239 | Ga0105241_10225946 | 3300009174 | Bacteria | 1576 |
| 240 | Ga0105242_10009803 | 3300009176 | Bacteria | 7343 |
| 241 | Ga0105242_10049217 | 3300009176 | Bacteria | 3429 |
| 242 | Ga0105242_10477372 | 3300009176 | Bacteria | 1181 |
| 243 | Ga0105242_10518972 | 3300009176 | Bacteria | 1136 |
| 244 | Ga0105242_10750173 | 3300009176 | Bacteria | 961 |
| 245 | Ga0105248_10051290 | 3300009177 | Bacteria | 4630 |
| 246 | Ga0105248_10484933 | 3300009177 | Unclassified | 1393 |
| 247 | Ga0105248_11104389 | 3300009177 | Bacteria | 896 |
| 248 | Ga0105237_10586598 | 3300009545 | Bacteria | 1121 |
| 249 | Ga0105237_10803775 | 3300009545 | Bacteria | 947 |
| 250 | Ga0105238_11287724 | 3300009551 | Unclassified | 757 |
| 251 | Ga0105249_10017004 | 3300009553 | Bacteria | 6453 |
| 252 | Ga0105249_10017306 | 3300009553 | Bacteria | 6399 |
| 253 | Ga0105249_10269560 | 3300009553 | Bacteria | 1695 |
| 254 | Ga0105249_11014088 | 3300009553 | Bacteria | 899 |
| 255 | Ga0105239_10039565 | 3300010375 | Bacteria | 5166 |
| 256 | Ga0105239_10054523 | 3300010375 | Bacteria | 4386 |
| 257 | Ga0105239_10069819 | 3300010375 | Bacteria | 3859 |
| 258 | Ga0105239_10111319 | 3300010375 | Bacteria | 3035 |
| 259 | Ga0105239_10119731 | 3300010375 | Bacteria | 2922 |
| 260 | Ga0105239_10326454 | 3300010375 | Bacteria | 1731 |
| 261 | Ga0105239_10651944 | 3300010375 | Unclassified | 1203 |
| 262 | Ga0105246_10342201 | 3300011119 | Unclassified | 1223 |
| 263 | Ga0105246_11510152 | 3300011119 | Unclassified | 631 |
| 264 | Ga0157338_1038168 | 3300012515 | Unclassified | 643 |
| 265 | Ga0157371_10059211 | 3300013102 | Bacteria | 2715 |
| 266 | Ga0157371_10231855 | 3300013102 | Bacteria | 1327 |
| 267 | Ga0157369_11048051 | 3300013105 | Unclassified | 834 |
| 268 | Ga0157369_11649568 | 3300013105 | Bacteria | 652 |
| 269 | Ga0157374_10481176 | 3300013296 | Unclassified | 1245 |
| 270 | Ga0157378_10500455 | 3300013297 | Bacteria | 1214 |
| 271 | Ga0163162_10111381 | 3300013306 | Unclassified | 2835 |
| 272 | Ga0163162_10194728 | 3300013306 | Bacteria | 2155 |
| 273 | Ga0157372_10059494 | 3300013307 | Bacteria | 4273 |
| 274 | Ga0157372_10481095 | 3300013307 | Bacteria | 1447 |
| 275 | Ga0157375_10012591 | 3300013308 | Bacteria | 7506 |
| 276 | Ga0157375_10827290 | 3300013308 | Unclassified | 1074 |
| 277 | Ga0157375_12389446 | 3300013308 | Bacteria | 631 |
| 278 | Ga0163163_11110528 | 3300014325 | Bacteria | 854 |
| 279 | Ga0157380_11215358 | 3300014326 | Bacteria | 798 |
| 280 | Ga0182008_10084232 | 3300014497 | Bacteria | 1566 |
| 281 | Ga0157377_10130402 | 3300014745 | Unclassified | 1535 |
| 282 | Ga0157377_11257723 | 3300014745 | Unclassified | 576 |
| 283 | Ga0157379_10426745 | 3300014968 | Bacteria | 1221 |
| 284 | Ga0163161_10028037 | 3300017792 | Bacteria | 3997 |
| 285 | Ga0163161_10416536 | 3300017792 | Bacteria | 1080 |
| 286 | Ga0197907_10551217 | 3300020069 | Bacteria | 603 |
| 287 | Ga0206354_10514906 | 3300020081 | Bacteria | 3714 |
| 288 | Ga0206354_11598535 | 3300020081 | Bacteria | 1445 |
| 289 | Ga0206353_10357655 | 3300020082 | Bacteria | 2445 |
| 290 | Ga0206353_10693181 | 3300020082 | Bacteria | 4202 |
| 291 | Ga0207656_10332846 | 3300025321 | Unclassified | 756 |
| 292 | Ga0207653_10009818 | 3300025885 | Bacteria | 2985 |
| 293 | Ga0207682_10090035 | 3300025893 | Bacteria | 1329 |
| 294 | Ga0207692_10043747 | 3300025898 | Bacteria | 2230 |
| 295 | Ga0207642_10063558 | 3300025899 | Bacteria | 1727 |
| 296 | Ga0207688_10052488 | 3300025901 | Bacteria | 2285 |
| 297 | Ga0207688_10095138 | 3300025901 | Bacteria | 1714 |
| 298 | Ga0207680_10075491 | 3300025903 | Bacteria | 2102 |
| 299 | Ga0207685_10083663 | 3300025905 | Bacteria | 1327 |
| 300 | Ga0207699_10082672 | 3300025906 | Unclassified | 1995 |
| 301 | Ga0207684_10014015 | 3300025910 | Bacteria | 6925 |
| 302 | Ga0207684_10475833 | 3300025910 | Unclassified | 1071 |
| 303 | Ga0207707_10064009 | 3300025912 | Bacteria | 3200 |
| 304 | Ga0207707_10085432 | 3300025912 | Bacteria | 2757 |
| 305 | Ga0207707_10087336 | 3300025912 | Bacteria | 2725 |
| 306 | Ga0207707_10556095 | 3300025912 | Bacteria | 974 |
| 307 | Ga0207707_11050666 | 3300025912 | Unclassified | 666 |
| 308 | Ga0207671_10407307 | 3300025914 | Bacteria | 1082 |
| 309 | Ga0207671_11251326 | 3300025914 | Unclassified | 579 |
| 310 | Ga0207693_10000778 | 3300025915 | Bacteria | 28589 |
| 311 | Ga0207693_10431284 | 3300025915 | Bacteria | 1030 |
| 312 | Ga0207663_10144465 | 3300025916 | Bacteria | 1661 |
| 313 | Ga0207663_11181720 | 3300025916 | Bacteria | 616 |
| 314 | Ga0207660_10043173 | 3300025917 | Bacteria | 3168 |
| 315 | Ga0207660_10079261 | 3300025917 | Bacteria | 2409 |
| 316 | Ga0207660_10175083 | 3300025917 | Bacteria | 1663 |
| 317 | Ga0207662_10143107 | 3300025918 | Bacteria | 1516 |
| 318 | Ga0207662_10235096 | 3300025918 | Bacteria | 1198 |
| 319 | Ga0207657_10012421 | 3300025919 | Bacteria | 8414 |
| 320 | Ga0207657_10053411 | 3300025919 | Bacteria | 3500 |
| 321 | Ga0207657_10120872 | 3300025919 | Bacteria | 2155 |
| 322 | Ga0207657_10240791 | 3300025919 | Bacteria | 1444 |
| 323 | Ga0207652_10018732 | 3300025921 | Bacteria | 5681 |
| 324 | Ga0207652_10102648 | 3300025921 | Bacteria | 2528 |
| 325 | Ga0207652_10118863 | 3300025921 | Bacteria | 2350 |
| 326 | Ga0207652_10119579 | 3300025921 | Bacteria | 2343 |
| 327 | Ga0207652_10137085 | 3300025921 | Bacteria | 2186 |
| 328 | Ga0207652_10182128 | 3300025921 | Bacteria | 1888 |
| 329 | Ga0207652_11099849 | 3300025921 | Bacteria | 695 |
| 330 | Ga0207646_10608923 | 3300025922 | Bacteria | 980 |
| 331 | Ga0207681_10234729 | 3300025923 | Bacteria | 1425 |
| 332 | Ga0207694_10309847 | 3300025924 | Bacteria | 1301 |
| 333 | Ga0207659_10042011 | 3300025926 | Bacteria | 3204 |
| 334 | Ga0207659_10263969 | 3300025926 | Unclassified | 1402 |
| 335 | Ga0207687_10018420 | 3300025927 | Bacteria | 4609 |
| 336 | Ga0207687_10033989 | 3300025927 | Bacteria | 3461 |
| 337 | Ga0207687_10152141 | 3300025927 | Bacteria | 1767 |
| 338 | Ga0207687_10728954 | 3300025927 | Viruses | 843 |
| 339 | Ga0207700_10057007 | 3300025928 | Bacteria | 2944 |
| 340 | Ga0207664_10803203 | 3300025929 | Unclassified | 846 |
| 341 | Ga0207644_10024038 | 3300025931 | Bacteria | 4179 |
| 342 | Ga0207644_10179775 | 3300025931 | Bacteria | 1657 |
| 343 | Ga0207644_10781812 | 3300025931 | Bacteria | 798 |
| 344 | Ga0207690_10071533 | 3300025932 | Bacteria | 2392 |
| 345 | Ga0207690_10083304 | 3300025932 | Bacteria | 2239 |
| 346 | Ga0207690_10245659 | 3300025932 | Bacteria | 1380 |
| 347 | Ga0207690_10354611 | 3300025932 | Bacteria | 1161 |
| 348 | Ga0207690_10845119 | 3300025932 | Bacteria | 758 |
| 349 | Ga0207706_10011465 | 3300025933 | Bacteria | 8073 |
| 350 | Ga0207706_10015721 | 3300025933 | Bacteria | 6840 |
| 351 | Ga0207706_10047569 | 3300025933 | Bacteria | 3794 |
| 352 | Ga0207686_10069082 | 3300025934 | Bacteria | 2265 |
| 353 | Ga0207686_10234476 | 3300025934 | Bacteria | 1332 |
| 354 | Ga0207686_10648946 | 3300025934 | Bacteria | 835 |
| 355 | Ga0207709_10031487 | 3300025935 | Bacteria | 3099 |
| 356 | Ga0207709_10048847 | 3300025935 | Bacteria | 2580 |
| 357 | Ga0207709_10192125 | 3300025935 | Bacteria | 1451 |
| 358 | Ga0207670_10174928 | 3300025936 | Bacteria | 1612 |
| 359 | Ga0207670_10528441 | 3300025936 | Bacteria | 961 |
| 360 | Ga0207669_10003176 | 3300025937 | Bacteria | 7092 |
| 361 | Ga0207669_10038933 | 3300025937 | Bacteria | 2743 |
| 362 | Ga0207669_10271584 | 3300025937 | Bacteria | 1274 |
| 363 | Ga0207669_10538121 | 3300025937 | Bacteria | 940 |
| 364 | Ga0207704_10018471 | 3300025938 | Bacteria | 3640 |
| 365 | Ga0207704_10025797 | 3300025938 | Bacteria | 3213 |
| 366 | Ga0207665_10025299 | 3300025939 | Bacteria | 3916 |
| 367 | Ga0207691_10017123 | 3300025940 | Bacteria | 6875 |
| 368 | Ga0207691_10398484 | 3300025940 | Bacteria | 1174 |
| 369 | Ga0207691_10458851 | 3300025940 | Bacteria | 1084 |
| 370 | Ga0207691_11022940 | 3300025940 | Unclassified | 689 |
| 371 | Ga0207711_10221812 | 3300025941 | Bacteria | 1729 |
| 372 | Ga0207711_10222751 | 3300025941 | Bacteria | 1726 |
| 373 | Ga0207689_10125421 | 3300025942 | Bacteria | 2112 |
| 374 | Ga0207689_10234974 | 3300025942 | Bacteria | 1515 |
| 375 | Ga0207689_10268418 | 3300025942 | Bacteria | 1412 |
| 376 | Ga0207689_11166964 | 3300025942 | Unclassified | 649 |
| 377 | Ga0207689_11257855 | 3300025942 | Unclassified | 622 |
| 378 | Ga0207661_10030813 | 3300025944 | Bacteria | 4136 |
| 379 | Ga0207661_10042448 | 3300025944 | Bacteria | 3585 |
| 380 | Ga0207661_10086838 | 3300025944 | Bacteria | 2597 |
| 381 | Ga0207661_10856073 | 3300025944 | Unclassified | 837 |
| 382 | Ga0207661_11050542 | 3300025944 | Unclassified | 750 |
| 383 | Ga0207661_11682482 | 3300025944 | Bacteria | 580 |
| 384 | Ga0207679_10372925 | 3300025945 | Bacteria | 1249 |
| 385 | Ga0207679_10380933 | 3300025945 | Bacteria | 1237 |
| 386 | Ga0207667_10054229 | 3300025949 | Bacteria | 4217 |
| 387 | Ga0207667_10114531 | 3300025949 | Bacteria | 2779 |
| 388 | Ga0207667_10217497 | 3300025949 | Bacteria | 1957 |
| 389 | Ga0207667_10296724 | 3300025949 | Bacteria | 1651 |
| 390 | Ga0207651_10011111 | 3300025960 | Bacteria | 5024 |
| 391 | Ga0207651_10081749 | 3300025960 | Bacteria | 2330 |
| 392 | Ga0207651_10166261 | 3300025960 | Bacteria | 1735 |
| 393 | Ga0207712_10059287 | 3300025961 | Bacteria | 2709 |
| 394 | Ga0207712_10328821 | 3300025961 | Unclassified | 1264 |
| 395 | Ga0207712_10387990 | 3300025961 | Bacteria | 1171 |
| 396 | Ga0207712_11525472 | 3300025961 | Bacteria | 599 |
| 397 | Ga0207668_10579452 | 3300025972 | Bacteria | 975 |
| 398 | Ga0207668_10634384 | 3300025972 | Bacteria | 934 |
| 399 | Ga0207668_11051881 | 3300025972 | Bacteria | 729 |
| 400 | Ga0207640_10041232 | 3300025981 | Bacteria | 2935 |
| 401 | Ga0207640_10314602 | 3300025981 | Bacteria | 1244 |
| 402 | Ga0207640_10587548 | 3300025981 | Bacteria | 941 |
| 403 | Ga0207658_10412003 | 3300025986 | Unclassified | 1190 |
| 404 | Ga0207677_10272810 | 3300026023 | Bacteria | 1384 |
| 405 | Ga0207677_10316876 | 3300026023 | Bacteria | 1294 |
| 406 | Ga0207677_11548282 | 3300026023 | Unclassified | 613 |
| 407 | Ga0207639_10015667 | 3300026041 | Bacteria | 5349 |
| 408 | Ga0207639_10098640 | 3300026041 | Bacteria | 2355 |
| 409 | Ga0207639_10296368 | 3300026041 | Bacteria | 1428 |
| 410 | Ga0207639_10981831 | 3300026041 | Bacteria | 791 |
| 411 | Ga0207678_10012714 | 3300026067 | Bacteria | 7392 |
| 412 | Ga0207708_10003195 | 3300026075 | Bacteria | 12075 |
| 413 | Ga0207708_10080217 | 3300026075 | Bacteria | 2508 |
| 414 | Ga0207708_10185951 | 3300026075 | Bacteria | 1651 |
| 415 | Ga0207708_10700649 | 3300026075 | Unclassified | 866 |
| 416 | Ga0207702_10276359 | 3300026078 | Bacteria | 1586 |
| 417 | Ga0207702_11042627 | 3300026078 | Viruses | 811 |
| 418 | Ga0207702_11066949 | 3300026078 | Bacteria | 802 |
| 419 | Ga0207702_11194741 | 3300026078 | Bacteria | 755 |
| 420 | Ga0207648_10002086 | 3300026089 | Bacteria | 21760 |
| 421 | Ga0207648_10004570 | 3300026089 | Bacteria | 14187 |
| 422 | Ga0207648_10301583 | 3300026089 | Bacteria | 1437 |
| 423 | Ga0207648_10361423 | 3300026089 | Bacteria | 1310 |
| 424 | Ga0207648_11974008 | 3300026089 | Bacteria | 545 |
| 425 | Ga0207676_10063585 | 3300026095 | Bacteria | 2931 |
| 426 | Ga0207674_10066775 | 3300026116 | Bacteria | 3622 |
| 427 | Ga0207675_100002688 | 3300026118 | Bacteria | 17542 |
| 428 | Ga0207675_100015447 | 3300026118 | Bacteria | 7122 |
| 429 | Ga0207675_100046297 | 3300026118 | Bacteria | 4063 |
| 430 | Ga0207683_10000041 | 3300026121 | Bacteria | 94017 |
| 431 | Ga0207683_10036784 | 3300026121 | Bacteria | 4263 |
| 432 | Ga0207683_10111619 | 3300026121 | Bacteria | 2448 |
| 433 | Ga0207683_10312670 | 3300026121 | Bacteria | 1438 |
| 434 | Ga0207683_10863968 | 3300026121 | Bacteria | 840 |
| 435 | Ga0207698_10207669 | 3300026142 | Bacteria | 1759 |
| 436 | Ga0207698_10647340 | 3300026142 | Viruses | 1046 |
| 437 | Ga0209983_1122351 | 3300027665 | Unclassified | 594 |
| 438 | Ga0209998_10010246 | 3300027717 | Bacteria | 1941 |
| 439 | Ga0207428_10000892 | 3300027907 | Bacteria | 33470 |
| 440 | Ga0207428_10002067 | 3300027907 | Bacteria | 20252 |
| 441 | Ga0268266_10896920 | 3300028379 | Unclassified | 857 |
| 442 | Ga0268265_10218546 | 3300028380 | Bacteria | 1666 |
| 443 | Ga0268265_10561831 | 3300028380 | Bacteria | 1085 |
| 444 | Ga0307408_100101790 | 3300031548 | Bacteria | 2190 |
| 445 | Ga0307405_10167921 | 3300031731 | Bacteria | 1562 |
| 446 | Ga0307406_11039426 | 3300031901 | Bacteria | 704 |
| 447 | Ga0307409_100988213 | 3300031995 | Bacteria | 859 |
| 448 | Ga0307416_100202656 | 3300032002 | Bacteria | 1884 |
| 449 | Ga0307416_101827999 | 3300032002 | Bacteria | 711 |
| 450 | Ga0307415_100065331 | 3300032126 | Bacteria | 2535 |
| 451 | Ga0307415_100088096 | 3300032126 | Bacteria | 2239 |
| 452 | Ga0373959_0191654 | 3300034820 | Unclassified | 536 |
| 453 | Ga0373951_0152433 | 3300035091 | Unclassified | 649 |
| 454 | Ga0373932_0038275 | 3300035112 | Bacteria | 1371 |
| 455 | Ga0373936_0142413 | 3300035113 | Bacteria | 1036 |
| 456 | Ga0373941_0219299 | 3300035115 | Bacteria | 730 |
| 457 | Ga0373945_0018054 | 3300035116 | Bacteria | 2397 |
| 458 | Ga0373960_0093402 | 3300035121 | Unclassified | 965 |
| 459 | Ga0373943_0068627 | 3300035170 | Bacteria | 1790 |
| 460 | Ga0373943_0580498 | 3300035170 | Bacteria | 659 |
| 461 | Ga0373961_0129816 | 3300035241 | Bacteria | 843 |
| 462 | Ga0373947_0005440 | 3300035725 | Bacteria | 7430 |
| 463 | Ga0373925_0252649 | 3300037068 | Unclassified | 1414 |
| 464 | Ga0395899_0006128 | 3300037312 | Bacteria | 9319 |
| 465 | Ga0395899_0010821 | 3300037312 | Bacteria | 6993 |
| 466 | Ga0395899_0018968 | 3300037312 | Bacteria | 5227 |
| 467 | Ga0395899_0116376 | 3300037312 | Bacteria | 1918 |
| 468 | Ga0395899_0257562 | 3300037312 | Unclassified | 1195 |
| 469 | Ga0395899_0264069 | 3300037312 | Bacteria | 1176 |
| 470 | Ga0395900_0002962 | 3300037418 | Bacteria | 18481 |
| 471 | Ga0395900_0010594 | 3300037418 | Bacteria | 9428 |
| 472 | Ga0395900_0012510 | 3300037418 | Bacteria | 8680 |
| 473 | Ga0395900_0039626 | 3300037418 | Bacteria | 4854 |
| 474 | Ga0395900_0115891 | 3300037418 | Bacteria | 2749 |
| 475 | Ga0395900_0263878 | 3300037418 | Archaea | 1719 |
| 476 | Ga0395900_0990870 | 3300037418 | Viruses | 761 |
| 477 | Ga0395898_0001595 | 3300037466 | Bacteria | 30933 |
| 478 | Ga0395898_0001862 | 3300037466 | Bacteria | 27022 |
| 479 | Ga0395898_0008942 | 3300037466 | Bacteria | 10550 |
| 480 | Ga0395898_0192927 | 3300037466 | Bacteria | 1946 |
| 481 | Ga0395898_0269908 | 3300037466 | Bacteria | 1622 |
| 482 | Ga0395898_0311853 | 3300037466 | Unclassified | 1501 |
| 483 | Ga0395898_1171438 | 3300037466 | Bacteria | 700 |
| 484 | Ga0395898_1563840 | 3300037466 | Unclassified | 584 |
| 485 | Ga0395905_0001862 | 3300037471 | Bacteria | 24295 |
| 486 | Ga0395905_0007290 | 3300037471 | Bacteria | 11023 |
| 487 | Ga0395905_0012603 | 3300037471 | Bacteria | 8134 |
| 488 | Ga0395905_0039785 | 3300037471 | Bacteria | 4412 |
| 489 | Ga0395905_0092114 | 3300037471 | Bacteria | 2842 |
| 490 | Ga0395905_0107670 | 3300037471 | Bacteria | 2617 |
| 491 | Ga0395905_0915276 | 3300037471 | Archaea | 780 |
| 492 | Ga0395901_0001901 | 3300038443 | Bacteria | 21558 |
| 493 | Ga0395901_0006362 | 3300038443 | Bacteria | 11967 |
| 494 | Ga0395901_0009061 | 3300038443 | Bacteria | 10077 |
| 495 | Ga0395901_0013690 | 3300038443 | Bacteria | 8245 |
| 496 | Ga0395901_0034065 | 3300038443 | Bacteria | 5259 |
| 497 | Ga0395901_0121702 | 3300038443 | Bacteria | 2742 |
| 498 | Ga0395901_0154480 | 3300038443 | Unclassified | 2410 |
| 499 | Ga0395901_0624181 | 3300038443 | Bacteria | 1084 |
| 500 | Ga0395901_0669118 | 3300038443 | Unclassified | 1039 |
| 501 | Ga0395901_0783982 | 3300038443 | Bacteria | 943 |
| 502 | Ga0395901_0792224 | 3300038443 | Unclassified | 937 |
| 503 | Ga0395901_0887697 | 3300038443 | Unclassified | 874 |
| 504 | Ga0242420_020251 | 3300038996 | Bacteria | 1182 |
| 505 | Ga0451789_0958954 | 3300041443 | Bacteria | 687 |
| 506 | Ga0451797_0838146 | 3300041453 | Unclassified | 548 |
| 507 | Ga0451798_0067737 | 3300041458 | Bacteria | 734 |
| 508 | Ga0451800_0962065 | 3300041459 | Bacteria | 590 |
| 509 | Ga0451847_0074877 | 3300041503 | Bacteria | 578 |
| 510 | Ga0451849_1263875 | 3300041505 | Bacteria | 571 |
| 511 | Ga0451853_0324016 | 3300041512 | Bacteria | 978 |
| 512 | Ga0451853_1845315 | 3300041512 | Bacteria | 558 |
| 513 | Ga0439448_0001968 | 3300042005 | Bacteria | 5492 |
| 514 | Ga0439448_0024047 | 3300042005 | Bacteria | 1903 |
| 515 | Ga0466963_0465383 | 3300044694 | Bacteria | 892 |
| 516 | Ga0466960_0310707 | 3300044901 | Bacteria | 890 |
| 517 | Ga0451576_0742727 | 3300045051 | Bacteria | 1031 |
| 518 | Ga0451576_1511440 | 3300045051 | Unclassified | 697 |
| 519 | Ga0466958_0000480 | 3300045836 | Bacteria | 16712 |
| 520 | Ga0466967_0034221 | 3300045976 | Bacteria | 4310 |
| 521 | Ga0466967_0389284 | 3300045976 | Bacteria | 1355 |
| 522 | Ga0466967_0425673 | 3300045976 | Bacteria | 1294 |
| 523 | Ga0466967_1160218 | 3300045976 | Unclassified | 770 |
| 524 | Ga0495592_0526491 | 3300046454 | Unclassified | 730 |
| 525 | Ga0495592_0552510 | 3300046454 | Bacteria | 708 |
| 526 | Ga0495592_0738792 | 3300046454 | Unclassified | 589 |
| 527 | Ga0495603_0002347 | 3300046455 | Bacteria | 11109 |
| 528 | Ga0495603_0043669 | 3300046455 | Bacteria | 2676 |
| 529 | Ga0495603_0162306 | 3300046455 | Bacteria | 1296 |
| 530 | Ga0495603_0211194 | 3300046455 | Bacteria | 1121 |
| 531 | Ga0495603_0305353 | 3300046455 | Bacteria | 914 |
| 532 | Ga0495629_0132610 | 3300046459 | Bacteria | 1735 |
| 533 | Ga0495629_0490397 | 3300046459 | Unclassified | 829 |
| 534 | Ga0495641_0063952 | 3300046461 | Bacteria | 1657 |
| 535 | Ga0495641_0118037 | 3300046461 | Bacteria | 1183 |
| 536 | Ga0495641_0487998 | 3300046461 | Unclassified | 561 |
| 537 | Ga0495641_0564264 | 3300046461 | Unclassified | 520 |
| 538 | Ga0495651_0292485 | 3300046462 | Unclassified | 1096 |
| 539 | Ga0495651_0598183 | 3300046462 | Unclassified | 696 |
| 540 | Ga0495653_0132255 | 3300046463 | Bacteria | 1765 |
| 541 | Ga0495582_0156706 | 3300046473 | Bacteria | 1294 |
| 542 | Ga0495582_0242706 | 3300046473 | Bacteria | 1032 |
| 543 | Ga0495582_0875037 | 3300046473 | Unclassified | 519 |
| 544 | Ga0495605_0343941 | 3300046474 | Unclassified | 626 |
| 545 | Ga0495639_0176694 | 3300046475 | Unclassified | 1038 |
| 546 | Ga0495662_0186743 | 3300046476 | Bacteria | 1022 |
| 547 | Ga0495664_0126535 | 3300046477 | Bacteria | 1546 |
| 548 | Ga0495664_0592973 | 3300046477 | Unclassified | 659 |
| 549 | Ga0495584_0040909 | 3300046491 | Bacteria | 2340 |
| 550 | Ga0495584_0085623 | 3300046491 | Bacteria | 1588 |
| 551 | Ga0495584_0187982 | 3300046491 | Unclassified | 1050 |
| 552 | Ga0495584_0270372 | 3300046491 | Bacteria | 864 |
| 553 | Ga0495584_0339608 | 3300046491 | Bacteria | 763 |
| 554 | Ga0495594_0045194 | 3300046499 | Bacteria | 2417 |
| 555 | Ga0495594_0506557 | 3300046499 | Bacteria | 685 |
| 556 | Ga0495583_0287467 | 3300046506 | Bacteria | 655 |
| 557 | Ga0495616_0150105 | 3300046513 | Bacteria | 1055 |
| 558 | Ga0495618_0198279 | 3300046514 | Bacteria | 1271 |
| 559 | Ga0495618_0556536 | 3300046514 | Bacteria | 686 |
| 560 | Ga0495628_0697699 | 3300046516 | Unclassified | 717 |
| 561 | Ga0495628_0697730 | 3300046516 | Bacteria | 717 |
| 562 | Ga0495628_0925357 | 3300046516 | Unclassified | 604 |
| 563 | Ga0495630_0017194 | 3300046517 | Bacteria | 5295 |
| 564 | Ga0495630_0396983 | 3300046517 | Unclassified | 1057 |
| 565 | Ga0495631_0216644 | 3300046518 | Unclassified | 818 |
| 566 | Ga0495637_0076799 | 3300046520 | Unclassified | 1338 |
| 567 | Ga0495644_0049631 | 3300046523 | Unclassified | 1575 |
| 568 | Ga0495644_0222683 | 3300046523 | Unclassified | 729 |
| 569 | Ga0495663_0009546 | 3300046525 | Bacteria | 2692 |
| 570 | Ga0495663_0038384 | 3300046525 | Bacteria | 1448 |
| 571 | Ga0495666_0025960 | 3300046526 | Bacteria | 2891 |
| 572 | Ga0495642_0036910 | 3300046528 | Bacteria | 1976 |
| 573 | Ga0495642_0163311 | 3300046528 | Bacteria | 966 |
| 574 | Ga0495640_0526130 | 3300046533 | Unclassified | 718 |
| 575 | Ga0495598_0348435 | 3300046537 | Unclassified | 570 |
| 576 | Ga0495598_0439402 | 3300046537 | Unclassified | 515 |
| 577 | Ga0495597_0230936 | 3300046542 | Bacteria | 732 |
| 578 | Ga0495622_0258470 | 3300046557 | Bacteria | 765 |
| 579 | Ga0495667_0067182 | 3300046559 | Bacteria | 2343 |
| 580 | Ga0495656_0141384 | 3300046615 | Bacteria | 1155 |
| 581 | Ga0495656_0284636 | 3300046615 | Unclassified | 843 |
| 582 | Ga0495656_0791917 | 3300046615 | Unclassified | 512 |
| 583 | Ga0495634_0272164 | 3300046642 | Bacteria | 1030 |
| 584 | Ga0495634_0403898 | 3300046642 | Unclassified | 811 |
| 585 | Ga0495635_0067509 | 3300046663 | Bacteria | 2453 |
| 586 | Ga0495635_0234895 | 3300046663 | Bacteria | 1238 |
| 587 | Ga0495661_0343974 | 3300046665 | Unclassified | 736 |
| 588 | Ga0495661_0582427 | 3300046665 | Unclassified | 527 |
| 589 | Ga0495588_0000586 | 3300046674 | Bacteria | 17370 |
| 590 | Ga0495588_0322846 | 3300046674 | Bacteria | 812 |
| 591 | Ga0495588_0542631 | 3300046674 | Bacteria | 609 |
| 592 | Ga0495588_0647056 | 3300046674 | Unclassified | 553 |
| 593 | Ga0495657_0139457 | 3300046675 | Unclassified | 1512 |
| 594 | Ga0495657_0149191 | 3300046675 | Unclassified | 1453 |
| 595 | Ga0495599_0535148 | 3300046678 | Bacteria | 687 |
| 596 | Ga0495647_0020286 | 3300046681 | Bacteria | 2384 |
| 597 | Ga0495658_0415734 | 3300046683 | Unclassified | 858 |
| 598 | Ga0495613_0145718 | 3300046689 | Unclassified | 1690 |
| 599 | Ga0495670_0349269 | 3300046691 | Bacteria | 796 |
| 600 | Ga0495649_0137797 | 3300046694 | Bacteria | 1286 |
| 601 | Ga0495581_0133432 | 3300047315 | Unclassified | 1447 |
| 602 | Ga0495581_0765311 | 3300047315 | Unclassified | 555 |
| 603 | Ga0495604_0184102 | 3300047317 | Bacteria | 1460 |
| 604 | Ga0495604_0319024 | 3300047317 | Unclassified | 1039 |
| 605 | Ga0495636_0130097 | 3300047318 | Bacteria | 1119 |
| 606 | Ga0495636_0376457 | 3300047318 | Bacteria | 673 |
| 607 | Ga0495674_0434514 | 3300047319 | Unclassified | 1056 |
| 608 | Ga0495674_0854402 | 3300047319 | Unclassified | 705 |
| 609 | Ga0495676_0017349 | 3300047321 | Bacteria | 6367 |
| 610 | Ga0495676_0128334 | 3300047321 | Bacteria | 1834 |
| 611 | Ga0495676_0176869 | 3300047321 | Bacteria | 1498 |
| 612 | Ga0495676_0383783 | 3300047321 | Unclassified | 934 |
| 613 | Ga0495676_0581928 | 3300047321 | Bacteria | 730 |
| 614 | Ga0495680_0040259 | 3300047322 | Bacteria | 3724 |
| 615 | Ga0495680_0197745 | 3300047322 | Unclassified | 1443 |
| 616 | Ga0495680_0270912 | 3300047322 | Bacteria | 1199 |
| 617 | Ga0495680_0370546 | 3300047322 | Bacteria | 994 |
| 618 | Ga0495683_0343216 | 3300047323 | Bacteria | 632 |
| 619 | Ga0495677_0215977 | 3300047445 | Unclassified | 747 |
| 620 | Ga0495684_0127146 | 3300047471 | Bacteria | 1917 |
| 621 | Ga0495684_0160199 | 3300047471 | Bacteria | 1679 |
| 622 | Ga0496100_0015996 | 3300048903 | Bacteria | 4394 |
| 623 | Ga0496100_0040037 | 3300048903 | Bacteria | 2979 |
| 624 | Ga0496101_0047646 | 3300048904 | Bacteria | 3078 |
| 625 | Ga0496101_0050269 | 3300048904 | Bacteria | 3000 |
| 626 | Ga0496101_0676087 | 3300048904 | Bacteria | 815 |
| 627 | Ga0496102_0023315 | 3300048905 | Bacteria | 5495 |
| 628 | Ga0496102_0038410 | 3300048905 | Bacteria | 4320 |
| 629 | Ga0496102_0163633 | 3300048905 | Bacteria | 2093 |
| 630 | Ga0496102_0241458 | 3300048905 | Bacteria | 1703 |
| 631 | Ga0496103_0023101 | 3300048906 | Bacteria | 3749 |
| 632 | Ga0496103_0073420 | 3300048906 | Unclassified | 2143 |
| 633 | Ga0496103_0178207 | 3300048906 | Bacteria | 1366 |
| 634 | Ga0496103_0324372 | 3300048906 | Bacteria | 990 |
| 635 | Ga0496104_0002265 | 3300048907 | Bacteria | 16587 |
| 636 | Ga0496104_0004320 | 3300048907 | Bacteria | 12366 |
| 637 | Ga0496104_0016248 | 3300048907 | Bacteria | 6759 |
| 638 | Ga0496104_0100569 | 3300048907 | Bacteria | 2768 |
| 639 | Ga0496104_1011369 | 3300048907 | Bacteria | 735 |
| 640 | Ga0496105_0002160 | 3300048908 | Bacteria | 14238 |
| 641 | Ga0496105_0002904 | 3300048908 | Bacteria | 12573 |
| 642 | Ga0496106_0036174 | 3300048909 | Bacteria | 3694 |
| 643 | Ga0496106_0080895 | 3300048909 | Bacteria | 2495 |
| 644 | Ga0496106_0748517 | 3300048909 | Viruses | 777 |
| 645 | Ga0496107_0033312 | 3300048910 | Bacteria | 3686 |
| 646 | Ga0496107_0079003 | 3300048910 | Bacteria | 2398 |
| 647 | Ga0496107_0088266 | 3300048910 | Bacteria | 2264 |
| 648 | Ga0496107_0539444 | 3300048910 | Unclassified | 864 |
| 649 | Ga0496108_0001671 | 3300048911 | Bacteria | 17595 |
| 650 | Ga0496108_0010509 | 3300048911 | Bacteria | 7518 |
| 651 | Ga0496108_0050702 | 3300048911 | Bacteria | 3475 |
| 652 | Ga0496108_0323732 | 3300048911 | Bacteria | 1344 |
| 653 | Ga0496108_0385543 | 3300048911 | Bacteria | 1224 |
| 654 | Ga0496108_0403584 | 3300048911 | Unclassified | 1194 |
| 655 | Ga0496108_0524798 | 3300048911 | Bacteria | 1034 |
| 656 | Ga0496109_0001133 | 3300048912 | Bacteria | 22156 |
| 657 | Ga0496109_0032399 | 3300048912 | Bacteria | 4698 |
| 658 | Ga0496109_0052942 | 3300048912 | Bacteria | 3700 |
| 659 | Ga0496109_0089878 | 3300048912 | Bacteria | 2840 |
| 660 | Ga0496109_0205067 | 3300048912 | Bacteria | 1854 |
| 661 | Ga0496109_0239526 | 3300048912 | Bacteria | 1707 |
| 662 | Ga0496109_0358910 | 3300048912 | Bacteria | 1377 |
| 663 | Ga0496109_0822957 | 3300048912 | Unclassified | 866 |
| 664 | Ga0496109_0950440 | 3300048912 | Unclassified | 797 |
| 665 | Ga0496109_1217543 | 3300048912 | Bacteria | 689 |
| 666 | Ga0496110_0000467 | 3300048913 | Bacteria | 27484 |
| 667 | Ga0496110_0000686 | 3300048913 | Bacteria | 23305 |
| 668 | Ga0496110_0014346 | 3300048913 | Bacteria | 6575 |
| 669 | Ga0496110_0025179 | 3300048913 | Bacteria | 5082 |
| 670 | Ga0496110_0368741 | 3300048913 | Bacteria | 1308 |
| 671 | Ga0496110_0618336 | 3300048913 | Unclassified | 982 |
| 672 | Ga0496110_1361215 | 3300048913 | Bacteria | 619 |
| 673 | Ga0496110_1477336 | 3300048913 | Bacteria | 589 |
| 674 | Ga0496111_0001328 | 3300048914 | Bacteria | 13918 |
| 675 | Ga0496111_0003353 | 3300048914 | Bacteria | 9906 |
| 676 | Ga0496111_0003433 | 3300048914 | Bacteria | 9802 |
| 677 | Ga0496111_0080744 | 3300048914 | Bacteria | 2373 |
| 678 | Ga0496111_0086896 | 3300048914 | Bacteria | 2288 |
| 679 | Ga0496111_0136795 | 3300048914 | Bacteria | 1815 |
| 680 | Ga0496111_0520437 | 3300048914 | Bacteria | 875 |
| 681 | Ga0496111_0677809 | 3300048914 | Bacteria | 751 |
| 682 | Ga0496111_1067844 | 3300048914 | Unclassified | 577 |
| 683 | Ga0496112_0010541 | 3300048915 | Bacteria | 8391 |
| 684 | Ga0496112_0050978 | 3300048915 | Bacteria | 4059 |
| 685 | Ga0496112_0248553 | 3300048915 | Bacteria | 1730 |
| 686 | Ga0496112_0290804 | 3300048915 | Bacteria | 1580 |
| 687 | Ga0496112_0710091 | 3300048915 | Bacteria | 933 |
| 688 | Ga0496112_1279338 | 3300048915 | Bacteria | 649 |
| 689 | Ga0496113_0005274 | 3300048916 | Bacteria | 8049 |
| 690 | Ga0496113_0012584 | 3300048916 | Bacteria | 5692 |
| 691 | Ga0496113_0174547 | 3300048916 | Bacteria | 1703 |
| 692 | Ga0496113_0219564 | 3300048916 | Bacteria | 1515 |
| 693 | Ga0496113_0293605 | 3300048916 | Unclassified | 1301 |
| 694 | Ga0496113_0328992 | 3300048916 | Bacteria | 1225 |
| 695 | Ga0496113_0438040 | 3300048916 | Bacteria | 1050 |
| 696 | Ga0496114_0031815 | 3300048917 | Bacteria | 4340 |
| 697 | Ga0496114_0047277 | 3300048917 | Bacteria | 3579 |
| 698 | Ga0496114_0067201 | 3300048917 | Bacteria | 3007 |
| 699 | Ga0496114_0180121 | 3300048917 | Bacteria | 1845 |
| 700 | Ga0496114_0330252 | 3300048917 | Unclassified | 1348 |
| 701 | Ga0496114_0457288 | 3300048917 | Unclassified | 1130 |
| 702 | Ga0496114_0559080 | 3300048917 | Unclassified | 1010 |
| 703 | Ga0496115_0004796 | 3300048918 | Bacteria | 9813 |
| 704 | nmdc:mga03n38_129858_c1 | 3300050490 | Unclassified | 1247 |
| 705 | nmdc:mga0yw44_136274_c1 | 3300050492 | Bacteria | 1593 |
| 706 | nmdc:mga06z11_350217_c1 | 3300050494 | Unclassified | 884 |
| 707 | nmdc:mga05p37_102731_c1 | 3300050507 | Bacteria | 3519 |
| 708 | nmdc:mga05p37_41257_c1 | 3300050507 | Bacteria | 5666 |
| 709 | nmdc:mga06r32_324075_c1 | 3300050510 | Bacteria | 1526 |
| 710 | nmdc:mga08y16_169317_c1 | 3300050511 | Bacteria | 2269 |
| 711 | nmdc:mga08y16_623060_c1 | 3300050511 | Bacteria | 1085 |
| 712 | nmdc:mga08y16_84209_c1 | 3300050511 | Bacteria | 3315 |
| 713 | nmdc:mga0n895_151250_c1 | 3300050512 | Bacteria | 2351 |
| 714 | nmdc:mga0n895_19897_c1 | 3300050512 | Bacteria | 6250 |
| 715 | nmdc:mga0n895_539258_c1 | 3300050512 | Unclassified | 1173 |
| 716 | nmdc:mga0n895_683404_c1 | 3300050512 | Bacteria | 1023 |
| 717 | nmdc:mga0rr50_1515020_c1 | 3300050513 | Bacteria | 567 |
| 718 | nmdc:mga0rr50_1520740_c1 | 3300050513 | Bacteria | 566 |
| 719 | nmdc:mga0rr50_27592_c1 | 3300050513 | Bacteria | 3979 |
| 720 | nmdc:mga08x19_18219_c1 | 3300050514 | Bacteria | 4303 |
| 721 | nmdc:mga08x19_816313_c1 | 3300050514 | Bacteria | 662 |
| 722 | nmdc:mga0a205_1183178_c1 | 3300050515 | Unclassified | 612 |
| 723 | nmdc:mga0a205_329898_c1 | 3300050515 | Unclassified | 1396 |
| 724 | nmdc:mga0a205_469750_c1 | 3300050515 | Bacteria | 1117 |
| 725 | Ga0495601_0165950 | 3300053077 | Bacteria | 1443 |
| 726 | Ga0495601_0584331 | 3300053077 | Unclassified | 717 |
| 727 | Ga0495601_0767467 | 3300053077 | Bacteria | 613 |
| 728 | Ga0495595_0117652 | 3300053084 | Unclassified | 1293 |
| 729 | Ga0495595_0187844 | 3300053084 | Bacteria | 1026 |
| 730 | Ga0495595_0514482 | 3300053084 | Unclassified | 610 |
| 731 | Ga0495619_0075633 | 3300053085 | Bacteria | 2260 |
| 732 | Ga0495619_0230186 | 3300053085 | Bacteria | 1284 |
| 733 | Ga0495619_0418732 | 3300053085 | Bacteria | 924 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025918 | Ga0207662_10235096 | Ga0207662_102350962 | 103 |
| 2 | 3300003373 | JGI25407J50210_10146073 | JGI25407J50210_101460732 | 104 |
| 3 | 3300005981 | Ga0081538_10007205 | Ga0081538_100072054 | 104 |
| 4 | 3300005435 | Ga0070714_101321508 | Ga0070714_1013215082 | 105 |
| 5 | 3300025916 | Ga0207663_11181720 | Ga0207663_111817202 | 105 |
| 6 | 3300046516 | Ga0495628_0697730 | Ga0495628_0697730_263_592 | 105 |
| 7 | 3300053077 | Ga0495601_0767467 | Ga0495601_0767467_224_553 | 105 |
| 8 | 3300053084 | Ga0495595_0514482 | Ga0495595_0514482_16_345 | 105 |
| 9 | 3300005458 | Ga0070681_11988529 | Ga0070681_119885291 | 110 |
| 10 | 3300005466 | Ga0070685_11477932 | Ga0070685_114779321 | 110 |
| 11 | 3300005543 | Ga0070672_100340238 | Ga0070672_1003402382 | 110 |
| 12 | 3300005544 | Ga0070686_100272113 | Ga0070686_1002721131 | 110 |
| 13 | 3300005614 | Ga0068856_101634763 | Ga0068856_1016347631 | 110 |
| 14 | 3300005616 | Ga0068852_100383002 | Ga0068852_1003830022 | 110 |
| 15 | 3300009098 | Ga0105245_10039907 | Ga0105245_100399073 | 110 |
| 16 | 3300010375 | Ga0105239_10119731 | Ga0105239_101197314 | 110 |
| 17 | 3300011119 | Ga0105246_10342201 | Ga0105246_103422012 | 110 |
| 18 | 3300025901 | Ga0207688_10095138 | Ga0207688_100951382 | 110 |
| 19 | 3300025940 | Ga0207691_10458851 | Ga0207691_104588512 | 110 |
| 20 | 3300025944 | Ga0207661_10030813 | Ga0207661_100308134 | 110 |
| 21 | 3300026078 | Ga0207702_11042627 | Ga0207702_110426272 | 110 |
| 22 | 3300048909 | Ga0496106_0748517 | Ga0496106_0748517_101_439 | 110 |
| 23 | 3300048911 | Ga0496108_0323732 | Ga0496108_0323732_854_1192 | 110 |
| 24 | 3300048916 | Ga0496113_0174547 | Ga0496113_0174547_250_588 | 110 |
| 25 | 3300038443 | Ga0395901_0034065 | Ga0395901_0034065_2138_2491 | 112 |
| 26 | 3300005456 | Ga0070678_100289181 | Ga0070678_1002891812 | 113 |
| 27 | 3300005840 | Ga0068870_11226170 | Ga0068870_112261702 | 113 |
| 28 | 3300006237 | Ga0097621_100241507 | Ga0097621_1002415073 | 113 |
| 29 | 3300026121 | Ga0207683_10111619 | Ga0207683_101116193 | 113 |
| 30 | 3300025931 | Ga0207644_10781812 | Ga0207644_107818122 | 114 |
| 31 | 3300026078 | Ga0207702_10276359 | Ga0207702_102763592 | 114 |
| 32 | 3300048914 | Ga0496111_0086896 | Ga0496111_0086896_1485_1835 | 114 |
| 33 | 3300005441 | Ga0070700_100577814 | Ga0070700_1005778142 | 117 |
| 34 | 3300005549 | Ga0070704_101468867 | Ga0070704_1014688671 | 117 |
| 35 | 3300006844 | Ga0075428_100285345 | Ga0075428_1002853452 | 117 |
| 36 | 3300009094 | Ga0111539_10442063 | Ga0111539_104420631 | 117 |
| 37 | 3300045051 | Ga0451576_0742727 | Ga0451576_0742727_144_509 | 117 |
| 38 | 3300046455 | Ga0495603_0162306 | Ga0495603_0162306_99_467 | 117 |
| 39 | 3300046459 | Ga0495629_0132610 | Ga0495629_0132610_444_812 | 117 |
| 40 | 3300046461 | Ga0495641_0063952 | Ga0495641_0063952_1017_1385 | 117 |
| 41 | 3300046461 | Ga0495641_0487998 | Ga0495641_0487998_163_531 | 117 |
| 42 | 3300046463 | Ga0495653_0132255 | Ga0495653_0132255_58_426 | 117 |
| 43 | 3300046473 | Ga0495582_0875037 | Ga0495582_0875037_23_391 | 117 |
| 44 | 3300046477 | Ga0495664_0592973 | Ga0495664_0592973_70_438 | 117 |
| 45 | 3300046514 | Ga0495618_0198279 | Ga0495618_0198279_561_929 | 117 |
| 46 | 3300046516 | Ga0495628_0697699 | Ga0495628_0697699_232_600 | 117 |
| 47 | 3300046533 | Ga0495640_0526130 | Ga0495640_0526130_234_602 | 117 |
| 48 | 3300046642 | Ga0495634_0272164 | Ga0495634_0272164_477_845 | 117 |
| 49 | 3300046663 | Ga0495635_0067509 | Ga0495635_0067509_1552_1920 | 117 |
| 50 | 3300046683 | Ga0495658_0415734 | Ga0495658_0415734_279_647 | 117 |
| 51 | 3300046689 | Ga0495613_0145718 | Ga0495613_0145718_157_525 | 117 |
| 52 | 3300047315 | Ga0495581_0765311 | Ga0495581_0765311_137_505 | 117 |
| 53 | 3300047317 | Ga0495604_0184102 | Ga0495604_0184102_114_482 | 117 |
| 54 | 3300047319 | Ga0495674_0854402 | Ga0495674_0854402_29_397 | 117 |
| 55 | 3300047321 | Ga0495676_0176869 | Ga0495676_0176869_552_920 | 117 |
| 56 | 3300047322 | Ga0495680_0040259 | Ga0495680_0040259_62_430 | 117 |
| 57 | 3300047471 | Ga0495684_0160199 | Ga0495684_0160199_482_850 | 117 |
| 58 | 3300048907 | Ga0496104_0100569 | Ga0496104_0100569_670_1038 | 117 |
| 59 | 3300048907 | Ga0496104_1011369 | Ga0496104_1011369_149_517 | 117 |
| 60 | 3300048910 | Ga0496107_0539444 | Ga0496107_0539444_178_546 | 117 |
| 61 | 3300048911 | Ga0496108_0050702 | Ga0496108_0050702_2109_2477 | 117 |
| 62 | 3300048912 | Ga0496109_0239526 | Ga0496109_0239526_442_810 | 117 |
| 63 | 3300048913 | Ga0496110_1361215 | Ga0496110_1361215_146_508 | 117 |
| 64 | 3300048914 | Ga0496111_0080744 | Ga0496111_0080744_514_882 | 117 |
| 65 | 3300048916 | Ga0496113_0293605 | Ga0496113_0293605_378_746 | 117 |
| 66 | 3300048917 | Ga0496114_0330252 | Ga0496114_0330252_712_1080 | 117 |
| 67 | 3300053085 | Ga0495619_0418732 | Ga0495619_0418732_160_528 | 117 |
| 68 | 3300035170 | Ga0373943_0580498 | Ga0373943_0580498_77_439 | 118 |
| 69 | 3300046461 | Ga0495641_0118037 | Ga0495641_0118037_798_1160 | 118 |
| 70 | 3300046517 | Ga0495630_0017194 | Ga0495630_0017194_1132_1494 | 118 |
| 71 | 3300047315 | Ga0495581_0133432 | Ga0495581_0133432_905_1267 | 118 |
| 72 | 3300047321 | Ga0495676_0128334 | Ga0495676_0128334_1328_1690 | 118 |
| 73 | 3300005329 | Ga0070683_100003106 | Ga0070683_10000310611 | 119 |
| 74 | 3300005329 | Ga0070683_100507905 | Ga0070683_1005079053 | 119 |
| 75 | 3300005330 | Ga0070690_100589022 | Ga0070690_1005890221 | 119 |
| 76 | 3300005334 | Ga0068869_101011290 | Ga0068869_1010112901 | 119 |
| 77 | 3300005337 | Ga0070682_100214642 | Ga0070682_1002146423 | 119 |
| 78 | 3300005338 | Ga0068868_100160946 | Ga0068868_1001609462 | 119 |
| 79 | 3300005341 | Ga0070691_10015360 | Ga0070691_100153604 | 119 |
| 80 | 3300005341 | Ga0070691_10264227 | Ga0070691_102642272 | 119 |
| 81 | 3300005343 | Ga0070687_100258891 | Ga0070687_1002588912 | 119 |
| 82 | 3300005355 | Ga0070671_100343898 | Ga0070671_1003438982 | 119 |
| 83 | 3300005364 | Ga0070673_100367597 | Ga0070673_1003675973 | 119 |
| 84 | 3300005365 | Ga0070688_100288853 | Ga0070688_1002888533 | 119 |
| 85 | 3300005365 | Ga0070688_100385078 | Ga0070688_1003850782 | 119 |
| 86 | 3300005436 | Ga0070713_100068611 | Ga0070713_1000686113 | 119 |
| 87 | 3300005437 | Ga0070710_11258686 | Ga0070710_112586861 | 119 |
| 88 | 3300005455 | Ga0070663_100478178 | Ga0070663_1004781783 | 119 |
| 89 | 3300005456 | Ga0070678_100041323 | Ga0070678_1000413233 | 119 |
| 90 | 3300005530 | Ga0070679_100139700 | Ga0070679_1001397003 | 119 |
| 91 | 3300005535 | Ga0070684_100059385 | Ga0070684_1000593852 | 119 |
| 92 | 3300005539 | Ga0068853_100609799 | Ga0068853_1006097991 | 119 |
| 93 | 3300005545 | Ga0070695_100093867 | Ga0070695_1000938673 | 119 |
| 94 | 3300005545 | Ga0070695_101184591 | Ga0070695_1011845911 | 119 |
| 95 | 3300005546 | Ga0070696_100081569 | Ga0070696_1000815693 | 119 |
| 96 | 3300005547 | Ga0070693_100009252 | Ga0070693_1000092523 | 119 |
| 97 | 3300005549 | Ga0070704_101287460 | Ga0070704_1012874601 | 119 |
| 98 | 3300005563 | Ga0068855_100363210 | Ga0068855_1003632102 | 119 |
| 99 | 3300005578 | Ga0068854_100046824 | Ga0068854_1000468242 | 119 |
| 100 | 3300005614 | Ga0068856_100607644 | Ga0068856_1006076443 | 119 |
| 101 | 3300005615 | Ga0070702_100007484 | Ga0070702_1000074844 | 119 |
| 102 | 3300005618 | Ga0068864_100081045 | Ga0068864_1000810453 | 119 |
| 103 | 3300005719 | Ga0068861_100003381 | Ga0068861_1000033815 | 119 |
| 104 | 3300005842 | Ga0068858_100550596 | Ga0068858_1005505962 | 119 |
| 105 | 3300005843 | Ga0068860_100475495 | Ga0068860_1004754953 | 119 |
| 106 | 3300005844 | Ga0068862_100479816 | Ga0068862_1004798163 | 119 |
| 107 | 3300005983 | Ga0081540_1002081 | Ga0081540_100208112 | 119 |
| 108 | 3300006028 | Ga0070717_10159358 | Ga0070717_101593582 | 119 |
| 109 | 3300006175 | Ga0070712_100567015 | Ga0070712_1005670152 | 119 |
| 110 | 3300006871 | Ga0075434_100276366 | Ga0075434_1002763663 | 119 |
| 111 | 3300007076 | Ga0075435_101228836 | Ga0075435_1012288362 | 119 |
| 112 | 3300009093 | Ga0105240_10828223 | Ga0105240_108282232 | 119 |
| 113 | 3300009098 | Ga0105245_10038520 | Ga0105245_100385205 | 119 |
| 114 | 3300009098 | Ga0105245_10431354 | Ga0105245_104313543 | 119 |
| 115 | 3300009148 | Ga0105243_10403366 | Ga0105243_104033663 | 119 |
| 116 | 3300009174 | Ga0105241_10225946 | Ga0105241_102259463 | 119 |
| 117 | 3300009176 | Ga0105242_10477372 | Ga0105242_104773723 | 119 |
| 118 | 3300009176 | Ga0105242_10518972 | Ga0105242_105189723 | 119 |
| 119 | 3300009176 | Ga0105242_10750173 | Ga0105242_107501732 | 119 |
| 120 | 3300009177 | Ga0105248_10484933 | Ga0105248_104849332 | 119 |
| 121 | 3300009553 | Ga0105249_10017004 | Ga0105249_100170043 | 119 |
| 122 | 3300010375 | Ga0105239_10069819 | Ga0105239_100698193 | 119 |
| 123 | 3300010375 | Ga0105239_10651944 | Ga0105239_106519442 | 119 |
| 124 | 3300013102 | Ga0157371_10231855 | Ga0157371_102318553 | 119 |
| 125 | 3300013296 | Ga0157374_10481176 | Ga0157374_104811762 | 119 |
| 126 | 3300013306 | Ga0163162_10111381 | Ga0163162_101113815 | 119 |
| 127 | 3300013307 | Ga0157372_10481095 | Ga0157372_104810953 | 119 |
| 128 | 3300013308 | Ga0157375_10012591 | Ga0157375_1001259111 | 119 |
| 129 | 3300013308 | Ga0157375_10827290 | Ga0157375_108272902 | 119 |
| 130 | 3300014497 | Ga0182008_10084232 | Ga0182008_100842323 | 119 |
| 131 | 3300017792 | Ga0163161_10028037 | Ga0163161_100280375 | 119 |
| 132 | 3300025899 | Ga0207642_10063558 | Ga0207642_100635583 | 119 |
| 133 | 3300025912 | Ga0207707_10085432 | Ga0207707_100854324 | 119 |
| 134 | 3300025915 | Ga0207693_10431284 | Ga0207693_104312842 | 119 |
| 135 | 3300025921 | Ga0207652_10182128 | Ga0207652_101821283 | 119 |
| 136 | 3300025927 | Ga0207687_10152141 | Ga0207687_101521413 | 119 |
| 137 | 3300025928 | Ga0207700_10057007 | Ga0207700_100570073 | 119 |
| 138 | 3300025931 | Ga0207644_10024038 | Ga0207644_100240385 | 119 |
| 139 | 3300025933 | Ga0207706_10011465 | Ga0207706_100114653 | 119 |
| 140 | 3300025934 | Ga0207686_10234476 | Ga0207686_102344763 | 119 |
| 141 | 3300025934 | Ga0207686_10648946 | Ga0207686_106489462 | 119 |
| 142 | 3300025936 | Ga0207670_10528441 | Ga0207670_105284411 | 119 |
| 143 | 3300025937 | Ga0207669_10038933 | Ga0207669_100389333 | 119 |
| 144 | 3300025941 | Ga0207711_10222751 | Ga0207711_102227512 | 119 |
| 145 | 3300025942 | Ga0207689_10234974 | Ga0207689_102349742 | 119 |
| 146 | 3300025942 | Ga0207689_11257855 | Ga0207689_112578552 | 119 |
| 147 | 3300025944 | Ga0207661_10086838 | Ga0207661_100868384 | 119 |
| 148 | 3300025944 | Ga0207661_11050542 | Ga0207661_110505422 | 119 |
| 149 | 3300025945 | Ga0207679_10372925 | Ga0207679_103729252 | 119 |
| 150 | 3300025945 | Ga0207679_10380933 | Ga0207679_103809333 | 119 |
| 151 | 3300025949 | Ga0207667_10054229 | Ga0207667_100542295 | 119 |
| 152 | 3300025960 | Ga0207651_10166261 | Ga0207651_101662613 | 119 |
| 153 | 3300025961 | Ga0207712_10387990 | Ga0207712_103879903 | 119 |
| 154 | 3300025972 | Ga0207668_10579452 | Ga0207668_105794523 | 119 |
| 155 | 3300026023 | Ga0207677_10272810 | Ga0207677_102728102 | 119 |
| 156 | 3300026041 | Ga0207639_10981831 | Ga0207639_109818312 | 119 |
| 157 | 3300026078 | Ga0207702_11066949 | Ga0207702_110669492 | 119 |
| 158 | 3300026089 | Ga0207648_10301583 | Ga0207648_103015833 | 119 |
| 159 | 3300026089 | Ga0207648_10361423 | Ga0207648_103614232 | 119 |
| 160 | 3300026089 | Ga0207648_11974008 | Ga0207648_119740082 | 119 |
| 161 | 3300026095 | Ga0207676_10063585 | Ga0207676_100635854 | 119 |
| 162 | 3300026118 | Ga0207675_100002688 | Ga0207675_1000026889 | 119 |
| 163 | 3300026121 | Ga0207683_10312670 | Ga0207683_103126702 | 119 |
| 164 | 3300028380 | Ga0268265_10218546 | Ga0268265_102185463 | 119 |
| 165 | 3300035170 | Ga0373943_0068627 | Ga0373943_0068627_1377_1742 | 119 |
| 166 | 3300035725 | Ga0373947_0005440 | Ga0373947_0005440_1729_2094 | 119 |
| 167 | 3300037068 | Ga0373925_0252649 | Ga0373925_0252649_330_695 | 119 |
| 168 | 3300037312 | Ga0395899_0006128 | Ga0395899_0006128_3844_4209 | 119 |
| 169 | 3300037312 | Ga0395899_0010821 | Ga0395899_0010821_52_423 | 119 |
| 170 | 3300037418 | Ga0395900_0010594 | Ga0395900_0010594_5349_5714 | 119 |
| 171 | 3300037418 | Ga0395900_0115891 | Ga0395900_0115891_861_1232 | 119 |
| 172 | 3300037466 | Ga0395898_0001595 | Ga0395898_0001595_5120_5491 | 119 |
| 173 | 3300037466 | Ga0395898_0311853 | Ga0395898_0311853_104_472 | 119 |
| 174 | 3300037466 | Ga0395898_1171438 | Ga0395898_1171438_248_613 | 119 |
| 175 | 3300037471 | Ga0395905_0001862 | Ga0395905_0001862_23642_24013 | 119 |
| 176 | 3300038443 | Ga0395901_0121702 | Ga0395901_0121702_79_450 | 119 |
| 177 | 3300038443 | Ga0395901_0783982 | Ga0395901_0783982_293_658 | 119 |
| 178 | 3300038443 | Ga0395901_0887697 | Ga0395901_0887697_358_726 | 119 |
| 179 | 3300041503 | Ga0451847_0074877 | Ga0451847_0074877_96_461 | 119 |
| 180 | 3300044901 | Ga0466960_0310707 | Ga0466960_0310707_138_509 | 119 |
| 181 | 3300046455 | Ga0495603_0002347 | Ga0495603_0002347_2636_3001 | 119 |
| 182 | 3300046473 | Ga0495582_0156706 | Ga0495582_0156706_164_529 | 119 |
| 183 | 3300046475 | Ga0495639_0176694 | Ga0495639_0176694_384_749 | 119 |
| 184 | 3300046491 | Ga0495584_0085623 | Ga0495584_0085623_1092_1463 | 119 |
| 185 | 3300046491 | Ga0495584_0187982 | Ga0495584_0187982_625_996 | 119 |
| 186 | 3300046499 | Ga0495594_0045194 | Ga0495594_0045194_1292_1657 | 119 |
| 187 | 3300046513 | Ga0495616_0150105 | Ga0495616_0150105_180_545 | 119 |
| 188 | 3300046523 | Ga0495644_0222683 | Ga0495644_0222683_180_545 | 119 |
| 189 | 3300046542 | Ga0495597_0230936 | Ga0495597_0230936_300_665 | 119 |
| 190 | 3300046557 | Ga0495622_0258470 | Ga0495622_0258470_264_629 | 119 |
| 191 | 3300046674 | Ga0495588_0000586 | Ga0495588_0000586_5842_6207 | 119 |
| 192 | 3300046674 | Ga0495588_0542631 | Ga0495588_0542631_61_426 | 119 |
| 193 | 3300046674 | Ga0495588_0647056 | Ga0495588_0647056_155_520 | 119 |
| 194 | 3300046681 | Ga0495647_0020286 | Ga0495647_0020286_1729_2094 | 119 |
| 195 | 3300047321 | Ga0495676_0017349 | Ga0495676_0017349_1083_1448 | 119 |
| 196 | 3300047445 | Ga0495677_0215977 | Ga0495677_0215977_166_531 | 119 |
| 197 | 3300048903 | Ga0496100_0015996 | Ga0496100_0015996_1928_2293 | 119 |
| 198 | 3300048903 | Ga0496100_0040037 | Ga0496100_0040037_2132_2503 | 119 |
| 199 | 3300048904 | Ga0496101_0050269 | Ga0496101_0050269_989_1360 | 119 |
| 200 | 3300048905 | Ga0496102_0163633 | Ga0496102_0163633_876_1247 | 119 |
| 201 | 3300048906 | Ga0496103_0023101 | Ga0496103_0023101_3136_3507 | 119 |
| 202 | 3300048907 | Ga0496104_0002265 | Ga0496104_0002265_679_1044 | 119 |
| 203 | 3300048907 | Ga0496104_0004320 | Ga0496104_0004320_6387_6758 | 119 |
| 204 | 3300048908 | Ga0496105_0002160 | Ga0496105_0002160_10551_10916 | 119 |
| 205 | 3300048908 | Ga0496105_0002904 | Ga0496105_0002904_2128_2499 | 119 |
| 206 | 3300048909 | Ga0496106_0036174 | Ga0496106_0036174_2218_2583 | 119 |
| 207 | 3300048909 | Ga0496106_0080895 | Ga0496106_0080895_900_1271 | 119 |
| 208 | 3300048910 | Ga0496107_0033312 | Ga0496107_0033312_768_1139 | 119 |
| 209 | 3300048910 | Ga0496107_0088266 | Ga0496107_0088266_181_546 | 119 |
| 210 | 3300048911 | Ga0496108_0001671 | Ga0496108_0001671_11369_11734 | 119 |
| 211 | 3300048911 | Ga0496108_0010509 | Ga0496108_0010509_4935_5306 | 119 |
| 212 | 3300048911 | Ga0496108_0403584 | Ga0496108_0403584_509_874 | 119 |
| 213 | 3300048911 | Ga0496108_0524798 | Ga0496108_0524798_656_1018 | 119 |
| 214 | 3300048912 | Ga0496109_0001133 | Ga0496109_0001133_3541_3906 | 119 |
| 215 | 3300048912 | Ga0496109_0052942 | Ga0496109_0052942_2428_2799 | 119 |
| 216 | 3300048912 | Ga0496109_0089878 | Ga0496109_0089878_2260_2622 | 119 |
| 217 | 3300048912 | Ga0496109_0358910 | Ga0496109_0358910_476_850 | 119 |
| 218 | 3300048912 | Ga0496109_0950440 | Ga0496109_0950440_413_778 | 119 |
| 219 | 3300048913 | Ga0496110_0000467 | Ga0496110_0000467_21366_21731 | 119 |
| 220 | 3300048913 | Ga0496110_0014346 | Ga0496110_0014346_4220_4591 | 119 |
| 221 | 3300048913 | Ga0496110_0618336 | Ga0496110_0618336_330_695 | 119 |
| 222 | 3300048914 | Ga0496111_0001328 | Ga0496111_0001328_8096_8461 | 119 |
| 223 | 3300048914 | Ga0496111_0003433 | Ga0496111_0003433_5370_5741 | 119 |
| 224 | 3300048914 | Ga0496111_0677809 | Ga0496111_0677809_350_712 | 119 |
| 225 | 3300048914 | Ga0496111_1067844 | Ga0496111_1067844_97_471 | 119 |
| 226 | 3300048915 | Ga0496112_0010541 | Ga0496112_0010541_2731_3096 | 119 |
| 227 | 3300048915 | Ga0496112_0050978 | Ga0496112_0050978_2659_3030 | 119 |
| 228 | 3300048915 | Ga0496112_1279338 | Ga0496112_1279338_30_392 | 119 |
| 229 | 3300048916 | Ga0496113_0005274 | Ga0496113_0005274_6489_6854 | 119 |
| 230 | 3300048916 | Ga0496113_0012584 | Ga0496113_0012584_2415_2786 | 119 |
| 231 | 3300048917 | Ga0496114_0031815 | Ga0496114_0031815_1938_2303 | 119 |
| 232 | 3300048917 | Ga0496114_0180121 | Ga0496114_0180121_800_1171 | 119 |
| 233 | 3300048918 | Ga0496115_0004796 | Ga0496115_0004796_8779_9144 | 119 |
| 234 | 3300050513 | nmdc:mga0rr50_1515020_c1 | nmdc:mga0rr50_1515020_c1_147_509 | 119 |
| 235 | 3300012515 | Ga0157338_1038168 | Ga0157338_10381681 | 120 |
| 236 | 3300050511 | nmdc:mga08y16_623060_c1 | nmdc:mga08y16_623060_c1_190_576 | 120 |
| 237 | 3300050512 | nmdc:mga0n895_539258_c1 | nmdc:mga0n895_539258_c1_92_460 | 120 |
| 238 | 3300050512 | nmdc:mga0n895_683404_c1 | nmdc:mga0n895_683404_c1_128_514 | 120 |
| 239 | 3300050513 | nmdc:mga0rr50_1520740_c1 | nmdc:mga0rr50_1520740_c1_14_400 | 120 |
| 240 | 3300050514 | nmdc:mga08x19_816313_c1 | nmdc:mga08x19_816313_c1_252_617 | 120 |
| 241 | 3300050515 | nmdc:mga0a205_1183178_c1 | nmdc:mga0a205_1183178_c1_22_387 | 120 |
| 242 | 3300005981 | Ga0081538_10212254 | Ga0081538_102122542 | 122 |
| 243 | 3300014745 | Ga0157377_11257723 | Ga0157377_112577231 | 122 |
| 244 | 3300041512 | Ga0451853_1845315 | Ga0451853_1845315_60_452 | 122 |
| 245 | 3300005329 | Ga0070683_100137920 | Ga0070683_1001379204 | 127 |
| 246 | 3300005331 | Ga0070670_101605766 | Ga0070670_1016057661 | 127 |
| 247 | 3300005340 | Ga0070689_100427957 | Ga0070689_1004279572 | 127 |
| 248 | 3300005356 | Ga0070674_101976768 | Ga0070674_1019767681 | 127 |
| 249 | 3300005364 | Ga0070673_101651676 | Ga0070673_1016516761 | 127 |
| 250 | 3300005366 | Ga0070659_100482819 | Ga0070659_1004828192 | 127 |
| 251 | 3300005457 | Ga0070662_100568910 | Ga0070662_1005689102 | 127 |
| 252 | 3300005535 | Ga0070684_100190116 | Ga0070684_1001901162 | 127 |
| 253 | 3300005545 | Ga0070695_100917705 | Ga0070695_1009177051 | 127 |
| 254 | 3300005937 | Ga0081455_10052374 | Ga0081455_100523742 | 127 |
| 255 | 3300006028 | Ga0070717_10355180 | Ga0070717_103551802 | 127 |
| 256 | 3300006173 | Ga0070716_101180602 | Ga0070716_1011806021 | 127 |
| 257 | 3300007076 | Ga0075435_100893229 | Ga0075435_1008932292 | 127 |
| 258 | 3300009553 | Ga0105249_11014088 | Ga0105249_110140882 | 127 |
| 259 | 3300013105 | Ga0157369_11649568 | Ga0157369_116495682 | 127 |
| 260 | 3300014745 | Ga0157377_10130402 | Ga0157377_101304022 | 127 |
| 261 | 3300025912 | Ga0207707_10556095 | Ga0207707_105560951 | 127 |
| 262 | 3300025927 | Ga0207687_10728954 | Ga0207687_107289542 | 127 |
| 263 | 3300026075 | Ga0207708_10185951 | Ga0207708_101859512 | 127 |
| 264 | 3300026075 | Ga0207708_10700649 | Ga0207708_107006492 | 127 |
| 265 | 3300026142 | Ga0207698_10647340 | Ga0207698_106473402 | 127 |
| 266 | 3300031995 | Ga0307409_100988213 | Ga0307409_1009882132 | 127 |
| 267 | 3300032002 | Ga0307416_100202656 | Ga0307416_1002026563 | 127 |
| 268 | 3300037418 | Ga0395900_0990870 | Ga0395900_0990870_285_677 | 127 |
| 269 | 3300038443 | Ga0395901_0669118 | Ga0395901_0669118_147_539 | 127 |
| 270 | 3300045051 | Ga0451576_1511440 | Ga0451576_1511440_269_667 | 127 |
| 271 | 3300046454 | Ga0495592_0738792 | Ga0495592_0738792_129_524 | 127 |
| 272 | 3300046455 | Ga0495603_0211194 | Ga0495603_0211194_190_591 | 127 |
| 273 | 3300046462 | Ga0495651_0292485 | Ga0495651_0292485_270_665 | 127 |
| 274 | 3300046514 | Ga0495618_0556536 | Ga0495618_0556536_229_633 | 127 |
| 275 | 3300046675 | Ga0495657_0149191 | Ga0495657_0149191_316_711 | 127 |
| 276 | 3300046678 | Ga0495599_0535148 | Ga0495599_0535148_196_600 | 127 |
| 277 | 3300047322 | Ga0495680_0270912 | Ga0495680_0270912_690_1085 | 127 |
| 278 | 3300047322 | Ga0495680_0370546 | Ga0495680_0370546_316_717 | 127 |
| 279 | 3300047471 | Ga0495684_0127146 | Ga0495684_0127146_673_1068 | 127 |
| 280 | 3300048906 | Ga0496103_0178207 | Ga0496103_0178207_449_838 | 127 |
| 281 | 3300048911 | Ga0496108_0385543 | Ga0496108_0385543_322_723 | 127 |
| 282 | 3300048912 | Ga0496109_0822957 | Ga0496109_0822957_43_432 | 127 |
| 283 | 3300048912 | Ga0496109_1217543 | Ga0496109_1217543_189_590 | 127 |
| 284 | 3300048913 | Ga0496110_0368741 | Ga0496110_0368741_746_1135 | 127 |
| 285 | 3300048913 | Ga0496110_1477336 | Ga0496110_1477336_28_432 | 127 |
| 286 | 3300048914 | Ga0496111_0136795 | Ga0496111_0136795_75_464 | 127 |
| 287 | 3300048914 | Ga0496111_0520437 | Ga0496111_0520437_185_586 | 127 |
| 288 | 3300048916 | Ga0496113_0219564 | Ga0496113_0219564_199_603 | 127 |
| 289 | 3300048917 | Ga0496114_0559080 | Ga0496114_0559080_60_473 | 127 |
| 290 | 3300053077 | Ga0495601_0165950 | Ga0495601_0165950_270_674 | 127 |
| 291 | 3300053084 | Ga0495595_0117652 | Ga0495595_0117652_12_416 | 127 |
| 292 | 3300053085 | Ga0495619_0075633 | Ga0495619_0075633_65_469 | 127 |
| 293 | 3300005328 | Ga0070676_10190990 | Ga0070676_101909902 | 128 |
| 294 | 3300005336 | Ga0070680_101344892 | Ga0070680_1013448921 | 128 |
| 295 | 3300005471 | Ga0070698_100012651 | Ga0070698_1000126519 | 128 |
| 296 | 3300005564 | Ga0070664_100482268 | Ga0070664_1004822682 | 128 |
| 297 | 3300005577 | Ga0068857_100106802 | Ga0068857_1001068022 | 128 |
| 298 | 3300005615 | Ga0070702_101076032 | Ga0070702_1010760322 | 128 |
| 299 | 3300005719 | Ga0068861_100634562 | Ga0068861_1006345622 | 128 |
| 300 | 3300005844 | Ga0068862_100702218 | Ga0068862_1007022182 | 128 |
| 301 | 3300005981 | Ga0081538_10000544 | Ga0081538_1000054441 | 128 |
| 302 | 3300006237 | Ga0097621_100785022 | Ga0097621_1007850222 | 128 |
| 303 | 3300006881 | Ga0068865_100292648 | Ga0068865_1002926481 | 128 |
| 304 | 3300006881 | Ga0068865_101401149 | Ga0068865_1014011491 | 128 |
| 305 | 3300009148 | Ga0105243_10106939 | Ga0105243_101069392 | 128 |
| 306 | 3300025935 | Ga0207709_10048847 | Ga0207709_100488472 | 128 |
| 307 | 3300025937 | Ga0207669_10271584 | Ga0207669_102715843 | 128 |
| 308 | 3300025940 | Ga0207691_11022940 | Ga0207691_110229402 | 128 |
| 309 | 3300025944 | Ga0207661_10042448 | Ga0207661_100424483 | 128 |
| 310 | 3300026116 | Ga0207674_10066775 | Ga0207674_100667753 | 128 |
| 311 | 3300028380 | Ga0268265_10561831 | Ga0268265_105618312 | 128 |
| 312 | 3300037312 | Ga0395899_0018968 | Ga0395899_0018968_4002_4394 | 128 |
| 313 | 3300037312 | Ga0395899_0257562 | Ga0395899_0257562_364_759 | 128 |
| 314 | 3300037418 | Ga0395900_0002962 | Ga0395900_0002962_16726_17118 | 128 |
| 315 | 3300037418 | Ga0395900_0263878 | Ga0395900_0263878_819_1214 | 128 |
| 316 | 3300037466 | Ga0395898_0192927 | Ga0395898_0192927_812_1204 | 128 |
| 317 | 3300037471 | Ga0395905_0007290 | Ga0395905_0007290_2321_2713 | 128 |
| 318 | 3300037471 | Ga0395905_0915276 | Ga0395905_0915276_298_693 | 128 |
| 319 | 3300038443 | Ga0395901_0001901 | Ga0395901_0001901_17479_17871 | 128 |
| 320 | 3300038443 | Ga0395901_0154480 | Ga0395901_0154480_1337_1732 | 128 |
| 321 | 3300041453 | Ga0451797_0838146 | Ga0451797_0838146_39_440 | 128 |
| 322 | 3300042005 | Ga0439448_0024047 | Ga0439448_0024047_1094_1486 | 128 |
| 323 | 3300044694 | Ga0466963_0465383 | Ga0466963_0465383_237_626 | 128 |
| 324 | 3300045976 | Ga0466967_0425673 | Ga0466967_0425673_636_1025 | 128 |
| 325 | 3300046454 | Ga0495592_0526491 | Ga0495592_0526491_176_580 | 128 |
| 326 | 3300046459 | Ga0495629_0490397 | Ga0495629_0490397_154_558 | 128 |
| 327 | 3300046461 | Ga0495641_0564264 | Ga0495641_0564264_41_445 | 128 |
| 328 | 3300046462 | Ga0495651_0598183 | Ga0495651_0598183_170_574 | 128 |
| 329 | 3300046476 | Ga0495662_0186743 | Ga0495662_0186743_580_984 | 128 |
| 330 | 3300046477 | Ga0495664_0126535 | Ga0495664_0126535_580_984 | 128 |
| 331 | 3300046516 | Ga0495628_0925357 | Ga0495628_0925357_10_414 | 128 |
| 332 | 3300046517 | Ga0495630_0396983 | Ga0495630_0396983_375_779 | 128 |
| 333 | 3300046559 | Ga0495667_0067182 | Ga0495667_0067182_1573_1977 | 128 |
| 334 | 3300046615 | Ga0495656_0284636 | Ga0495656_0284636_343_741 | 128 |
| 335 | 3300046642 | Ga0495634_0403898 | Ga0495634_0403898_314_718 | 128 |
| 336 | 3300046663 | Ga0495635_0234895 | Ga0495635_0234895_701_1105 | 128 |
| 337 | 3300046665 | Ga0495661_0343974 | Ga0495661_0343974_27_425 | 128 |
| 338 | 3300046675 | Ga0495657_0139457 | Ga0495657_0139457_228_632 | 128 |
| 339 | 3300047317 | Ga0495604_0319024 | Ga0495604_0319024_544_948 | 128 |
| 340 | 3300047319 | Ga0495674_0434514 | Ga0495674_0434514_450_854 | 128 |
| 341 | 3300047321 | Ga0495676_0383783 | Ga0495676_0383783_324_728 | 128 |
| 342 | 3300047322 | Ga0495680_0197745 | Ga0495680_0197745_588_992 | 128 |
| 343 | 3300048917 | Ga0496114_0457288 | Ga0496114_0457288_192_596 | 128 |
| 344 | 3300053077 | Ga0495601_0584331 | Ga0495601_0584331_160_564 | 128 |
| 345 | 3300053084 | Ga0495595_0187844 | Ga0495595_0187844_39_443 | 128 |
| 346 | 3300053085 | Ga0495619_0230186 | Ga0495619_0230186_26_430 | 128 |
| 347 | 3300001991 | JGI24743J22301_10045839 | JGI24743J22301_100458391 | 129 |
| 348 | 3300002077 | JGI24744J21845_10000622 | JGI24744J21845_100006225 | 129 |
| 349 | 3300003911 | JGI25405J52794_10083919 | JGI25405J52794_100839191 | 129 |
| 350 | 3300005329 | Ga0070683_100619576 | Ga0070683_1006195762 | 129 |
| 351 | 3300005329 | Ga0070683_100937589 | Ga0070683_1009375892 | 129 |
| 352 | 3300005329 | Ga0070683_100945383 | Ga0070683_1009453831 | 129 |
| 353 | 3300005330 | Ga0070690_100007009 | Ga0070690_1000070096 | 129 |
| 354 | 3300005330 | Ga0070690_100007646 | Ga0070690_1000076466 | 129 |
| 355 | 3300005334 | Ga0068869_100229275 | Ga0068869_1002292752 | 129 |
| 356 | 3300005336 | Ga0070680_100049628 | Ga0070680_1000496282 | 129 |
| 357 | 3300005336 | Ga0070680_100207710 | Ga0070680_1002077103 | 129 |
| 358 | 3300005336 | Ga0070680_100272761 | Ga0070680_1002727611 | 129 |
| 359 | 3300005337 | Ga0070682_100007893 | Ga0070682_1000078935 | 129 |
| 360 | 3300005337 | Ga0070682_100809864 | Ga0070682_1008098641 | 129 |
| 361 | 3300005338 | Ga0068868_100042584 | Ga0068868_1000425842 | 129 |
| 362 | 3300005338 | Ga0068868_100925271 | Ga0068868_1009252712 | 129 |
| 363 | 3300005338 | Ga0068868_101460763 | Ga0068868_1014607631 | 129 |
| 364 | 3300005338 | Ga0068868_101712880 | Ga0068868_1017128801 | 129 |
| 365 | 3300005338 | Ga0068868_101941983 | Ga0068868_1019419831 | 129 |
| 366 | 3300005339 | Ga0070660_100014662 | Ga0070660_1000146622 | 129 |
| 367 | 3300005339 | Ga0070660_100016236 | Ga0070660_1000162362 | 129 |
| 368 | 3300005339 | Ga0070660_100088499 | Ga0070660_1000884992 | 129 |
| 369 | 3300005340 | Ga0070689_100001929 | Ga0070689_1000019295 | 129 |
| 370 | 3300005341 | Ga0070691_10014538 | Ga0070691_100145384 | 129 |
| 371 | 3300005341 | Ga0070691_10060012 | Ga0070691_100600122 | 129 |
| 372 | 3300005343 | Ga0070687_100016945 | Ga0070687_1000169454 | 129 |
| 373 | 3300005343 | Ga0070687_100143302 | Ga0070687_1001433022 | 129 |
| 374 | 3300005345 | Ga0070692_10003456 | Ga0070692_100034565 | 129 |
| 375 | 3300005345 | Ga0070692_10016755 | Ga0070692_100167554 | 129 |
| 376 | 3300005347 | Ga0070668_100054346 | Ga0070668_1000543461 | 129 |
| 377 | 3300005347 | Ga0070668_100955672 | Ga0070668_1009556721 | 129 |
| 378 | 3300005353 | Ga0070669_100055884 | Ga0070669_1000558844 | 129 |
| 379 | 3300005354 | Ga0070675_100138657 | Ga0070675_1001386572 | 129 |
| 380 | 3300005354 | Ga0070675_100434258 | Ga0070675_1004342582 | 129 |
| 381 | 3300005355 | Ga0070671_100138439 | Ga0070671_1001384392 | 129 |
| 382 | 3300005356 | Ga0070674_100004383 | Ga0070674_1000043836 | 129 |
| 383 | 3300005356 | Ga0070674_100014406 | Ga0070674_1000144064 | 129 |
| 384 | 3300005364 | Ga0070673_100012370 | Ga0070673_1000123706 | 129 |
| 385 | 3300005364 | Ga0070673_100173255 | Ga0070673_1001732554 | 129 |
| 386 | 3300005365 | Ga0070688_100027090 | Ga0070688_1000270902 | 129 |
| 387 | 3300005366 | Ga0070659_100003504 | Ga0070659_10000350410 | 129 |
| 388 | 3300005366 | Ga0070659_100020196 | Ga0070659_1000201965 | 129 |
| 389 | 3300005366 | Ga0070659_100250168 | Ga0070659_1002501681 | 129 |
| 390 | 3300005366 | Ga0070659_100272169 | Ga0070659_1002721692 | 129 |
| 391 | 3300005367 | Ga0070667_100360629 | Ga0070667_1003606292 | 129 |
| 392 | 3300005367 | Ga0070667_100797232 | Ga0070667_1007972321 | 129 |
| 393 | 3300005406 | Ga0070703_10042315 | Ga0070703_100423151 | 129 |
| 394 | 3300005434 | Ga0070709_10006351 | Ga0070709_100063516 | 129 |
| 395 | 3300005435 | Ga0070714_100432599 | Ga0070714_1004325993 | 129 |
| 396 | 3300005437 | Ga0070710_10004670 | Ga0070710_100046706 | 129 |
| 397 | 3300005438 | Ga0070701_10002084 | Ga0070701_100020844 | 129 |
| 398 | 3300005438 | Ga0070701_10080816 | Ga0070701_100808162 | 129 |
| 399 | 3300005438 | Ga0070701_10140634 | Ga0070701_101406343 | 129 |
| 400 | 3300005439 | Ga0070711_100174269 | Ga0070711_1001742693 | 129 |
| 401 | 3300005440 | Ga0070705_100071436 | Ga0070705_1000714361 | 129 |
| 402 | 3300005441 | Ga0070700_100196915 | Ga0070700_1001969152 | 129 |
| 403 | 3300005441 | Ga0070700_100447030 | Ga0070700_1004470303 | 129 |
| 404 | 3300005444 | Ga0070694_100006339 | Ga0070694_1000063396 | 129 |
| 405 | 3300005444 | Ga0070694_100015580 | Ga0070694_1000155805 | 129 |
| 406 | 3300005455 | Ga0070663_100009824 | Ga0070663_1000098246 | 129 |
| 407 | 3300005455 | Ga0070663_100688211 | Ga0070663_1006882112 | 129 |
| 408 | 3300005456 | Ga0070678_100001355 | Ga0070678_1000013555 | 129 |
| 409 | 3300005456 | Ga0070678_100024433 | Ga0070678_1000244333 | 129 |
| 410 | 3300005456 | Ga0070678_100905202 | Ga0070678_1009052022 | 129 |
| 411 | 3300005457 | Ga0070662_100014629 | Ga0070662_1000146293 | 129 |
| 412 | 3300005457 | Ga0070662_100032138 | Ga0070662_1000321385 | 129 |
| 413 | 3300005457 | Ga0070662_100066548 | Ga0070662_1000665483 | 129 |
| 414 | 3300005458 | Ga0070681_10281295 | Ga0070681_102812952 | 129 |
| 415 | 3300005458 | Ga0070681_10628878 | Ga0070681_106288782 | 129 |
| 416 | 3300005459 | Ga0068867_100004104 | Ga0068867_1000041045 | 129 |
| 417 | 3300005466 | Ga0070685_10060121 | Ga0070685_100601212 | 129 |
| 418 | 3300005467 | Ga0070706_100015559 | Ga0070706_1000155596 | 129 |
| 419 | 3300005471 | Ga0070698_100018972 | Ga0070698_1000189726 | 129 |
| 420 | 3300005530 | Ga0070679_100025017 | Ga0070679_1000250178 | 129 |
| 421 | 3300005530 | Ga0070679_100100735 | Ga0070679_1001007352 | 129 |
| 422 | 3300005530 | Ga0070679_100145965 | Ga0070679_1001459653 | 129 |
| 423 | 3300005530 | Ga0070679_100285032 | Ga0070679_1002850322 | 129 |
| 424 | 3300005530 | Ga0070679_100481822 | Ga0070679_1004818222 | 129 |
| 425 | 3300005530 | Ga0070679_101460179 | Ga0070679_1014601791 | 129 |
| 426 | 3300005535 | Ga0070684_100955018 | Ga0070684_1009550182 | 129 |
| 427 | 3300005539 | Ga0068853_100003775 | Ga0068853_1000037756 | 129 |
| 428 | 3300005539 | Ga0068853_100067026 | Ga0068853_1000670264 | 129 |
| 429 | 3300005539 | Ga0068853_100418115 | Ga0068853_1004181152 | 129 |
| 430 | 3300005539 | Ga0068853_100471891 | Ga0068853_1004718912 | 129 |
| 431 | 3300005545 | Ga0070695_100006793 | Ga0070695_1000067937 | 129 |
| 432 | 3300005546 | Ga0070696_100008063 | Ga0070696_1000080635 | 129 |
| 433 | 3300005546 | Ga0070696_100013726 | Ga0070696_1000137262 | 129 |
| 434 | 3300005546 | Ga0070696_100016796 | Ga0070696_1000167966 | 129 |
| 435 | 3300005546 | Ga0070696_101531295 | Ga0070696_1015312951 | 129 |
| 436 | 3300005547 | Ga0070693_100109962 | Ga0070693_1001099622 | 129 |
| 437 | 3300005547 | Ga0070693_100221042 | Ga0070693_1002210423 | 129 |
| 438 | 3300005548 | Ga0070665_100229666 | Ga0070665_1002296663 | 129 |
| 439 | 3300005549 | Ga0070704_100017949 | Ga0070704_1000179493 | 129 |
| 440 | 3300005549 | Ga0070704_100055926 | Ga0070704_1000559264 | 129 |
| 441 | 3300005563 | Ga0068855_100039995 | Ga0068855_1000399955 | 129 |
| 442 | 3300005563 | Ga0068855_100040250 | Ga0068855_1000402504 | 129 |
| 443 | 3300005563 | Ga0068855_100329890 | Ga0068855_1003298904 | 129 |
| 444 | 3300005563 | Ga0068855_100699520 | Ga0068855_1006995202 | 129 |
| 445 | 3300005563 | Ga0068855_100746606 | Ga0068855_1007466062 | 129 |
| 446 | 3300005578 | Ga0068854_100032576 | Ga0068854_1000325764 | 129 |
| 447 | 3300005578 | Ga0068854_100623591 | Ga0068854_1006235912 | 129 |
| 448 | 3300005578 | Ga0068854_101765634 | Ga0068854_1017656341 | 129 |
| 449 | 3300005614 | Ga0068856_100007081 | Ga0068856_1000070814 | 129 |
| 450 | 3300005614 | Ga0068856_101594374 | Ga0068856_1015943741 | 129 |
| 451 | 3300005615 | Ga0070702_100021016 | Ga0070702_1000210163 | 129 |
| 452 | 3300005615 | Ga0070702_100077498 | Ga0070702_1000774982 | 129 |
| 453 | 3300005616 | Ga0068852_100327449 | Ga0068852_1003274492 | 129 |
| 454 | 3300005616 | Ga0068852_100597961 | Ga0068852_1005979613 | 129 |
| 455 | 3300005617 | Ga0068859_100120993 | Ga0068859_1001209934 | 129 |
| 456 | 3300005617 | Ga0068859_100483423 | Ga0068859_1004834232 | 129 |
| 457 | 3300005718 | Ga0068866_10012434 | Ga0068866_100124343 | 129 |
| 458 | 3300005718 | Ga0068866_10013230 | Ga0068866_100132303 | 129 |
| 459 | 3300005719 | Ga0068861_100018958 | Ga0068861_1000189584 | 129 |
| 460 | 3300005719 | Ga0068861_100077252 | Ga0068861_1000772523 | 129 |
| 461 | 3300005719 | Ga0068861_100295761 | Ga0068861_1002957611 | 129 |
| 462 | 3300005844 | Ga0068862_100069889 | Ga0068862_1000698894 | 129 |
| 463 | 3300005937 | Ga0081455_10005481 | Ga0081455_100054818 | 129 |
| 464 | 3300005981 | Ga0081538_10005013 | Ga0081538_1000501315 | 129 |
| 465 | 3300005983 | Ga0081540_1010083 | Ga0081540_10100836 | 129 |
| 466 | 3300005983 | Ga0081540_1020045 | Ga0081540_10200454 | 129 |
| 467 | 3300006038 | Ga0075365_10088285 | Ga0075365_100882852 | 129 |
| 468 | 3300006058 | Ga0075432_10007341 | Ga0075432_100073413 | 129 |
| 469 | 3300006163 | Ga0070715_10118432 | Ga0070715_101184322 | 129 |
| 470 | 3300006173 | Ga0070716_100295463 | Ga0070716_1002954632 | 129 |
| 471 | 3300006173 | Ga0070716_100700007 | Ga0070716_1007000071 | 129 |
| 472 | 3300006175 | Ga0070712_100016882 | Ga0070712_1000168823 | 129 |
| 473 | 3300006178 | Ga0075367_10129912 | Ga0075367_101299123 | 129 |
| 474 | 3300006237 | Ga0097621_100005876 | Ga0097621_10000587610 | 129 |
| 475 | 3300006358 | Ga0068871_100138006 | Ga0068871_1001380062 | 129 |
| 476 | 3300006847 | Ga0075431_100006169 | Ga0075431_1000061693 | 129 |
| 477 | 3300006847 | Ga0075431_100278062 | Ga0075431_1002780623 | 129 |
| 478 | 3300006847 | Ga0075431_101876898 | Ga0075431_1018768981 | 129 |
| 479 | 3300006871 | Ga0075434_100098662 | Ga0075434_1000986622 | 129 |
| 480 | 3300006871 | Ga0075434_100131466 | Ga0075434_1001314662 | 129 |
| 481 | 3300006880 | Ga0075429_100038949 | Ga0075429_1000389494 | 129 |
| 482 | 3300006881 | Ga0068865_100008007 | Ga0068865_1000080073 | 129 |
| 483 | 3300006881 | Ga0068865_100016053 | Ga0068865_1000160536 | 129 |
| 484 | 3300006914 | Ga0075436_100011666 | Ga0075436_1000116663 | 129 |
| 485 | 3300006931 | Ga0097620_100120997 | Ga0097620_1001209974 | 129 |
| 486 | 3300006931 | Ga0097620_100483446 | Ga0097620_1004834462 | 129 |
| 487 | 3300007076 | Ga0075435_100054169 | Ga0075435_1000541693 | 129 |
| 488 | 3300009092 | Ga0105250_10187788 | Ga0105250_101877882 | 129 |
| 489 | 3300009093 | Ga0105240_10388353 | Ga0105240_103883533 | 129 |
| 490 | 3300009094 | Ga0111539_10129955 | Ga0111539_101299552 | 129 |
| 491 | 3300009094 | Ga0111539_11489475 | Ga0111539_114894752 | 129 |
| 492 | 3300009098 | Ga0105245_10026959 | Ga0105245_100269594 | 129 |
| 493 | 3300009098 | Ga0105245_10033334 | Ga0105245_100333347 | 129 |
| 494 | 3300009098 | Ga0105245_10676799 | Ga0105245_106767992 | 129 |
| 495 | 3300009147 | Ga0114129_10118719 | Ga0114129_101187194 | 129 |
| 496 | 3300009148 | Ga0105243_10068354 | Ga0105243_100683544 | 129 |
| 497 | 3300009148 | Ga0105243_11004036 | Ga0105243_110040362 | 129 |
| 498 | 3300009176 | Ga0105242_10009803 | Ga0105242_100098036 | 129 |
| 499 | 3300009176 | Ga0105242_10049217 | Ga0105242_100492174 | 129 |
| 500 | 3300009177 | Ga0105248_10051290 | Ga0105248_100512902 | 129 |
| 501 | 3300009177 | Ga0105248_11104389 | Ga0105248_111043892 | 129 |
| 502 | 3300009545 | Ga0105237_10586598 | Ga0105237_105865982 | 129 |
| 503 | 3300009545 | Ga0105237_10803775 | Ga0105237_108037751 | 129 |
| 504 | 3300009551 | Ga0105238_11287724 | Ga0105238_112877241 | 129 |
| 505 | 3300009553 | Ga0105249_10017306 | Ga0105249_100173066 | 129 |
| 506 | 3300009553 | Ga0105249_10269560 | Ga0105249_102695601 | 129 |
| 507 | 3300010375 | Ga0105239_10039565 | Ga0105239_100395652 | 129 |
| 508 | 3300010375 | Ga0105239_10054523 | Ga0105239_100545233 | 129 |
| 509 | 3300010375 | Ga0105239_10111319 | Ga0105239_101113192 | 129 |
| 510 | 3300010375 | Ga0105239_10326454 | Ga0105239_103264541 | 129 |
| 511 | 3300011119 | Ga0105246_11510152 | Ga0105246_115101521 | 129 |
| 512 | 3300013102 | Ga0157371_10059211 | Ga0157371_100592114 | 129 |
| 513 | 3300013105 | Ga0157369_11048051 | Ga0157369_110480511 | 129 |
| 514 | 3300013297 | Ga0157378_10500455 | Ga0157378_105004552 | 129 |
| 515 | 3300013306 | Ga0163162_10194728 | Ga0163162_101947283 | 129 |
| 516 | 3300013307 | Ga0157372_10059494 | Ga0157372_100594943 | 129 |
| 517 | 3300013308 | Ga0157375_12389446 | Ga0157375_123894462 | 129 |
| 518 | 3300014325 | Ga0163163_11110528 | Ga0163163_111105281 | 129 |
| 519 | 3300014326 | Ga0157380_11215358 | Ga0157380_112153582 | 129 |
| 520 | 3300014968 | Ga0157379_10426745 | Ga0157379_104267453 | 129 |
| 521 | 3300017792 | Ga0163161_10416536 | Ga0163161_104165363 | 129 |
| 522 | 3300020069 | Ga0197907_10551217 | Ga0197907_105512172 | 129 |
| 523 | 3300020081 | Ga0206354_10514906 | Ga0206354_105149064 | 129 |
| 524 | 3300020081 | Ga0206354_11598535 | Ga0206354_115985352 | 129 |
| 525 | 3300020082 | Ga0206353_10357655 | Ga0206353_103576552 | 129 |
| 526 | 3300020082 | Ga0206353_10693181 | Ga0206353_106931815 | 129 |
| 527 | 3300025321 | Ga0207656_10332846 | Ga0207656_103328462 | 129 |
| 528 | 3300025885 | Ga0207653_10009818 | Ga0207653_100098183 | 129 |
| 529 | 3300025893 | Ga0207682_10090035 | Ga0207682_100900351 | 129 |
| 530 | 3300025898 | Ga0207692_10043747 | Ga0207692_100437473 | 129 |
| 531 | 3300025901 | Ga0207688_10052488 | Ga0207688_100524884 | 129 |
| 532 | 3300025903 | Ga0207680_10075491 | Ga0207680_100754912 | 129 |
| 533 | 3300025905 | Ga0207685_10083663 | Ga0207685_100836632 | 129 |
| 534 | 3300025906 | Ga0207699_10082672 | Ga0207699_100826724 | 129 |
| 535 | 3300025910 | Ga0207684_10014015 | Ga0207684_100140153 | 129 |
| 536 | 3300025910 | Ga0207684_10475833 | Ga0207684_104758331 | 129 |
| 537 | 3300025912 | Ga0207707_10064009 | Ga0207707_100640093 | 129 |
| 538 | 3300025912 | Ga0207707_10087336 | Ga0207707_100873362 | 129 |
| 539 | 3300025912 | Ga0207707_11050666 | Ga0207707_110506662 | 129 |
| 540 | 3300025914 | Ga0207671_10407307 | Ga0207671_104073073 | 129 |
| 541 | 3300025914 | Ga0207671_11251326 | Ga0207671_112513261 | 129 |
| 542 | 3300025915 | Ga0207693_10000778 | Ga0207693_1000077830 | 129 |
| 543 | 3300025916 | Ga0207663_10144465 | Ga0207663_101444652 | 129 |
| 544 | 3300025917 | Ga0207660_10043173 | Ga0207660_100431734 | 129 |
| 545 | 3300025917 | Ga0207660_10079261 | Ga0207660_100792614 | 129 |
| 546 | 3300025917 | Ga0207660_10175083 | Ga0207660_101750833 | 129 |
| 547 | 3300025918 | Ga0207662_10143107 | Ga0207662_101431073 | 129 |
| 548 | 3300025919 | Ga0207657_10012421 | Ga0207657_100124215 | 129 |
| 549 | 3300025919 | Ga0207657_10053411 | Ga0207657_100534112 | 129 |
| 550 | 3300025919 | Ga0207657_10120872 | Ga0207657_101208722 | 129 |
| 551 | 3300025919 | Ga0207657_10240791 | Ga0207657_102407913 | 129 |
| 552 | 3300025921 | Ga0207652_10018732 | Ga0207652_100187322 | 129 |
| 553 | 3300025921 | Ga0207652_10102648 | Ga0207652_101026484 | 129 |
| 554 | 3300025921 | Ga0207652_10118863 | Ga0207652_101188632 | 129 |
| 555 | 3300025921 | Ga0207652_10119579 | Ga0207652_101195792 | 129 |
| 556 | 3300025921 | Ga0207652_10137085 | Ga0207652_101370852 | 129 |
| 557 | 3300025921 | Ga0207652_11099849 | Ga0207652_110998492 | 129 |
| 558 | 3300025922 | Ga0207646_10608923 | Ga0207646_106089232 | 129 |
| 559 | 3300025923 | Ga0207681_10234729 | Ga0207681_102347293 | 129 |
| 560 | 3300025924 | Ga0207694_10309847 | Ga0207694_103098472 | 129 |
| 561 | 3300025926 | Ga0207659_10042011 | Ga0207659_100420113 | 129 |
| 562 | 3300025926 | Ga0207659_10263969 | Ga0207659_102639692 | 129 |
| 563 | 3300025927 | Ga0207687_10018420 | Ga0207687_100184204 | 129 |
| 564 | 3300025927 | Ga0207687_10033989 | Ga0207687_100339894 | 129 |
| 565 | 3300025929 | Ga0207664_10803203 | Ga0207664_108032032 | 129 |
| 566 | 3300025931 | Ga0207644_10179775 | Ga0207644_101797751 | 129 |
| 567 | 3300025932 | Ga0207690_10071533 | Ga0207690_100715332 | 129 |
| 568 | 3300025932 | Ga0207690_10083304 | Ga0207690_100833042 | 129 |
| 569 | 3300025932 | Ga0207690_10245659 | Ga0207690_102456592 | 129 |
| 570 | 3300025932 | Ga0207690_10354611 | Ga0207690_103546112 | 129 |
| 571 | 3300025932 | Ga0207690_10845119 | Ga0207690_108451192 | 129 |
| 572 | 3300025933 | Ga0207706_10015721 | Ga0207706_100157214 | 129 |
| 573 | 3300025933 | Ga0207706_10047569 | Ga0207706_100475694 | 129 |
| 574 | 3300025934 | Ga0207686_10069082 | Ga0207686_100690824 | 129 |
| 575 | 3300025935 | Ga0207709_10031487 | Ga0207709_100314874 | 129 |
| 576 | 3300025935 | Ga0207709_10192125 | Ga0207709_101921252 | 129 |
| 577 | 3300025936 | Ga0207670_10174928 | Ga0207670_101749282 | 129 |
| 578 | 3300025937 | Ga0207669_10003176 | Ga0207669_100031764 | 129 |
| 579 | 3300025937 | Ga0207669_10538121 | Ga0207669_105381211 | 129 |
| 580 | 3300025938 | Ga0207704_10018471 | Ga0207704_100184715 | 129 |
| 581 | 3300025938 | Ga0207704_10025797 | Ga0207704_100257972 | 129 |
| 582 | 3300025939 | Ga0207665_10025299 | Ga0207665_100252993 | 129 |
| 583 | 3300025940 | Ga0207691_10017123 | Ga0207691_100171232 | 129 |
| 584 | 3300025940 | Ga0207691_10398484 | Ga0207691_103984842 | 129 |
| 585 | 3300025941 | Ga0207711_10221812 | Ga0207711_102218122 | 129 |
| 586 | 3300025942 | Ga0207689_10125421 | Ga0207689_101254212 | 129 |
| 587 | 3300025942 | Ga0207689_10268418 | Ga0207689_102684183 | 129 |
| 588 | 3300025942 | Ga0207689_11166964 | Ga0207689_111669642 | 129 |
| 589 | 3300025944 | Ga0207661_10856073 | Ga0207661_108560732 | 129 |
| 590 | 3300025944 | Ga0207661_11682482 | Ga0207661_116824821 | 129 |
| 591 | 3300025949 | Ga0207667_10114531 | Ga0207667_101145313 | 129 |
| 592 | 3300025949 | Ga0207667_10217497 | Ga0207667_102174972 | 129 |
| 593 | 3300025949 | Ga0207667_10296724 | Ga0207667_102967242 | 129 |
| 594 | 3300025960 | Ga0207651_10011111 | Ga0207651_100111114 | 129 |
| 595 | 3300025960 | Ga0207651_10081749 | Ga0207651_100817494 | 129 |
| 596 | 3300025961 | Ga0207712_10059287 | Ga0207712_100592872 | 129 |
| 597 | 3300025961 | Ga0207712_10328821 | Ga0207712_103288213 | 129 |
| 598 | 3300025961 | Ga0207712_11525472 | Ga0207712_115254722 | 129 |
| 599 | 3300025972 | Ga0207668_10634384 | Ga0207668_106343842 | 129 |
| 600 | 3300025972 | Ga0207668_11051881 | Ga0207668_110518811 | 129 |
| 601 | 3300025981 | Ga0207640_10041232 | Ga0207640_100412324 | 129 |
| 602 | 3300025981 | Ga0207640_10314602 | Ga0207640_103146022 | 129 |
| 603 | 3300025981 | Ga0207640_10587548 | Ga0207640_105875482 | 129 |
| 604 | 3300025986 | Ga0207658_10412003 | Ga0207658_104120032 | 129 |
| 605 | 3300026023 | Ga0207677_10316876 | Ga0207677_103168762 | 129 |
| 606 | 3300026023 | Ga0207677_11548282 | Ga0207677_115482822 | 129 |
| 607 | 3300026041 | Ga0207639_10015667 | Ga0207639_100156674 | 129 |
| 608 | 3300026041 | Ga0207639_10098640 | Ga0207639_100986404 | 129 |
| 609 | 3300026041 | Ga0207639_10296368 | Ga0207639_102963682 | 129 |
| 610 | 3300026067 | Ga0207678_10012714 | Ga0207678_100127146 | 129 |
| 611 | 3300026075 | Ga0207708_10003195 | Ga0207708_1000319516 | 129 |
| 612 | 3300026075 | Ga0207708_10080217 | Ga0207708_100802172 | 129 |
| 613 | 3300026078 | Ga0207702_11194741 | Ga0207702_111947412 | 129 |
| 614 | 3300026089 | Ga0207648_10002086 | Ga0207648_100020867 | 129 |
| 615 | 3300026089 | Ga0207648_10004570 | Ga0207648_100045707 | 129 |
| 616 | 3300026118 | Ga0207675_100015447 | Ga0207675_1000154474 | 129 |
| 617 | 3300026118 | Ga0207675_100046297 | Ga0207675_1000462975 | 129 |
| 618 | 3300026121 | Ga0207683_10000041 | Ga0207683_1000004176 | 129 |
| 619 | 3300026121 | Ga0207683_10036784 | Ga0207683_100367844 | 129 |
| 620 | 3300026121 | Ga0207683_10863968 | Ga0207683_108639681 | 129 |
| 621 | 3300026142 | Ga0207698_10207669 | Ga0207698_102076692 | 129 |
| 622 | 3300027665 | Ga0209983_1122351 | Ga0209983_11223512 | 129 |
| 623 | 3300027717 | Ga0209998_10010246 | Ga0209998_100102463 | 129 |
| 624 | 3300027907 | Ga0207428_10000892 | Ga0207428_1000089230 | 129 |
| 625 | 3300027907 | Ga0207428_10002067 | Ga0207428_1000206713 | 129 |
| 626 | 3300028379 | Ga0268266_10896920 | Ga0268266_108969202 | 129 |
| 627 | 3300031548 | Ga0307408_100101790 | Ga0307408_1001017901 | 129 |
| 628 | 3300031731 | Ga0307405_10167921 | Ga0307405_101679213 | 129 |
| 629 | 3300031901 | Ga0307406_11039426 | Ga0307406_110394261 | 129 |
| 630 | 3300032002 | Ga0307416_101827999 | Ga0307416_1018279992 | 129 |
| 631 | 3300032126 | Ga0307415_100065331 | Ga0307415_1000653312 | 129 |
| 632 | 3300032126 | Ga0307415_100088096 | Ga0307415_1000880963 | 129 |
| 633 | 3300034820 | Ga0373959_0191654 | Ga0373959_0191654_43_438 | 129 |
| 634 | 3300035091 | Ga0373951_0152433 | Ga0373951_0152433_104_499 | 129 |
| 635 | 3300035112 | Ga0373932_0038275 | Ga0373932_0038275_800_1195 | 129 |
| 636 | 3300035113 | Ga0373936_0142413 | Ga0373936_0142413_276_671 | 129 |
| 637 | 3300035115 | Ga0373941_0219299 | Ga0373941_0219299_258_653 | 129 |
| 638 | 3300035116 | Ga0373945_0018054 | Ga0373945_0018054_1961_2356 | 129 |
| 639 | 3300035121 | Ga0373960_0093402 | Ga0373960_0093402_440_835 | 129 |
| 640 | 3300035241 | Ga0373961_0129816 | Ga0373961_0129816_231_626 | 129 |
| 641 | 3300037312 | Ga0395899_0116376 | Ga0395899_0116376_599_988 | 129 |
| 642 | 3300037312 | Ga0395899_0264069 | Ga0395899_0264069_40_432 | 129 |
| 643 | 3300037418 | Ga0395900_0012510 | Ga0395900_0012510_2313_2705 | 129 |
| 644 | 3300037418 | Ga0395900_0039626 | Ga0395900_0039626_4005_4394 | 129 |
| 645 | 3300037466 | Ga0395898_0001862 | Ga0395898_0001862_8331_8720 | 129 |
| 646 | 3300037466 | Ga0395898_0008942 | Ga0395898_0008942_4070_4462 | 129 |
| 647 | 3300037466 | Ga0395898_0269908 | Ga0395898_0269908_305_703 | 129 |
| 648 | 3300037466 | Ga0395898_1563840 | Ga0395898_1563840_117_506 | 129 |
| 649 | 3300037471 | Ga0395905_0012603 | Ga0395905_0012603_5970_6359 | 129 |
| 650 | 3300037471 | Ga0395905_0039785 | Ga0395905_0039785_2253_2645 | 129 |
| 651 | 3300037471 | Ga0395905_0092114 | Ga0395905_0092114_989_1387 | 129 |
| 652 | 3300037471 | Ga0395905_0107670 | Ga0395905_0107670_1098_1487 | 129 |
| 653 | 3300038443 | Ga0395901_0006362 | Ga0395901_0006362_9450_9842 | 129 |
| 654 | 3300038443 | Ga0395901_0009061 | Ga0395901_0009061_8691_9089 | 129 |
| 655 | 3300038443 | Ga0395901_0013690 | Ga0395901_0013690_6166_6555 | 129 |
| 656 | 3300038443 | Ga0395901_0624181 | Ga0395901_0624181_15_407 | 129 |
| 657 | 3300038443 | Ga0395901_0792224 | Ga0395901_0792224_45_434 | 129 |
| 658 | 3300038996 | Ga0242420_020251 | Ga0242420_020251_637_1026 | 129 |
| 659 | 3300041443 | Ga0451789_0958954 | Ga0451789_0958954_26_418 | 129 |
| 660 | 3300041458 | Ga0451798_0067737 | Ga0451798_0067737_180_587 | 129 |
| 661 | 3300041459 | Ga0451800_0962065 | Ga0451800_0962065_122_511 | 129 |
| 662 | 3300041505 | Ga0451849_1263875 | Ga0451849_1263875_57_449 | 129 |
| 663 | 3300041512 | Ga0451853_0324016 | Ga0451853_0324016_159_566 | 129 |
| 664 | 3300042005 | Ga0439448_0001968 | Ga0439448_0001968_2603_2998 | 129 |
| 665 | 3300045836 | Ga0466958_0000480 | Ga0466958_0000480_5697_6092 | 129 |
| 666 | 3300045976 | Ga0466967_0034221 | Ga0466967_0034221_1132_1527 | 129 |
| 667 | 3300045976 | Ga0466967_0389284 | Ga0466967_0389284_528_935 | 129 |
| 668 | 3300045976 | Ga0466967_1160218 | Ga0466967_1160218_302_709 | 129 |
| 669 | 3300046454 | Ga0495592_0552510 | Ga0495592_0552510_91_492 | 129 |
| 670 | 3300046455 | Ga0495603_0043669 | Ga0495603_0043669_199_594 | 129 |
| 671 | 3300046455 | Ga0495603_0305353 | Ga0495603_0305353_311_718 | 129 |
| 672 | 3300046473 | Ga0495582_0242706 | Ga0495582_0242706_569_958 | 129 |
| 673 | 3300046474 | Ga0495605_0343941 | Ga0495605_0343941_148_546 | 129 |
| 674 | 3300046491 | Ga0495584_0040909 | Ga0495584_0040909_958_1347 | 129 |
| 675 | 3300046491 | Ga0495584_0270372 | Ga0495584_0270372_192_587 | 129 |
| 676 | 3300046491 | Ga0495584_0339608 | Ga0495584_0339608_125_523 | 129 |
| 677 | 3300046499 | Ga0495594_0506557 | Ga0495594_0506557_96_485 | 129 |
| 678 | 3300046506 | Ga0495583_0287467 | Ga0495583_0287467_181_570 | 129 |
| 679 | 3300046518 | Ga0495631_0216644 | Ga0495631_0216644_92_484 | 129 |
| 680 | 3300046520 | Ga0495637_0076799 | Ga0495637_0076799_591_989 | 129 |
| 681 | 3300046523 | Ga0495644_0049631 | Ga0495644_0049631_284_682 | 129 |
| 682 | 3300046525 | Ga0495663_0009546 | Ga0495663_0009546_2079_2468 | 129 |
| 683 | 3300046525 | Ga0495663_0038384 | Ga0495663_0038384_111_509 | 129 |
| 684 | 3300046526 | Ga0495666_0025960 | Ga0495666_0025960_1875_2270 | 129 |
| 685 | 3300046528 | Ga0495642_0036910 | Ga0495642_0036910_17_406 | 129 |
| 686 | 3300046528 | Ga0495642_0163311 | Ga0495642_0163311_18_416 | 129 |
| 687 | 3300046537 | Ga0495598_0348435 | Ga0495598_0348435_58_447 | 129 |
| 688 | 3300046537 | Ga0495598_0439402 | Ga0495598_0439402_107_505 | 129 |
| 689 | 3300046615 | Ga0495656_0141384 | Ga0495656_0141384_335_730 | 129 |
| 690 | 3300046615 | Ga0495656_0791917 | Ga0495656_0791917_91_480 | 129 |
| 691 | 3300046665 | Ga0495661_0582427 | Ga0495661_0582427_73_471 | 129 |
| 692 | 3300046674 | Ga0495588_0322846 | Ga0495588_0322846_309_716 | 129 |
| 693 | 3300046691 | Ga0495670_0349269 | Ga0495670_0349269_73_462 | 129 |
| 694 | 3300046694 | Ga0495649_0137797 | Ga0495649_0137797_398_805 | 129 |
| 695 | 3300047318 | Ga0495636_0130097 | Ga0495636_0130097_31_420 | 129 |
| 696 | 3300047318 | Ga0495636_0376457 | Ga0495636_0376457_122_511 | 129 |
| 697 | 3300047321 | Ga0495676_0581928 | Ga0495676_0581928_272_661 | 129 |
| 698 | 3300047323 | Ga0495683_0343216 | Ga0495683_0343216_107_511 | 129 |
| 699 | 3300048904 | Ga0496101_0047646 | Ga0496101_0047646_853_1251 | 129 |
| 700 | 3300048904 | Ga0496101_0676087 | Ga0496101_0676087_36_452 | 129 |
| 701 | 3300048905 | Ga0496102_0023315 | Ga0496102_0023315_2952_3350 | 129 |
| 702 | 3300048905 | Ga0496102_0038410 | Ga0496102_0038410_2152_2547 | 129 |
| 703 | 3300048905 | Ga0496102_0241458 | Ga0496102_0241458_852_1241 | 129 |
| 704 | 3300048906 | Ga0496103_0073420 | Ga0496103_0073420_1079_1477 | 129 |
| 705 | 3300048906 | Ga0496103_0324372 | Ga0496103_0324372_287_703 | 129 |
| 706 | 3300048907 | Ga0496104_0016248 | Ga0496104_0016248_3614_4012 | 129 |
| 707 | 3300048910 | Ga0496107_0079003 | Ga0496107_0079003_1883_2281 | 129 |
| 708 | 3300048912 | Ga0496109_0032399 | Ga0496109_0032399_410_826 | 129 |
| 709 | 3300048912 | Ga0496109_0205067 | Ga0496109_0205067_1184_1573 | 129 |
| 710 | 3300048913 | Ga0496110_0000686 | Ga0496110_0000686_5370_5768 | 129 |
| 711 | 3300048913 | Ga0496110_0025179 | Ga0496110_0025179_2184_2579 | 129 |
| 712 | 3300048914 | Ga0496111_0003353 | Ga0496111_0003353_1454_1852 | 129 |
| 713 | 3300048915 | Ga0496112_0248553 | Ga0496112_0248553_502_897 | 129 |
| 714 | 3300048915 | Ga0496112_0290804 | Ga0496112_0290804_391_807 | 129 |
| 715 | 3300048915 | Ga0496112_0710091 | Ga0496112_0710091_274_669 | 129 |
| 716 | 3300048916 | Ga0496113_0328992 | Ga0496113_0328992_158_547 | 129 |
| 717 | 3300048916 | Ga0496113_0438040 | Ga0496113_0438040_194_589 | 129 |
| 718 | 3300048917 | Ga0496114_0047277 | Ga0496114_0047277_791_1189 | 129 |
| 719 | 3300048917 | Ga0496114_0067201 | Ga0496114_0067201_2036_2431 | 129 |
| 720 | 3300050490 | nmdc:mga03n38_129858_c1 | nmdc:mga03n38_129858_c1_53_448 | 129 |
| 721 | 3300050492 | nmdc:mga0yw44_136274_c1 | nmdc:mga0yw44_136274_c1_293_685 | 129 |
| 722 | 3300050494 | nmdc:mga06z11_350217_c1 | nmdc:mga06z11_350217_c1_246_641 | 129 |
| 723 | 3300050507 | nmdc:mga05p37_102731_c1 | nmdc:mga05p37_102731_c1_1069_1461 | 129 |
| 724 | 3300050507 | nmdc:mga05p37_41257_c1 | nmdc:mga05p37_41257_c1_636_1031 | 129 |
| 725 | 3300050510 | nmdc:mga06r32_324075_c1 | nmdc:mga06r32_324075_c1_591_986 | 129 |
| 726 | 3300050511 | nmdc:mga08y16_169317_c1 | nmdc:mga08y16_169317_c1_623_1015 | 129 |
| 727 | 3300050511 | nmdc:mga08y16_84209_c1 | nmdc:mga08y16_84209_c1_1186_1581 | 129 |
| 728 | 3300050512 | nmdc:mga0n895_151250_c1 | nmdc:mga0n895_151250_c1_460_852 | 129 |
| 729 | 3300050512 | nmdc:mga0n895_19897_c1 | nmdc:mga0n895_19897_c1_2688_3083 | 129 |
| 730 | 3300050513 | nmdc:mga0rr50_27592_c1 | nmdc:mga0rr50_27592_c1_300_695 | 129 |
| 731 | 3300050514 | nmdc:mga08x19_18219_c1 | nmdc:mga08x19_18219_c1_1087_1482 | 129 |
| 732 | 3300050515 | nmdc:mga0a205_329898_c1 | nmdc:mga0a205_329898_c1_702_1097 | 129 |
| 733 | 3300050515 | nmdc:mga0a205_469750_c1 | nmdc:mga0a205_469750_c1_124_516 | 129 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8h53-assembly2.cif.gz_C | human asparaginyl-trna synthetase in complex with asparagine-amp | 0.7997 | 35 | 112 |
| 8h53-assembly1.cif.gz_A | human asparaginyl-trna synthetase in complex with asparagine-amp | 0.7932 | 35 | 112 |
| 1j6q-assembly1.cif.gz_A | solution structure and characterization of the heme chaperone ccme | 0.7802 | 34 | 120 |
| 5ihe-assembly2.cif.gz_B | d-family dna polymerase - dp1 subunit (3'-5' proof-reading exonuclease) | 0.7504 | 34 | 112 |
| 6t8h-assembly1.cif.gz_A | cryo-em structure of the dna-bound pold-pcna processive complex from p. abyssi | 0.7435 | 34 | 112 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ywkA02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.814 | 36 | 106 | 2.40.50.140 |
| 1j6qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7802 | 34 | 120 | 2.40.50.140 |
| af_Q9GYL9_118_221_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.765 | 36 | 113 | 2.40.50.140 |
| 4me3A02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7579 | 37 | 113 | 2.40.50.140 |
| 4pofA02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7508 | 37 | 112 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1JIT1-F1-model_v4 | Cytochrome c maturation protein CcmE | 0.8397 | 51 | 129 |
GO:0005886
GO:0017004 GO:0020037 |
| AF-A0A7W1BRT6-F1-model_v4 | Cytochrome c maturation protein CcmE | 0.8193 | 26 | 129 |
GO:0005886
GO:0017004 GO:0020037 |
| AF-A0A7W1JIT1-F1-model_v4 | Cytochrome c maturation protein CcmE | 0.8115 | 51 | 129 |
GO:0005886
GO:0017004 GO:0020037 |
| AF-A0A7W0MXY0-F1-model_v4 | RecG wedge domain-containing protein | 0.8036 | 34 | 113 |
GO:0003677
GO:0003678 GO:0005524 GO:0006281 GO:0016787 |
| AF-A0A550HTD9-F1-model_v4 | DNA polymerase II small subunit (Pol II) (EC 2.7.7.7) (Exodeoxyribonuclease small subunit) (EC 3.1.11.1) | 0.7891 | 36 | 114 |
GO:0003677
GO:0003887 GO:0006271 GO:0006308 GO:0008310 GO:0042575 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar