F478073

General Info

Members Datasets Scaffolds Average Seq Length
733 296 733 128

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_101876898|Ga0075431_1018768981
Length 154
Sequence VARKQSPARLVVALSVAACLAIFLLYTSIAGGGTVSLRPSQLSGHTGTAQLFGVVLAPVSGDAHAGGLRFRLRDIDGKATVPVVYRGSVPDLFRVGRDVYLKGRMQNGVFIGDRDSLVTKCPSKYQPAKPAVRASGPGEGVWGNREVPPAHSAY

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
188 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
189 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
190 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
191 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
193 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
194 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
195 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
196 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
205 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
206 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
207 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
208 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
209 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
210 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
213 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
214 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
217 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
218 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
219 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
220 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
221 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
224 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
225 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
226 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
227 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
228 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
229 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
230 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
231 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
232 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
233 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
234 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
235 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
236 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
237 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
238 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
239 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
240 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
241 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
242 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
243 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
244 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
245 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
246 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
247 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
248 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
249 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
250 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
251 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
252 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
253 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
254 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
255 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
256 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
257 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
258 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
259 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
260 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
261 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
262 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
263 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
264 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
265 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
266 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
267 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
268 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
269 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
270 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
271 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
272 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
273 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
274 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
275 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
276 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
277 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
280 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
281 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
282 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
283 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
284 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
285 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
286 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
287 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
288 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
289 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
290 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
291 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
292 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
293 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
294 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
295 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
296 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0.68
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.68
Nodule 0
Rhizoplane 11.73
Rhizosphere 87.04
Stem 0
Stem Tuber 0
Unclassified 0.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10045839 3300001991 Unclassified 884
2 JGI24744J21845_10000622 3300002077 Bacteria 6458
3 JGI25407J50210_10146073 3300003373 Unclassified 582
4 JGI25405J52794_10083919 3300003911 Unclassified 702
5 Ga0070676_10190990 3300005328 Bacteria 1337
6 Ga0070683_100003106 3300005329 Bacteria 13377
7 Ga0070683_100137920 3300005329 Unclassified 2310
8 Ga0070683_100507905 3300005329 Bacteria 1152
9 Ga0070683_100619576 3300005329 Bacteria 1036
10 Ga0070683_100937589 3300005329 Bacteria 831
11 Ga0070683_100945383 3300005329 Bacteria 827
12 Ga0070690_100007009 3300005330 Bacteria 6425
13 Ga0070690_100007646 3300005330 Bacteria 6193
14 Ga0070690_100589022 3300005330 Bacteria 843
15 Ga0070670_101605766 3300005331 Unclassified 598
16 Ga0068869_100229275 3300005334 Bacteria 1475
17 Ga0068869_101011290 3300005334 Bacteria 724
18 Ga0070680_100049628 3300005336 Bacteria 3422
19 Ga0070680_100207710 3300005336 Bacteria 1652
20 Ga0070680_100272761 3300005336 Bacteria 1432
21 Ga0070680_101344892 3300005336 Unclassified 618
22 Ga0070682_100007893 3300005337 Bacteria 5990
23 Ga0070682_100214642 3300005337 Bacteria 1366
24 Ga0070682_100809864 3300005337 Bacteria 762
25 Ga0068868_100042584 3300005338 Bacteria 3545
26 Ga0068868_100160946 3300005338 Bacteria 1854
27 Ga0068868_100925271 3300005338 Bacteria 794
28 Ga0068868_101460763 3300005338 Bacteria 639
29 Ga0068868_101712880 3300005338 Bacteria 592
30 Ga0068868_101941983 3300005338 Unclassified 558
31 Ga0070660_100014662 3300005339 Bacteria 5654
32 Ga0070660_100016236 3300005339 Bacteria 5399
33 Ga0070660_100088499 3300005339 Bacteria 2439
34 Ga0070689_100001929 3300005340 Bacteria 13414
35 Ga0070689_100427957 3300005340 Bacteria 1123
36 Ga0070691_10014538 3300005341 Bacteria 3613
37 Ga0070691_10015360 3300005341 Bacteria 3519
38 Ga0070691_10060012 3300005341 Unclassified 1828
39 Ga0070691_10264227 3300005341 Bacteria 928
40 Ga0070687_100016945 3300005343 Bacteria 3338
41 Ga0070687_100143302 3300005343 Bacteria 1394
42 Ga0070687_100258891 3300005343 Bacteria 1085
43 Ga0070692_10003456 3300005345 Bacteria 6406
44 Ga0070692_10016755 3300005345 Bacteria 3490
45 Ga0070668_100054346 3300005347 Bacteria 3089
46 Ga0070668_100955672 3300005347 Unclassified 768
47 Ga0070669_100055884 3300005353 Bacteria 2893
48 Ga0070675_100138657 3300005354 Bacteria 2077
49 Ga0070675_100434258 3300005354 Bacteria 1176
50 Ga0070671_100138439 3300005355 Bacteria 2053
51 Ga0070671_100343898 3300005355 Unclassified 1273
52 Ga0070674_100004383 3300005356 Bacteria 8043
53 Ga0070674_100014406 3300005356 Bacteria 4917
54 Ga0070674_101976768 3300005356 Unclassified 531
55 Ga0070673_100012370 3300005364 Bacteria 5857
56 Ga0070673_100173255 3300005364 Bacteria 1843
57 Ga0070673_100367597 3300005364 Unclassified 1280
58 Ga0070673_101651676 3300005364 Unclassified 606
59 Ga0070688_100027090 3300005365 Bacteria 3411
60 Ga0070688_100288853 3300005365 Bacteria 1181
61 Ga0070688_100385078 3300005365 Bacteria 1034
62 Ga0070659_100003504 3300005366 Bacteria 11176
63 Ga0070659_100020196 3300005366 Bacteria 5058
64 Ga0070659_100250168 3300005366 Bacteria 1469
65 Ga0070659_100272169 3300005366 Bacteria 1407
66 Ga0070659_100482819 3300005366 Bacteria 1055
67 Ga0070667_100360629 3300005367 Bacteria 1317
68 Ga0070667_100797232 3300005367 Bacteria 877
69 Ga0070703_10042315 3300005406 Bacteria 1424
70 Ga0070709_10006351 3300005434 Bacteria 6436
71 Ga0070714_100432599 3300005435 Unclassified 1248
72 Ga0070714_101321508 3300005435 Unclassified 704
73 Ga0070713_100068611 3300005436 Bacteria 2988
74 Ga0070710_10004670 3300005437 Bacteria 6478
75 Ga0070710_11258686 3300005437 Unclassified 549
76 Ga0070701_10002084 3300005438 Bacteria 7592
77 Ga0070701_10080816 3300005438 Bacteria 1759
78 Ga0070701_10140634 3300005438 Unclassified 1380
79 Ga0070711_100174269 3300005439 Bacteria 1642
80 Ga0070705_100071436 3300005440 Bacteria 2099
81 Ga0070700_100196915 3300005441 Bacteria 1413
82 Ga0070700_100447030 3300005441 Unclassified 983
83 Ga0070700_100577814 3300005441 Bacteria 877
84 Ga0070694_100006339 3300005444 Bacteria 7178
85 Ga0070694_100015580 3300005444 Bacteria 4777
86 Ga0070663_100009824 3300005455 Bacteria 5945
87 Ga0070663_100478178 3300005455 Bacteria 1031
88 Ga0070663_100688211 3300005455 Bacteria 868
89 Ga0070678_100001355 3300005456 Bacteria 13027
90 Ga0070678_100024433 3300005456 Bacteria 4045
91 Ga0070678_100041323 3300005456 Bacteria 3268
92 Ga0070678_100289181 3300005456 Bacteria 1389
93 Ga0070678_100905202 3300005456 Bacteria 807
94 Ga0070662_100014629 3300005457 Bacteria 5246
95 Ga0070662_100032138 3300005457 Bacteria 3687
96 Ga0070662_100066548 3300005457 Unclassified 2644
97 Ga0070662_100568910 3300005457 Viruses 951
98 Ga0070681_10281295 3300005458 Bacteria 1574
99 Ga0070681_10628878 3300005458 Bacteria 988
100 Ga0070681_11988529 3300005458 Bacteria 509
101 Ga0068867_100004104 3300005459 Bacteria 10238
102 Ga0070685_10060121 3300005466 Bacteria 2221
103 Ga0070685_11477932 3300005466 Unclassified 523
104 Ga0070706_100015559 3300005467 Bacteria 7027
105 Ga0070698_100012651 3300005471 Bacteria 8935
106 Ga0070698_100018972 3300005471 Bacteria 7234
107 Ga0070679_100025017 3300005530 Bacteria 5854
108 Ga0070679_100100735 3300005530 Bacteria 2875
109 Ga0070679_100139700 3300005530 Bacteria 2403
110 Ga0070679_100145965 3300005530 Bacteria 2344
111 Ga0070679_100285032 3300005530 Bacteria 1604
112 Ga0070679_100481822 3300005530 Unclassified 1185
113 Ga0070679_101460179 3300005530 Bacteria 630
114 Ga0070684_100059385 3300005535 Bacteria 3343
115 Ga0070684_100190116 3300005535 Bacteria 1868
116 Ga0070684_100955018 3300005535 Bacteria 804
117 Ga0068853_100003775 3300005539 Bacteria 11609
118 Ga0068853_100067026 3300005539 Bacteria 3118
119 Ga0068853_100418115 3300005539 Bacteria 1257
120 Ga0068853_100471891 3300005539 Unclassified 1182
121 Ga0068853_100609799 3300005539 Unclassified 1037
122 Ga0070672_100340238 3300005543 Bacteria 1278
123 Ga0070686_100272113 3300005544 Bacteria 1246
124 Ga0070695_100006793 3300005545 Bacteria 6774
125 Ga0070695_100093867 3300005545 Unclassified 2008
126 Ga0070695_100917705 3300005545 Viruses 708
127 Ga0070695_101184591 3300005545 Bacteria 628
128 Ga0070696_100008063 3300005546 Bacteria 7039
129 Ga0070696_100013726 3300005546 Bacteria 5440
130 Ga0070696_100016796 3300005546 Bacteria 4937
131 Ga0070696_100081569 3300005546 Bacteria 2292
132 Ga0070696_101531295 3300005546 Unclassified 571
133 Ga0070693_100009252 3300005547 Bacteria 4894
134 Ga0070693_100109962 3300005547 Bacteria 1694
135 Ga0070693_100221042 3300005547 Unclassified 1241
136 Ga0070665_100229666 3300005548 Bacteria 1856
137 Ga0070704_100017949 3300005549 Bacteria 4513
138 Ga0070704_100055926 3300005549 Bacteria 2799
139 Ga0070704_101287460 3300005549 Bacteria 668
140 Ga0070704_101468867 3300005549 Bacteria 626
141 Ga0068855_100039995 3300005563 Bacteria 5566
142 Ga0068855_100040250 3300005563 Bacteria 5547
143 Ga0068855_100329890 3300005563 Bacteria 1685
144 Ga0068855_100363210 3300005563 Bacteria 1593
145 Ga0068855_100699520 3300005563 Bacteria 1085
146 Ga0068855_100746606 3300005563 Bacteria 1044
147 Ga0070664_100482268 3300005564 Bacteria 1141
148 Ga0068857_100106802 3300005577 Bacteria 2514
149 Ga0068854_100032576 3300005578 Bacteria 3627
150 Ga0068854_100046824 3300005578 Bacteria 3080
151 Ga0068854_100623591 3300005578 Unclassified 923
152 Ga0068854_101765634 3300005578 Unclassified 567
153 Ga0068856_100007081 3300005614 Bacteria 10950
154 Ga0068856_100607644 3300005614 Bacteria 1114
155 Ga0068856_101594374 3300005614 Bacteria 666
156 Ga0068856_101634763 3300005614 Viruses 657
157 Ga0070702_100007484 3300005615 Bacteria 5233
158 Ga0070702_100021016 3300005615 Bacteria 3428
159 Ga0070702_100077498 3300005615 Bacteria 1981
160 Ga0070702_101076032 3300005615 Unclassified 641
161 Ga0068852_100327449 3300005616 Bacteria 1490
162 Ga0068852_100383002 3300005616 Viruses 1380
163 Ga0068852_100597961 3300005616 Bacteria 1107
164 Ga0068859_100120993 3300005617 Bacteria 2684
165 Ga0068859_100483423 3300005617 Bacteria 1334
166 Ga0068864_100081045 3300005618 Bacteria 2845
167 Ga0068866_10012434 3300005718 Bacteria 3708
168 Ga0068866_10013230 3300005718 Bacteria 3614
169 Ga0068861_100003381 3300005719 Bacteria 10580
170 Ga0068861_100018958 3300005719 Bacteria 4907
171 Ga0068861_100077252 3300005719 Bacteria 2597
172 Ga0068861_100295761 3300005719 Bacteria 1400
173 Ga0068861_100634562 3300005719 Bacteria 985
174 Ga0068870_11226170 3300005840 Unclassified 544
175 Ga0068858_100550596 3300005842 Bacteria 1117
176 Ga0068860_100475495 3300005843 Bacteria 1245
177 Ga0068862_100069889 3300005844 Bacteria 3031
178 Ga0068862_100479816 3300005844 Bacteria 1177
179 Ga0068862_100702218 3300005844 Bacteria 980
180 Ga0081455_10005481 3300005937 Bacteria 13915
181 Ga0081455_10052374 3300005937 Bacteria 3495
182 Ga0081538_10000544 3300005981 Bacteria 41533
183 Ga0081538_10005013 3300005981 Bacteria 12060
184 Ga0081538_10007205 3300005981 Bacteria 9655
185 Ga0081538_10212254 3300005981 Unclassified 779
186 Ga0081540_1002081 3300005983 Bacteria 16689
187 Ga0081540_1010083 3300005983 Bacteria 6431
188 Ga0081540_1020045 3300005983 Bacteria 4037
189 Ga0070717_10159358 3300006028 Bacteria 1957
190 Ga0070717_10355180 3300006028 Bacteria 1311
191 Ga0075365_10088285 3300006038 Bacteria 2109
192 Ga0075432_10007341 3300006058 Bacteria 3752
193 Ga0070715_10118432 3300006163 Bacteria 1259
194 Ga0070716_100295463 3300006173 Bacteria 1124
195 Ga0070716_100700007 3300006173 Bacteria 774
196 Ga0070716_101180602 3300006173 Unclassified 614
197 Ga0070712_100016882 3300006175 Bacteria 4721
198 Ga0070712_100567015 3300006175 Bacteria 958
199 Ga0075367_10129912 3300006178 Bacteria 1557
200 Ga0097621_100005876 3300006237 Bacteria 8669
201 Ga0097621_100241507 3300006237 Bacteria 1579
202 Ga0097621_100785022 3300006237 Unclassified 882
203 Ga0068871_100138006 3300006358 Bacteria 2072
204 Ga0075428_100285345 3300006844 Bacteria 1776
205 Ga0075431_100006169 3300006847 Bacteria 11895
206 Ga0075431_100278062 3300006847 Bacteria 1695
207 Ga0075431_101876898 3300006847 Unclassified 555
208 Ga0075434_100098662 3300006871 Bacteria 2926
209 Ga0075434_100131466 3300006871 Bacteria 2522
210 Ga0075434_100276366 3300006871 Bacteria 1699
211 Ga0075429_100038949 3300006880 Bacteria 4137
212 Ga0068865_100008007 3300006881 Bacteria 6525
213 Ga0068865_100016053 3300006881 Bacteria 4784
214 Ga0068865_100292648 3300006881 Bacteria 1300
215 Ga0068865_101401149 3300006881 Unclassified 624
216 Ga0075436_100011666 3300006914 Bacteria 6029
217 Ga0097620_100120997 3300006931 Bacteria 2684
218 Ga0097620_100483446 3300006931 Bacteria 1334
219 Ga0075435_100054169 3300007076 Bacteria 3237
220 Ga0075435_100893229 3300007076 Bacteria 775
221 Ga0075435_101228836 3300007076 Bacteria 656
222 Ga0105250_10187788 3300009092 Bacteria 869
223 Ga0105240_10388353 3300009093 Bacteria 1575
224 Ga0105240_10828223 3300009093 Bacteria 1000
225 Ga0111539_10129955 3300009094 Bacteria 2950
226 Ga0111539_10442063 3300009094 Bacteria 1514
227 Ga0111539_11489475 3300009094 Bacteria 785
228 Ga0105245_10026959 3300009098 Bacteria 5060
229 Ga0105245_10033334 3300009098 Bacteria 4564
230 Ga0105245_10038520 3300009098 Bacteria 4254
231 Ga0105245_10039907 3300009098 Bacteria 4180
232 Ga0105245_10431354 3300009098 Unclassified 1323
233 Ga0105245_10676799 3300009098 Bacteria 1064
234 Ga0114129_10118719 3300009147 Bacteria 3643
235 Ga0105243_10068354 3300009148 Bacteria 2863
236 Ga0105243_10106939 3300009148 Bacteria 2333
237 Ga0105243_10403366 3300009148 Bacteria 1271
238 Ga0105243_11004036 3300009148 Unclassified 837
239 Ga0105241_10225946 3300009174 Bacteria 1576
240 Ga0105242_10009803 3300009176 Bacteria 7343
241 Ga0105242_10049217 3300009176 Bacteria 3429
242 Ga0105242_10477372 3300009176 Bacteria 1181
243 Ga0105242_10518972 3300009176 Bacteria 1136
244 Ga0105242_10750173 3300009176 Bacteria 961
245 Ga0105248_10051290 3300009177 Bacteria 4630
246 Ga0105248_10484933 3300009177 Unclassified 1393
247 Ga0105248_11104389 3300009177 Bacteria 896
248 Ga0105237_10586598 3300009545 Bacteria 1121
249 Ga0105237_10803775 3300009545 Bacteria 947
250 Ga0105238_11287724 3300009551 Unclassified 757
251 Ga0105249_10017004 3300009553 Bacteria 6453
252 Ga0105249_10017306 3300009553 Bacteria 6399
253 Ga0105249_10269560 3300009553 Bacteria 1695
254 Ga0105249_11014088 3300009553 Bacteria 899
255 Ga0105239_10039565 3300010375 Bacteria 5166
256 Ga0105239_10054523 3300010375 Bacteria 4386
257 Ga0105239_10069819 3300010375 Bacteria 3859
258 Ga0105239_10111319 3300010375 Bacteria 3035
259 Ga0105239_10119731 3300010375 Bacteria 2922
260 Ga0105239_10326454 3300010375 Bacteria 1731
261 Ga0105239_10651944 3300010375 Unclassified 1203
262 Ga0105246_10342201 3300011119 Unclassified 1223
263 Ga0105246_11510152 3300011119 Unclassified 631
264 Ga0157338_1038168 3300012515 Unclassified 643
265 Ga0157371_10059211 3300013102 Bacteria 2715
266 Ga0157371_10231855 3300013102 Bacteria 1327
267 Ga0157369_11048051 3300013105 Unclassified 834
268 Ga0157369_11649568 3300013105 Bacteria 652
269 Ga0157374_10481176 3300013296 Unclassified 1245
270 Ga0157378_10500455 3300013297 Bacteria 1214
271 Ga0163162_10111381 3300013306 Unclassified 2835
272 Ga0163162_10194728 3300013306 Bacteria 2155
273 Ga0157372_10059494 3300013307 Bacteria 4273
274 Ga0157372_10481095 3300013307 Bacteria 1447
275 Ga0157375_10012591 3300013308 Bacteria 7506
276 Ga0157375_10827290 3300013308 Unclassified 1074
277 Ga0157375_12389446 3300013308 Bacteria 631
278 Ga0163163_11110528 3300014325 Bacteria 854
279 Ga0157380_11215358 3300014326 Bacteria 798
280 Ga0182008_10084232 3300014497 Bacteria 1566
281 Ga0157377_10130402 3300014745 Unclassified 1535
282 Ga0157377_11257723 3300014745 Unclassified 576
283 Ga0157379_10426745 3300014968 Bacteria 1221
284 Ga0163161_10028037 3300017792 Bacteria 3997
285 Ga0163161_10416536 3300017792 Bacteria 1080
286 Ga0197907_10551217 3300020069 Bacteria 603
287 Ga0206354_10514906 3300020081 Bacteria 3714
288 Ga0206354_11598535 3300020081 Bacteria 1445
289 Ga0206353_10357655 3300020082 Bacteria 2445
290 Ga0206353_10693181 3300020082 Bacteria 4202
291 Ga0207656_10332846 3300025321 Unclassified 756
292 Ga0207653_10009818 3300025885 Bacteria 2985
293 Ga0207682_10090035 3300025893 Bacteria 1329
294 Ga0207692_10043747 3300025898 Bacteria 2230
295 Ga0207642_10063558 3300025899 Bacteria 1727
296 Ga0207688_10052488 3300025901 Bacteria 2285
297 Ga0207688_10095138 3300025901 Bacteria 1714
298 Ga0207680_10075491 3300025903 Bacteria 2102
299 Ga0207685_10083663 3300025905 Bacteria 1327
300 Ga0207699_10082672 3300025906 Unclassified 1995
301 Ga0207684_10014015 3300025910 Bacteria 6925
302 Ga0207684_10475833 3300025910 Unclassified 1071
303 Ga0207707_10064009 3300025912 Bacteria 3200
304 Ga0207707_10085432 3300025912 Bacteria 2757
305 Ga0207707_10087336 3300025912 Bacteria 2725
306 Ga0207707_10556095 3300025912 Bacteria 974
307 Ga0207707_11050666 3300025912 Unclassified 666
308 Ga0207671_10407307 3300025914 Bacteria 1082
309 Ga0207671_11251326 3300025914 Unclassified 579
310 Ga0207693_10000778 3300025915 Bacteria 28589
311 Ga0207693_10431284 3300025915 Bacteria 1030
312 Ga0207663_10144465 3300025916 Bacteria 1661
313 Ga0207663_11181720 3300025916 Bacteria 616
314 Ga0207660_10043173 3300025917 Bacteria 3168
315 Ga0207660_10079261 3300025917 Bacteria 2409
316 Ga0207660_10175083 3300025917 Bacteria 1663
317 Ga0207662_10143107 3300025918 Bacteria 1516
318 Ga0207662_10235096 3300025918 Bacteria 1198
319 Ga0207657_10012421 3300025919 Bacteria 8414
320 Ga0207657_10053411 3300025919 Bacteria 3500
321 Ga0207657_10120872 3300025919 Bacteria 2155
322 Ga0207657_10240791 3300025919 Bacteria 1444
323 Ga0207652_10018732 3300025921 Bacteria 5681
324 Ga0207652_10102648 3300025921 Bacteria 2528
325 Ga0207652_10118863 3300025921 Bacteria 2350
326 Ga0207652_10119579 3300025921 Bacteria 2343
327 Ga0207652_10137085 3300025921 Bacteria 2186
328 Ga0207652_10182128 3300025921 Bacteria 1888
329 Ga0207652_11099849 3300025921 Bacteria 695
330 Ga0207646_10608923 3300025922 Bacteria 980
331 Ga0207681_10234729 3300025923 Bacteria 1425
332 Ga0207694_10309847 3300025924 Bacteria 1301
333 Ga0207659_10042011 3300025926 Bacteria 3204
334 Ga0207659_10263969 3300025926 Unclassified 1402
335 Ga0207687_10018420 3300025927 Bacteria 4609
336 Ga0207687_10033989 3300025927 Bacteria 3461
337 Ga0207687_10152141 3300025927 Bacteria 1767
338 Ga0207687_10728954 3300025927 Viruses 843
339 Ga0207700_10057007 3300025928 Bacteria 2944
340 Ga0207664_10803203 3300025929 Unclassified 846
341 Ga0207644_10024038 3300025931 Bacteria 4179
342 Ga0207644_10179775 3300025931 Bacteria 1657
343 Ga0207644_10781812 3300025931 Bacteria 798
344 Ga0207690_10071533 3300025932 Bacteria 2392
345 Ga0207690_10083304 3300025932 Bacteria 2239
346 Ga0207690_10245659 3300025932 Bacteria 1380
347 Ga0207690_10354611 3300025932 Bacteria 1161
348 Ga0207690_10845119 3300025932 Bacteria 758
349 Ga0207706_10011465 3300025933 Bacteria 8073
350 Ga0207706_10015721 3300025933 Bacteria 6840
351 Ga0207706_10047569 3300025933 Bacteria 3794
352 Ga0207686_10069082 3300025934 Bacteria 2265
353 Ga0207686_10234476 3300025934 Bacteria 1332
354 Ga0207686_10648946 3300025934 Bacteria 835
355 Ga0207709_10031487 3300025935 Bacteria 3099
356 Ga0207709_10048847 3300025935 Bacteria 2580
357 Ga0207709_10192125 3300025935 Bacteria 1451
358 Ga0207670_10174928 3300025936 Bacteria 1612
359 Ga0207670_10528441 3300025936 Bacteria 961
360 Ga0207669_10003176 3300025937 Bacteria 7092
361 Ga0207669_10038933 3300025937 Bacteria 2743
362 Ga0207669_10271584 3300025937 Bacteria 1274
363 Ga0207669_10538121 3300025937 Bacteria 940
364 Ga0207704_10018471 3300025938 Bacteria 3640
365 Ga0207704_10025797 3300025938 Bacteria 3213
366 Ga0207665_10025299 3300025939 Bacteria 3916
367 Ga0207691_10017123 3300025940 Bacteria 6875
368 Ga0207691_10398484 3300025940 Bacteria 1174
369 Ga0207691_10458851 3300025940 Bacteria 1084
370 Ga0207691_11022940 3300025940 Unclassified 689
371 Ga0207711_10221812 3300025941 Bacteria 1729
372 Ga0207711_10222751 3300025941 Bacteria 1726
373 Ga0207689_10125421 3300025942 Bacteria 2112
374 Ga0207689_10234974 3300025942 Bacteria 1515
375 Ga0207689_10268418 3300025942 Bacteria 1412
376 Ga0207689_11166964 3300025942 Unclassified 649
377 Ga0207689_11257855 3300025942 Unclassified 622
378 Ga0207661_10030813 3300025944 Bacteria 4136
379 Ga0207661_10042448 3300025944 Bacteria 3585
380 Ga0207661_10086838 3300025944 Bacteria 2597
381 Ga0207661_10856073 3300025944 Unclassified 837
382 Ga0207661_11050542 3300025944 Unclassified 750
383 Ga0207661_11682482 3300025944 Bacteria 580
384 Ga0207679_10372925 3300025945 Bacteria 1249
385 Ga0207679_10380933 3300025945 Bacteria 1237
386 Ga0207667_10054229 3300025949 Bacteria 4217
387 Ga0207667_10114531 3300025949 Bacteria 2779
388 Ga0207667_10217497 3300025949 Bacteria 1957
389 Ga0207667_10296724 3300025949 Bacteria 1651
390 Ga0207651_10011111 3300025960 Bacteria 5024
391 Ga0207651_10081749 3300025960 Bacteria 2330
392 Ga0207651_10166261 3300025960 Bacteria 1735
393 Ga0207712_10059287 3300025961 Bacteria 2709
394 Ga0207712_10328821 3300025961 Unclassified 1264
395 Ga0207712_10387990 3300025961 Bacteria 1171
396 Ga0207712_11525472 3300025961 Bacteria 599
397 Ga0207668_10579452 3300025972 Bacteria 975
398 Ga0207668_10634384 3300025972 Bacteria 934
399 Ga0207668_11051881 3300025972 Bacteria 729
400 Ga0207640_10041232 3300025981 Bacteria 2935
401 Ga0207640_10314602 3300025981 Bacteria 1244
402 Ga0207640_10587548 3300025981 Bacteria 941
403 Ga0207658_10412003 3300025986 Unclassified 1190
404 Ga0207677_10272810 3300026023 Bacteria 1384
405 Ga0207677_10316876 3300026023 Bacteria 1294
406 Ga0207677_11548282 3300026023 Unclassified 613
407 Ga0207639_10015667 3300026041 Bacteria 5349
408 Ga0207639_10098640 3300026041 Bacteria 2355
409 Ga0207639_10296368 3300026041 Bacteria 1428
410 Ga0207639_10981831 3300026041 Bacteria 791
411 Ga0207678_10012714 3300026067 Bacteria 7392
412 Ga0207708_10003195 3300026075 Bacteria 12075
413 Ga0207708_10080217 3300026075 Bacteria 2508
414 Ga0207708_10185951 3300026075 Bacteria 1651
415 Ga0207708_10700649 3300026075 Unclassified 866
416 Ga0207702_10276359 3300026078 Bacteria 1586
417 Ga0207702_11042627 3300026078 Viruses 811
418 Ga0207702_11066949 3300026078 Bacteria 802
419 Ga0207702_11194741 3300026078 Bacteria 755
420 Ga0207648_10002086 3300026089 Bacteria 21760
421 Ga0207648_10004570 3300026089 Bacteria 14187
422 Ga0207648_10301583 3300026089 Bacteria 1437
423 Ga0207648_10361423 3300026089 Bacteria 1310
424 Ga0207648_11974008 3300026089 Bacteria 545
425 Ga0207676_10063585 3300026095 Bacteria 2931
426 Ga0207674_10066775 3300026116 Bacteria 3622
427 Ga0207675_100002688 3300026118 Bacteria 17542
428 Ga0207675_100015447 3300026118 Bacteria 7122
429 Ga0207675_100046297 3300026118 Bacteria 4063
430 Ga0207683_10000041 3300026121 Bacteria 94017
431 Ga0207683_10036784 3300026121 Bacteria 4263
432 Ga0207683_10111619 3300026121 Bacteria 2448
433 Ga0207683_10312670 3300026121 Bacteria 1438
434 Ga0207683_10863968 3300026121 Bacteria 840
435 Ga0207698_10207669 3300026142 Bacteria 1759
436 Ga0207698_10647340 3300026142 Viruses 1046
437 Ga0209983_1122351 3300027665 Unclassified 594
438 Ga0209998_10010246 3300027717 Bacteria 1941
439 Ga0207428_10000892 3300027907 Bacteria 33470
440 Ga0207428_10002067 3300027907 Bacteria 20252
441 Ga0268266_10896920 3300028379 Unclassified 857
442 Ga0268265_10218546 3300028380 Bacteria 1666
443 Ga0268265_10561831 3300028380 Bacteria 1085
444 Ga0307408_100101790 3300031548 Bacteria 2190
445 Ga0307405_10167921 3300031731 Bacteria 1562
446 Ga0307406_11039426 3300031901 Bacteria 704
447 Ga0307409_100988213 3300031995 Bacteria 859
448 Ga0307416_100202656 3300032002 Bacteria 1884
449 Ga0307416_101827999 3300032002 Bacteria 711
450 Ga0307415_100065331 3300032126 Bacteria 2535
451 Ga0307415_100088096 3300032126 Bacteria 2239
452 Ga0373959_0191654 3300034820 Unclassified 536
453 Ga0373951_0152433 3300035091 Unclassified 649
454 Ga0373932_0038275 3300035112 Bacteria 1371
455 Ga0373936_0142413 3300035113 Bacteria 1036
456 Ga0373941_0219299 3300035115 Bacteria 730
457 Ga0373945_0018054 3300035116 Bacteria 2397
458 Ga0373960_0093402 3300035121 Unclassified 965
459 Ga0373943_0068627 3300035170 Bacteria 1790
460 Ga0373943_0580498 3300035170 Bacteria 659
461 Ga0373961_0129816 3300035241 Bacteria 843
462 Ga0373947_0005440 3300035725 Bacteria 7430
463 Ga0373925_0252649 3300037068 Unclassified 1414
464 Ga0395899_0006128 3300037312 Bacteria 9319
465 Ga0395899_0010821 3300037312 Bacteria 6993
466 Ga0395899_0018968 3300037312 Bacteria 5227
467 Ga0395899_0116376 3300037312 Bacteria 1918
468 Ga0395899_0257562 3300037312 Unclassified 1195
469 Ga0395899_0264069 3300037312 Bacteria 1176
470 Ga0395900_0002962 3300037418 Bacteria 18481
471 Ga0395900_0010594 3300037418 Bacteria 9428
472 Ga0395900_0012510 3300037418 Bacteria 8680
473 Ga0395900_0039626 3300037418 Bacteria 4854
474 Ga0395900_0115891 3300037418 Bacteria 2749
475 Ga0395900_0263878 3300037418 Archaea 1719
476 Ga0395900_0990870 3300037418 Viruses 761
477 Ga0395898_0001595 3300037466 Bacteria 30933
478 Ga0395898_0001862 3300037466 Bacteria 27022
479 Ga0395898_0008942 3300037466 Bacteria 10550
480 Ga0395898_0192927 3300037466 Bacteria 1946
481 Ga0395898_0269908 3300037466 Bacteria 1622
482 Ga0395898_0311853 3300037466 Unclassified 1501
483 Ga0395898_1171438 3300037466 Bacteria 700
484 Ga0395898_1563840 3300037466 Unclassified 584
485 Ga0395905_0001862 3300037471 Bacteria 24295
486 Ga0395905_0007290 3300037471 Bacteria 11023
487 Ga0395905_0012603 3300037471 Bacteria 8134
488 Ga0395905_0039785 3300037471 Bacteria 4412
489 Ga0395905_0092114 3300037471 Bacteria 2842
490 Ga0395905_0107670 3300037471 Bacteria 2617
491 Ga0395905_0915276 3300037471 Archaea 780
492 Ga0395901_0001901 3300038443 Bacteria 21558
493 Ga0395901_0006362 3300038443 Bacteria 11967
494 Ga0395901_0009061 3300038443 Bacteria 10077
495 Ga0395901_0013690 3300038443 Bacteria 8245
496 Ga0395901_0034065 3300038443 Bacteria 5259
497 Ga0395901_0121702 3300038443 Bacteria 2742
498 Ga0395901_0154480 3300038443 Unclassified 2410
499 Ga0395901_0624181 3300038443 Bacteria 1084
500 Ga0395901_0669118 3300038443 Unclassified 1039
501 Ga0395901_0783982 3300038443 Bacteria 943
502 Ga0395901_0792224 3300038443 Unclassified 937
503 Ga0395901_0887697 3300038443 Unclassified 874
504 Ga0242420_020251 3300038996 Bacteria 1182
505 Ga0451789_0958954 3300041443 Bacteria 687
506 Ga0451797_0838146 3300041453 Unclassified 548
507 Ga0451798_0067737 3300041458 Bacteria 734
508 Ga0451800_0962065 3300041459 Bacteria 590
509 Ga0451847_0074877 3300041503 Bacteria 578
510 Ga0451849_1263875 3300041505 Bacteria 571
511 Ga0451853_0324016 3300041512 Bacteria 978
512 Ga0451853_1845315 3300041512 Bacteria 558
513 Ga0439448_0001968 3300042005 Bacteria 5492
514 Ga0439448_0024047 3300042005 Bacteria 1903
515 Ga0466963_0465383 3300044694 Bacteria 892
516 Ga0466960_0310707 3300044901 Bacteria 890
517 Ga0451576_0742727 3300045051 Bacteria 1031
518 Ga0451576_1511440 3300045051 Unclassified 697
519 Ga0466958_0000480 3300045836 Bacteria 16712
520 Ga0466967_0034221 3300045976 Bacteria 4310
521 Ga0466967_0389284 3300045976 Bacteria 1355
522 Ga0466967_0425673 3300045976 Bacteria 1294
523 Ga0466967_1160218 3300045976 Unclassified 770
524 Ga0495592_0526491 3300046454 Unclassified 730
525 Ga0495592_0552510 3300046454 Bacteria 708
526 Ga0495592_0738792 3300046454 Unclassified 589
527 Ga0495603_0002347 3300046455 Bacteria 11109
528 Ga0495603_0043669 3300046455 Bacteria 2676
529 Ga0495603_0162306 3300046455 Bacteria 1296
530 Ga0495603_0211194 3300046455 Bacteria 1121
531 Ga0495603_0305353 3300046455 Bacteria 914
532 Ga0495629_0132610 3300046459 Bacteria 1735
533 Ga0495629_0490397 3300046459 Unclassified 829
534 Ga0495641_0063952 3300046461 Bacteria 1657
535 Ga0495641_0118037 3300046461 Bacteria 1183
536 Ga0495641_0487998 3300046461 Unclassified 561
537 Ga0495641_0564264 3300046461 Unclassified 520
538 Ga0495651_0292485 3300046462 Unclassified 1096
539 Ga0495651_0598183 3300046462 Unclassified 696
540 Ga0495653_0132255 3300046463 Bacteria 1765
541 Ga0495582_0156706 3300046473 Bacteria 1294
542 Ga0495582_0242706 3300046473 Bacteria 1032
543 Ga0495582_0875037 3300046473 Unclassified 519
544 Ga0495605_0343941 3300046474 Unclassified 626
545 Ga0495639_0176694 3300046475 Unclassified 1038
546 Ga0495662_0186743 3300046476 Bacteria 1022
547 Ga0495664_0126535 3300046477 Bacteria 1546
548 Ga0495664_0592973 3300046477 Unclassified 659
549 Ga0495584_0040909 3300046491 Bacteria 2340
550 Ga0495584_0085623 3300046491 Bacteria 1588
551 Ga0495584_0187982 3300046491 Unclassified 1050
552 Ga0495584_0270372 3300046491 Bacteria 864
553 Ga0495584_0339608 3300046491 Bacteria 763
554 Ga0495594_0045194 3300046499 Bacteria 2417
555 Ga0495594_0506557 3300046499 Bacteria 685
556 Ga0495583_0287467 3300046506 Bacteria 655
557 Ga0495616_0150105 3300046513 Bacteria 1055
558 Ga0495618_0198279 3300046514 Bacteria 1271
559 Ga0495618_0556536 3300046514 Bacteria 686
560 Ga0495628_0697699 3300046516 Unclassified 717
561 Ga0495628_0697730 3300046516 Bacteria 717
562 Ga0495628_0925357 3300046516 Unclassified 604
563 Ga0495630_0017194 3300046517 Bacteria 5295
564 Ga0495630_0396983 3300046517 Unclassified 1057
565 Ga0495631_0216644 3300046518 Unclassified 818
566 Ga0495637_0076799 3300046520 Unclassified 1338
567 Ga0495644_0049631 3300046523 Unclassified 1575
568 Ga0495644_0222683 3300046523 Unclassified 729
569 Ga0495663_0009546 3300046525 Bacteria 2692
570 Ga0495663_0038384 3300046525 Bacteria 1448
571 Ga0495666_0025960 3300046526 Bacteria 2891
572 Ga0495642_0036910 3300046528 Bacteria 1976
573 Ga0495642_0163311 3300046528 Bacteria 966
574 Ga0495640_0526130 3300046533 Unclassified 718
575 Ga0495598_0348435 3300046537 Unclassified 570
576 Ga0495598_0439402 3300046537 Unclassified 515
577 Ga0495597_0230936 3300046542 Bacteria 732
578 Ga0495622_0258470 3300046557 Bacteria 765
579 Ga0495667_0067182 3300046559 Bacteria 2343
580 Ga0495656_0141384 3300046615 Bacteria 1155
581 Ga0495656_0284636 3300046615 Unclassified 843
582 Ga0495656_0791917 3300046615 Unclassified 512
583 Ga0495634_0272164 3300046642 Bacteria 1030
584 Ga0495634_0403898 3300046642 Unclassified 811
585 Ga0495635_0067509 3300046663 Bacteria 2453
586 Ga0495635_0234895 3300046663 Bacteria 1238
587 Ga0495661_0343974 3300046665 Unclassified 736
588 Ga0495661_0582427 3300046665 Unclassified 527
589 Ga0495588_0000586 3300046674 Bacteria 17370
590 Ga0495588_0322846 3300046674 Bacteria 812
591 Ga0495588_0542631 3300046674 Bacteria 609
592 Ga0495588_0647056 3300046674 Unclassified 553
593 Ga0495657_0139457 3300046675 Unclassified 1512
594 Ga0495657_0149191 3300046675 Unclassified 1453
595 Ga0495599_0535148 3300046678 Bacteria 687
596 Ga0495647_0020286 3300046681 Bacteria 2384
597 Ga0495658_0415734 3300046683 Unclassified 858
598 Ga0495613_0145718 3300046689 Unclassified 1690
599 Ga0495670_0349269 3300046691 Bacteria 796
600 Ga0495649_0137797 3300046694 Bacteria 1286
601 Ga0495581_0133432 3300047315 Unclassified 1447
602 Ga0495581_0765311 3300047315 Unclassified 555
603 Ga0495604_0184102 3300047317 Bacteria 1460
604 Ga0495604_0319024 3300047317 Unclassified 1039
605 Ga0495636_0130097 3300047318 Bacteria 1119
606 Ga0495636_0376457 3300047318 Bacteria 673
607 Ga0495674_0434514 3300047319 Unclassified 1056
608 Ga0495674_0854402 3300047319 Unclassified 705
609 Ga0495676_0017349 3300047321 Bacteria 6367
610 Ga0495676_0128334 3300047321 Bacteria 1834
611 Ga0495676_0176869 3300047321 Bacteria 1498
612 Ga0495676_0383783 3300047321 Unclassified 934
613 Ga0495676_0581928 3300047321 Bacteria 730
614 Ga0495680_0040259 3300047322 Bacteria 3724
615 Ga0495680_0197745 3300047322 Unclassified 1443
616 Ga0495680_0270912 3300047322 Bacteria 1199
617 Ga0495680_0370546 3300047322 Bacteria 994
618 Ga0495683_0343216 3300047323 Bacteria 632
619 Ga0495677_0215977 3300047445 Unclassified 747
620 Ga0495684_0127146 3300047471 Bacteria 1917
621 Ga0495684_0160199 3300047471 Bacteria 1679
622 Ga0496100_0015996 3300048903 Bacteria 4394
623 Ga0496100_0040037 3300048903 Bacteria 2979
624 Ga0496101_0047646 3300048904 Bacteria 3078
625 Ga0496101_0050269 3300048904 Bacteria 3000
626 Ga0496101_0676087 3300048904 Bacteria 815
627 Ga0496102_0023315 3300048905 Bacteria 5495
628 Ga0496102_0038410 3300048905 Bacteria 4320
629 Ga0496102_0163633 3300048905 Bacteria 2093
630 Ga0496102_0241458 3300048905 Bacteria 1703
631 Ga0496103_0023101 3300048906 Bacteria 3749
632 Ga0496103_0073420 3300048906 Unclassified 2143
633 Ga0496103_0178207 3300048906 Bacteria 1366
634 Ga0496103_0324372 3300048906 Bacteria 990
635 Ga0496104_0002265 3300048907 Bacteria 16587
636 Ga0496104_0004320 3300048907 Bacteria 12366
637 Ga0496104_0016248 3300048907 Bacteria 6759
638 Ga0496104_0100569 3300048907 Bacteria 2768
639 Ga0496104_1011369 3300048907 Bacteria 735
640 Ga0496105_0002160 3300048908 Bacteria 14238
641 Ga0496105_0002904 3300048908 Bacteria 12573
642 Ga0496106_0036174 3300048909 Bacteria 3694
643 Ga0496106_0080895 3300048909 Bacteria 2495
644 Ga0496106_0748517 3300048909 Viruses 777
645 Ga0496107_0033312 3300048910 Bacteria 3686
646 Ga0496107_0079003 3300048910 Bacteria 2398
647 Ga0496107_0088266 3300048910 Bacteria 2264
648 Ga0496107_0539444 3300048910 Unclassified 864
649 Ga0496108_0001671 3300048911 Bacteria 17595
650 Ga0496108_0010509 3300048911 Bacteria 7518
651 Ga0496108_0050702 3300048911 Bacteria 3475
652 Ga0496108_0323732 3300048911 Bacteria 1344
653 Ga0496108_0385543 3300048911 Bacteria 1224
654 Ga0496108_0403584 3300048911 Unclassified 1194
655 Ga0496108_0524798 3300048911 Bacteria 1034
656 Ga0496109_0001133 3300048912 Bacteria 22156
657 Ga0496109_0032399 3300048912 Bacteria 4698
658 Ga0496109_0052942 3300048912 Bacteria 3700
659 Ga0496109_0089878 3300048912 Bacteria 2840
660 Ga0496109_0205067 3300048912 Bacteria 1854
661 Ga0496109_0239526 3300048912 Bacteria 1707
662 Ga0496109_0358910 3300048912 Bacteria 1377
663 Ga0496109_0822957 3300048912 Unclassified 866
664 Ga0496109_0950440 3300048912 Unclassified 797
665 Ga0496109_1217543 3300048912 Bacteria 689
666 Ga0496110_0000467 3300048913 Bacteria 27484
667 Ga0496110_0000686 3300048913 Bacteria 23305
668 Ga0496110_0014346 3300048913 Bacteria 6575
669 Ga0496110_0025179 3300048913 Bacteria 5082
670 Ga0496110_0368741 3300048913 Bacteria 1308
671 Ga0496110_0618336 3300048913 Unclassified 982
672 Ga0496110_1361215 3300048913 Bacteria 619
673 Ga0496110_1477336 3300048913 Bacteria 589
674 Ga0496111_0001328 3300048914 Bacteria 13918
675 Ga0496111_0003353 3300048914 Bacteria 9906
676 Ga0496111_0003433 3300048914 Bacteria 9802
677 Ga0496111_0080744 3300048914 Bacteria 2373
678 Ga0496111_0086896 3300048914 Bacteria 2288
679 Ga0496111_0136795 3300048914 Bacteria 1815
680 Ga0496111_0520437 3300048914 Bacteria 875
681 Ga0496111_0677809 3300048914 Bacteria 751
682 Ga0496111_1067844 3300048914 Unclassified 577
683 Ga0496112_0010541 3300048915 Bacteria 8391
684 Ga0496112_0050978 3300048915 Bacteria 4059
685 Ga0496112_0248553 3300048915 Bacteria 1730
686 Ga0496112_0290804 3300048915 Bacteria 1580
687 Ga0496112_0710091 3300048915 Bacteria 933
688 Ga0496112_1279338 3300048915 Bacteria 649
689 Ga0496113_0005274 3300048916 Bacteria 8049
690 Ga0496113_0012584 3300048916 Bacteria 5692
691 Ga0496113_0174547 3300048916 Bacteria 1703
692 Ga0496113_0219564 3300048916 Bacteria 1515
693 Ga0496113_0293605 3300048916 Unclassified 1301
694 Ga0496113_0328992 3300048916 Bacteria 1225
695 Ga0496113_0438040 3300048916 Bacteria 1050
696 Ga0496114_0031815 3300048917 Bacteria 4340
697 Ga0496114_0047277 3300048917 Bacteria 3579
698 Ga0496114_0067201 3300048917 Bacteria 3007
699 Ga0496114_0180121 3300048917 Bacteria 1845
700 Ga0496114_0330252 3300048917 Unclassified 1348
701 Ga0496114_0457288 3300048917 Unclassified 1130
702 Ga0496114_0559080 3300048917 Unclassified 1010
703 Ga0496115_0004796 3300048918 Bacteria 9813
704 nmdc:mga03n38_129858_c1 3300050490 Unclassified 1247
705 nmdc:mga0yw44_136274_c1 3300050492 Bacteria 1593
706 nmdc:mga06z11_350217_c1 3300050494 Unclassified 884
707 nmdc:mga05p37_102731_c1 3300050507 Bacteria 3519
708 nmdc:mga05p37_41257_c1 3300050507 Bacteria 5666
709 nmdc:mga06r32_324075_c1 3300050510 Bacteria 1526
710 nmdc:mga08y16_169317_c1 3300050511 Bacteria 2269
711 nmdc:mga08y16_623060_c1 3300050511 Bacteria 1085
712 nmdc:mga08y16_84209_c1 3300050511 Bacteria 3315
713 nmdc:mga0n895_151250_c1 3300050512 Bacteria 2351
714 nmdc:mga0n895_19897_c1 3300050512 Bacteria 6250
715 nmdc:mga0n895_539258_c1 3300050512 Unclassified 1173
716 nmdc:mga0n895_683404_c1 3300050512 Bacteria 1023
717 nmdc:mga0rr50_1515020_c1 3300050513 Bacteria 567
718 nmdc:mga0rr50_1520740_c1 3300050513 Bacteria 566
719 nmdc:mga0rr50_27592_c1 3300050513 Bacteria 3979
720 nmdc:mga08x19_18219_c1 3300050514 Bacteria 4303
721 nmdc:mga08x19_816313_c1 3300050514 Bacteria 662
722 nmdc:mga0a205_1183178_c1 3300050515 Unclassified 612
723 nmdc:mga0a205_329898_c1 3300050515 Unclassified 1396
724 nmdc:mga0a205_469750_c1 3300050515 Bacteria 1117
725 Ga0495601_0165950 3300053077 Bacteria 1443
726 Ga0495601_0584331 3300053077 Unclassified 717
727 Ga0495601_0767467 3300053077 Bacteria 613
728 Ga0495595_0117652 3300053084 Unclassified 1293
729 Ga0495595_0187844 3300053084 Bacteria 1026
730 Ga0495595_0514482 3300053084 Unclassified 610
731 Ga0495619_0075633 3300053085 Bacteria 2260
732 Ga0495619_0230186 3300053085 Bacteria 1284
733 Ga0495619_0418732 3300053085 Bacteria 924

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025918 Ga0207662_10235096 Ga0207662_102350962 103
2 3300003373 JGI25407J50210_10146073 JGI25407J50210_101460732 104
3 3300005981 Ga0081538_10007205 Ga0081538_100072054 104
4 3300005435 Ga0070714_101321508 Ga0070714_1013215082 105
5 3300025916 Ga0207663_11181720 Ga0207663_111817202 105
6 3300046516 Ga0495628_0697730 Ga0495628_0697730_263_592 105
7 3300053077 Ga0495601_0767467 Ga0495601_0767467_224_553 105
8 3300053084 Ga0495595_0514482 Ga0495595_0514482_16_345 105
9 3300005458 Ga0070681_11988529 Ga0070681_119885291 110
10 3300005466 Ga0070685_11477932 Ga0070685_114779321 110
11 3300005543 Ga0070672_100340238 Ga0070672_1003402382 110
12 3300005544 Ga0070686_100272113 Ga0070686_1002721131 110
13 3300005614 Ga0068856_101634763 Ga0068856_1016347631 110
14 3300005616 Ga0068852_100383002 Ga0068852_1003830022 110
15 3300009098 Ga0105245_10039907 Ga0105245_100399073 110
16 3300010375 Ga0105239_10119731 Ga0105239_101197314 110
17 3300011119 Ga0105246_10342201 Ga0105246_103422012 110
18 3300025901 Ga0207688_10095138 Ga0207688_100951382 110
19 3300025940 Ga0207691_10458851 Ga0207691_104588512 110
20 3300025944 Ga0207661_10030813 Ga0207661_100308134 110
21 3300026078 Ga0207702_11042627 Ga0207702_110426272 110
22 3300048909 Ga0496106_0748517 Ga0496106_0748517_101_439 110
23 3300048911 Ga0496108_0323732 Ga0496108_0323732_854_1192 110
24 3300048916 Ga0496113_0174547 Ga0496113_0174547_250_588 110
25 3300038443 Ga0395901_0034065 Ga0395901_0034065_2138_2491 112
26 3300005456 Ga0070678_100289181 Ga0070678_1002891812 113
27 3300005840 Ga0068870_11226170 Ga0068870_112261702 113
28 3300006237 Ga0097621_100241507 Ga0097621_1002415073 113
29 3300026121 Ga0207683_10111619 Ga0207683_101116193 113
30 3300025931 Ga0207644_10781812 Ga0207644_107818122 114
31 3300026078 Ga0207702_10276359 Ga0207702_102763592 114
32 3300048914 Ga0496111_0086896 Ga0496111_0086896_1485_1835 114
33 3300005441 Ga0070700_100577814 Ga0070700_1005778142 117
34 3300005549 Ga0070704_101468867 Ga0070704_1014688671 117
35 3300006844 Ga0075428_100285345 Ga0075428_1002853452 117
36 3300009094 Ga0111539_10442063 Ga0111539_104420631 117
37 3300045051 Ga0451576_0742727 Ga0451576_0742727_144_509 117
38 3300046455 Ga0495603_0162306 Ga0495603_0162306_99_467 117
39 3300046459 Ga0495629_0132610 Ga0495629_0132610_444_812 117
40 3300046461 Ga0495641_0063952 Ga0495641_0063952_1017_1385 117
41 3300046461 Ga0495641_0487998 Ga0495641_0487998_163_531 117
42 3300046463 Ga0495653_0132255 Ga0495653_0132255_58_426 117
43 3300046473 Ga0495582_0875037 Ga0495582_0875037_23_391 117
44 3300046477 Ga0495664_0592973 Ga0495664_0592973_70_438 117
45 3300046514 Ga0495618_0198279 Ga0495618_0198279_561_929 117
46 3300046516 Ga0495628_0697699 Ga0495628_0697699_232_600 117
47 3300046533 Ga0495640_0526130 Ga0495640_0526130_234_602 117
48 3300046642 Ga0495634_0272164 Ga0495634_0272164_477_845 117
49 3300046663 Ga0495635_0067509 Ga0495635_0067509_1552_1920 117
50 3300046683 Ga0495658_0415734 Ga0495658_0415734_279_647 117
51 3300046689 Ga0495613_0145718 Ga0495613_0145718_157_525 117
52 3300047315 Ga0495581_0765311 Ga0495581_0765311_137_505 117
53 3300047317 Ga0495604_0184102 Ga0495604_0184102_114_482 117
54 3300047319 Ga0495674_0854402 Ga0495674_0854402_29_397 117
55 3300047321 Ga0495676_0176869 Ga0495676_0176869_552_920 117
56 3300047322 Ga0495680_0040259 Ga0495680_0040259_62_430 117
57 3300047471 Ga0495684_0160199 Ga0495684_0160199_482_850 117
58 3300048907 Ga0496104_0100569 Ga0496104_0100569_670_1038 117
59 3300048907 Ga0496104_1011369 Ga0496104_1011369_149_517 117
60 3300048910 Ga0496107_0539444 Ga0496107_0539444_178_546 117
61 3300048911 Ga0496108_0050702 Ga0496108_0050702_2109_2477 117
62 3300048912 Ga0496109_0239526 Ga0496109_0239526_442_810 117
63 3300048913 Ga0496110_1361215 Ga0496110_1361215_146_508 117
64 3300048914 Ga0496111_0080744 Ga0496111_0080744_514_882 117
65 3300048916 Ga0496113_0293605 Ga0496113_0293605_378_746 117
66 3300048917 Ga0496114_0330252 Ga0496114_0330252_712_1080 117
67 3300053085 Ga0495619_0418732 Ga0495619_0418732_160_528 117
68 3300035170 Ga0373943_0580498 Ga0373943_0580498_77_439 118
69 3300046461 Ga0495641_0118037 Ga0495641_0118037_798_1160 118
70 3300046517 Ga0495630_0017194 Ga0495630_0017194_1132_1494 118
71 3300047315 Ga0495581_0133432 Ga0495581_0133432_905_1267 118
72 3300047321 Ga0495676_0128334 Ga0495676_0128334_1328_1690 118
73 3300005329 Ga0070683_100003106 Ga0070683_10000310611 119
74 3300005329 Ga0070683_100507905 Ga0070683_1005079053 119
75 3300005330 Ga0070690_100589022 Ga0070690_1005890221 119
76 3300005334 Ga0068869_101011290 Ga0068869_1010112901 119
77 3300005337 Ga0070682_100214642 Ga0070682_1002146423 119
78 3300005338 Ga0068868_100160946 Ga0068868_1001609462 119
79 3300005341 Ga0070691_10015360 Ga0070691_100153604 119
80 3300005341 Ga0070691_10264227 Ga0070691_102642272 119
81 3300005343 Ga0070687_100258891 Ga0070687_1002588912 119
82 3300005355 Ga0070671_100343898 Ga0070671_1003438982 119
83 3300005364 Ga0070673_100367597 Ga0070673_1003675973 119
84 3300005365 Ga0070688_100288853 Ga0070688_1002888533 119
85 3300005365 Ga0070688_100385078 Ga0070688_1003850782 119
86 3300005436 Ga0070713_100068611 Ga0070713_1000686113 119
87 3300005437 Ga0070710_11258686 Ga0070710_112586861 119
88 3300005455 Ga0070663_100478178 Ga0070663_1004781783 119
89 3300005456 Ga0070678_100041323 Ga0070678_1000413233 119
90 3300005530 Ga0070679_100139700 Ga0070679_1001397003 119
91 3300005535 Ga0070684_100059385 Ga0070684_1000593852 119
92 3300005539 Ga0068853_100609799 Ga0068853_1006097991 119
93 3300005545 Ga0070695_100093867 Ga0070695_1000938673 119
94 3300005545 Ga0070695_101184591 Ga0070695_1011845911 119
95 3300005546 Ga0070696_100081569 Ga0070696_1000815693 119
96 3300005547 Ga0070693_100009252 Ga0070693_1000092523 119
97 3300005549 Ga0070704_101287460 Ga0070704_1012874601 119
98 3300005563 Ga0068855_100363210 Ga0068855_1003632102 119
99 3300005578 Ga0068854_100046824 Ga0068854_1000468242 119
100 3300005614 Ga0068856_100607644 Ga0068856_1006076443 119
101 3300005615 Ga0070702_100007484 Ga0070702_1000074844 119
102 3300005618 Ga0068864_100081045 Ga0068864_1000810453 119
103 3300005719 Ga0068861_100003381 Ga0068861_1000033815 119
104 3300005842 Ga0068858_100550596 Ga0068858_1005505962 119
105 3300005843 Ga0068860_100475495 Ga0068860_1004754953 119
106 3300005844 Ga0068862_100479816 Ga0068862_1004798163 119
107 3300005983 Ga0081540_1002081 Ga0081540_100208112 119
108 3300006028 Ga0070717_10159358 Ga0070717_101593582 119
109 3300006175 Ga0070712_100567015 Ga0070712_1005670152 119
110 3300006871 Ga0075434_100276366 Ga0075434_1002763663 119
111 3300007076 Ga0075435_101228836 Ga0075435_1012288362 119
112 3300009093 Ga0105240_10828223 Ga0105240_108282232 119
113 3300009098 Ga0105245_10038520 Ga0105245_100385205 119
114 3300009098 Ga0105245_10431354 Ga0105245_104313543 119
115 3300009148 Ga0105243_10403366 Ga0105243_104033663 119
116 3300009174 Ga0105241_10225946 Ga0105241_102259463 119
117 3300009176 Ga0105242_10477372 Ga0105242_104773723 119
118 3300009176 Ga0105242_10518972 Ga0105242_105189723 119
119 3300009176 Ga0105242_10750173 Ga0105242_107501732 119
120 3300009177 Ga0105248_10484933 Ga0105248_104849332 119
121 3300009553 Ga0105249_10017004 Ga0105249_100170043 119
122 3300010375 Ga0105239_10069819 Ga0105239_100698193 119
123 3300010375 Ga0105239_10651944 Ga0105239_106519442 119
124 3300013102 Ga0157371_10231855 Ga0157371_102318553 119
125 3300013296 Ga0157374_10481176 Ga0157374_104811762 119
126 3300013306 Ga0163162_10111381 Ga0163162_101113815 119
127 3300013307 Ga0157372_10481095 Ga0157372_104810953 119
128 3300013308 Ga0157375_10012591 Ga0157375_1001259111 119
129 3300013308 Ga0157375_10827290 Ga0157375_108272902 119
130 3300014497 Ga0182008_10084232 Ga0182008_100842323 119
131 3300017792 Ga0163161_10028037 Ga0163161_100280375 119
132 3300025899 Ga0207642_10063558 Ga0207642_100635583 119
133 3300025912 Ga0207707_10085432 Ga0207707_100854324 119
134 3300025915 Ga0207693_10431284 Ga0207693_104312842 119
135 3300025921 Ga0207652_10182128 Ga0207652_101821283 119
136 3300025927 Ga0207687_10152141 Ga0207687_101521413 119
137 3300025928 Ga0207700_10057007 Ga0207700_100570073 119
138 3300025931 Ga0207644_10024038 Ga0207644_100240385 119
139 3300025933 Ga0207706_10011465 Ga0207706_100114653 119
140 3300025934 Ga0207686_10234476 Ga0207686_102344763 119
141 3300025934 Ga0207686_10648946 Ga0207686_106489462 119
142 3300025936 Ga0207670_10528441 Ga0207670_105284411 119
143 3300025937 Ga0207669_10038933 Ga0207669_100389333 119
144 3300025941 Ga0207711_10222751 Ga0207711_102227512 119
145 3300025942 Ga0207689_10234974 Ga0207689_102349742 119
146 3300025942 Ga0207689_11257855 Ga0207689_112578552 119
147 3300025944 Ga0207661_10086838 Ga0207661_100868384 119
148 3300025944 Ga0207661_11050542 Ga0207661_110505422 119
149 3300025945 Ga0207679_10372925 Ga0207679_103729252 119
150 3300025945 Ga0207679_10380933 Ga0207679_103809333 119
151 3300025949 Ga0207667_10054229 Ga0207667_100542295 119
152 3300025960 Ga0207651_10166261 Ga0207651_101662613 119
153 3300025961 Ga0207712_10387990 Ga0207712_103879903 119
154 3300025972 Ga0207668_10579452 Ga0207668_105794523 119
155 3300026023 Ga0207677_10272810 Ga0207677_102728102 119
156 3300026041 Ga0207639_10981831 Ga0207639_109818312 119
157 3300026078 Ga0207702_11066949 Ga0207702_110669492 119
158 3300026089 Ga0207648_10301583 Ga0207648_103015833 119
159 3300026089 Ga0207648_10361423 Ga0207648_103614232 119
160 3300026089 Ga0207648_11974008 Ga0207648_119740082 119
161 3300026095 Ga0207676_10063585 Ga0207676_100635854 119
162 3300026118 Ga0207675_100002688 Ga0207675_1000026889 119
163 3300026121 Ga0207683_10312670 Ga0207683_103126702 119
164 3300028380 Ga0268265_10218546 Ga0268265_102185463 119
165 3300035170 Ga0373943_0068627 Ga0373943_0068627_1377_1742 119
166 3300035725 Ga0373947_0005440 Ga0373947_0005440_1729_2094 119
167 3300037068 Ga0373925_0252649 Ga0373925_0252649_330_695 119
168 3300037312 Ga0395899_0006128 Ga0395899_0006128_3844_4209 119
169 3300037312 Ga0395899_0010821 Ga0395899_0010821_52_423 119
170 3300037418 Ga0395900_0010594 Ga0395900_0010594_5349_5714 119
171 3300037418 Ga0395900_0115891 Ga0395900_0115891_861_1232 119
172 3300037466 Ga0395898_0001595 Ga0395898_0001595_5120_5491 119
173 3300037466 Ga0395898_0311853 Ga0395898_0311853_104_472 119
174 3300037466 Ga0395898_1171438 Ga0395898_1171438_248_613 119
175 3300037471 Ga0395905_0001862 Ga0395905_0001862_23642_24013 119
176 3300038443 Ga0395901_0121702 Ga0395901_0121702_79_450 119
177 3300038443 Ga0395901_0783982 Ga0395901_0783982_293_658 119
178 3300038443 Ga0395901_0887697 Ga0395901_0887697_358_726 119
179 3300041503 Ga0451847_0074877 Ga0451847_0074877_96_461 119
180 3300044901 Ga0466960_0310707 Ga0466960_0310707_138_509 119
181 3300046455 Ga0495603_0002347 Ga0495603_0002347_2636_3001 119
182 3300046473 Ga0495582_0156706 Ga0495582_0156706_164_529 119
183 3300046475 Ga0495639_0176694 Ga0495639_0176694_384_749 119
184 3300046491 Ga0495584_0085623 Ga0495584_0085623_1092_1463 119
185 3300046491 Ga0495584_0187982 Ga0495584_0187982_625_996 119
186 3300046499 Ga0495594_0045194 Ga0495594_0045194_1292_1657 119
187 3300046513 Ga0495616_0150105 Ga0495616_0150105_180_545 119
188 3300046523 Ga0495644_0222683 Ga0495644_0222683_180_545 119
189 3300046542 Ga0495597_0230936 Ga0495597_0230936_300_665 119
190 3300046557 Ga0495622_0258470 Ga0495622_0258470_264_629 119
191 3300046674 Ga0495588_0000586 Ga0495588_0000586_5842_6207 119
192 3300046674 Ga0495588_0542631 Ga0495588_0542631_61_426 119
193 3300046674 Ga0495588_0647056 Ga0495588_0647056_155_520 119
194 3300046681 Ga0495647_0020286 Ga0495647_0020286_1729_2094 119
195 3300047321 Ga0495676_0017349 Ga0495676_0017349_1083_1448 119
196 3300047445 Ga0495677_0215977 Ga0495677_0215977_166_531 119
197 3300048903 Ga0496100_0015996 Ga0496100_0015996_1928_2293 119
198 3300048903 Ga0496100_0040037 Ga0496100_0040037_2132_2503 119
199 3300048904 Ga0496101_0050269 Ga0496101_0050269_989_1360 119
200 3300048905 Ga0496102_0163633 Ga0496102_0163633_876_1247 119
201 3300048906 Ga0496103_0023101 Ga0496103_0023101_3136_3507 119
202 3300048907 Ga0496104_0002265 Ga0496104_0002265_679_1044 119
203 3300048907 Ga0496104_0004320 Ga0496104_0004320_6387_6758 119
204 3300048908 Ga0496105_0002160 Ga0496105_0002160_10551_10916 119
205 3300048908 Ga0496105_0002904 Ga0496105_0002904_2128_2499 119
206 3300048909 Ga0496106_0036174 Ga0496106_0036174_2218_2583 119
207 3300048909 Ga0496106_0080895 Ga0496106_0080895_900_1271 119
208 3300048910 Ga0496107_0033312 Ga0496107_0033312_768_1139 119
209 3300048910 Ga0496107_0088266 Ga0496107_0088266_181_546 119
210 3300048911 Ga0496108_0001671 Ga0496108_0001671_11369_11734 119
211 3300048911 Ga0496108_0010509 Ga0496108_0010509_4935_5306 119
212 3300048911 Ga0496108_0403584 Ga0496108_0403584_509_874 119
213 3300048911 Ga0496108_0524798 Ga0496108_0524798_656_1018 119
214 3300048912 Ga0496109_0001133 Ga0496109_0001133_3541_3906 119
215 3300048912 Ga0496109_0052942 Ga0496109_0052942_2428_2799 119
216 3300048912 Ga0496109_0089878 Ga0496109_0089878_2260_2622 119
217 3300048912 Ga0496109_0358910 Ga0496109_0358910_476_850 119
218 3300048912 Ga0496109_0950440 Ga0496109_0950440_413_778 119
219 3300048913 Ga0496110_0000467 Ga0496110_0000467_21366_21731 119
220 3300048913 Ga0496110_0014346 Ga0496110_0014346_4220_4591 119
221 3300048913 Ga0496110_0618336 Ga0496110_0618336_330_695 119
222 3300048914 Ga0496111_0001328 Ga0496111_0001328_8096_8461 119
223 3300048914 Ga0496111_0003433 Ga0496111_0003433_5370_5741 119
224 3300048914 Ga0496111_0677809 Ga0496111_0677809_350_712 119
225 3300048914 Ga0496111_1067844 Ga0496111_1067844_97_471 119
226 3300048915 Ga0496112_0010541 Ga0496112_0010541_2731_3096 119
227 3300048915 Ga0496112_0050978 Ga0496112_0050978_2659_3030 119
228 3300048915 Ga0496112_1279338 Ga0496112_1279338_30_392 119
229 3300048916 Ga0496113_0005274 Ga0496113_0005274_6489_6854 119
230 3300048916 Ga0496113_0012584 Ga0496113_0012584_2415_2786 119
231 3300048917 Ga0496114_0031815 Ga0496114_0031815_1938_2303 119
232 3300048917 Ga0496114_0180121 Ga0496114_0180121_800_1171 119
233 3300048918 Ga0496115_0004796 Ga0496115_0004796_8779_9144 119
234 3300050513 nmdc:mga0rr50_1515020_c1 nmdc:mga0rr50_1515020_c1_147_509 119
235 3300012515 Ga0157338_1038168 Ga0157338_10381681 120
236 3300050511 nmdc:mga08y16_623060_c1 nmdc:mga08y16_623060_c1_190_576 120
237 3300050512 nmdc:mga0n895_539258_c1 nmdc:mga0n895_539258_c1_92_460 120
238 3300050512 nmdc:mga0n895_683404_c1 nmdc:mga0n895_683404_c1_128_514 120
239 3300050513 nmdc:mga0rr50_1520740_c1 nmdc:mga0rr50_1520740_c1_14_400 120
240 3300050514 nmdc:mga08x19_816313_c1 nmdc:mga08x19_816313_c1_252_617 120
241 3300050515 nmdc:mga0a205_1183178_c1 nmdc:mga0a205_1183178_c1_22_387 120
242 3300005981 Ga0081538_10212254 Ga0081538_102122542 122
243 3300014745 Ga0157377_11257723 Ga0157377_112577231 122
244 3300041512 Ga0451853_1845315 Ga0451853_1845315_60_452 122
245 3300005329 Ga0070683_100137920 Ga0070683_1001379204 127
246 3300005331 Ga0070670_101605766 Ga0070670_1016057661 127
247 3300005340 Ga0070689_100427957 Ga0070689_1004279572 127
248 3300005356 Ga0070674_101976768 Ga0070674_1019767681 127
249 3300005364 Ga0070673_101651676 Ga0070673_1016516761 127
250 3300005366 Ga0070659_100482819 Ga0070659_1004828192 127
251 3300005457 Ga0070662_100568910 Ga0070662_1005689102 127
252 3300005535 Ga0070684_100190116 Ga0070684_1001901162 127
253 3300005545 Ga0070695_100917705 Ga0070695_1009177051 127
254 3300005937 Ga0081455_10052374 Ga0081455_100523742 127
255 3300006028 Ga0070717_10355180 Ga0070717_103551802 127
256 3300006173 Ga0070716_101180602 Ga0070716_1011806021 127
257 3300007076 Ga0075435_100893229 Ga0075435_1008932292 127
258 3300009553 Ga0105249_11014088 Ga0105249_110140882 127
259 3300013105 Ga0157369_11649568 Ga0157369_116495682 127
260 3300014745 Ga0157377_10130402 Ga0157377_101304022 127
261 3300025912 Ga0207707_10556095 Ga0207707_105560951 127
262 3300025927 Ga0207687_10728954 Ga0207687_107289542 127
263 3300026075 Ga0207708_10185951 Ga0207708_101859512 127
264 3300026075 Ga0207708_10700649 Ga0207708_107006492 127
265 3300026142 Ga0207698_10647340 Ga0207698_106473402 127
266 3300031995 Ga0307409_100988213 Ga0307409_1009882132 127
267 3300032002 Ga0307416_100202656 Ga0307416_1002026563 127
268 3300037418 Ga0395900_0990870 Ga0395900_0990870_285_677 127
269 3300038443 Ga0395901_0669118 Ga0395901_0669118_147_539 127
270 3300045051 Ga0451576_1511440 Ga0451576_1511440_269_667 127
271 3300046454 Ga0495592_0738792 Ga0495592_0738792_129_524 127
272 3300046455 Ga0495603_0211194 Ga0495603_0211194_190_591 127
273 3300046462 Ga0495651_0292485 Ga0495651_0292485_270_665 127
274 3300046514 Ga0495618_0556536 Ga0495618_0556536_229_633 127
275 3300046675 Ga0495657_0149191 Ga0495657_0149191_316_711 127
276 3300046678 Ga0495599_0535148 Ga0495599_0535148_196_600 127
277 3300047322 Ga0495680_0270912 Ga0495680_0270912_690_1085 127
278 3300047322 Ga0495680_0370546 Ga0495680_0370546_316_717 127
279 3300047471 Ga0495684_0127146 Ga0495684_0127146_673_1068 127
280 3300048906 Ga0496103_0178207 Ga0496103_0178207_449_838 127
281 3300048911 Ga0496108_0385543 Ga0496108_0385543_322_723 127
282 3300048912 Ga0496109_0822957 Ga0496109_0822957_43_432 127
283 3300048912 Ga0496109_1217543 Ga0496109_1217543_189_590 127
284 3300048913 Ga0496110_0368741 Ga0496110_0368741_746_1135 127
285 3300048913 Ga0496110_1477336 Ga0496110_1477336_28_432 127
286 3300048914 Ga0496111_0136795 Ga0496111_0136795_75_464 127
287 3300048914 Ga0496111_0520437 Ga0496111_0520437_185_586 127
288 3300048916 Ga0496113_0219564 Ga0496113_0219564_199_603 127
289 3300048917 Ga0496114_0559080 Ga0496114_0559080_60_473 127
290 3300053077 Ga0495601_0165950 Ga0495601_0165950_270_674 127
291 3300053084 Ga0495595_0117652 Ga0495595_0117652_12_416 127
292 3300053085 Ga0495619_0075633 Ga0495619_0075633_65_469 127
293 3300005328 Ga0070676_10190990 Ga0070676_101909902 128
294 3300005336 Ga0070680_101344892 Ga0070680_1013448921 128
295 3300005471 Ga0070698_100012651 Ga0070698_1000126519 128
296 3300005564 Ga0070664_100482268 Ga0070664_1004822682 128
297 3300005577 Ga0068857_100106802 Ga0068857_1001068022 128
298 3300005615 Ga0070702_101076032 Ga0070702_1010760322 128
299 3300005719 Ga0068861_100634562 Ga0068861_1006345622 128
300 3300005844 Ga0068862_100702218 Ga0068862_1007022182 128
301 3300005981 Ga0081538_10000544 Ga0081538_1000054441 128
302 3300006237 Ga0097621_100785022 Ga0097621_1007850222 128
303 3300006881 Ga0068865_100292648 Ga0068865_1002926481 128
304 3300006881 Ga0068865_101401149 Ga0068865_1014011491 128
305 3300009148 Ga0105243_10106939 Ga0105243_101069392 128
306 3300025935 Ga0207709_10048847 Ga0207709_100488472 128
307 3300025937 Ga0207669_10271584 Ga0207669_102715843 128
308 3300025940 Ga0207691_11022940 Ga0207691_110229402 128
309 3300025944 Ga0207661_10042448 Ga0207661_100424483 128
310 3300026116 Ga0207674_10066775 Ga0207674_100667753 128
311 3300028380 Ga0268265_10561831 Ga0268265_105618312 128
312 3300037312 Ga0395899_0018968 Ga0395899_0018968_4002_4394 128
313 3300037312 Ga0395899_0257562 Ga0395899_0257562_364_759 128
314 3300037418 Ga0395900_0002962 Ga0395900_0002962_16726_17118 128
315 3300037418 Ga0395900_0263878 Ga0395900_0263878_819_1214 128
316 3300037466 Ga0395898_0192927 Ga0395898_0192927_812_1204 128
317 3300037471 Ga0395905_0007290 Ga0395905_0007290_2321_2713 128
318 3300037471 Ga0395905_0915276 Ga0395905_0915276_298_693 128
319 3300038443 Ga0395901_0001901 Ga0395901_0001901_17479_17871 128
320 3300038443 Ga0395901_0154480 Ga0395901_0154480_1337_1732 128
321 3300041453 Ga0451797_0838146 Ga0451797_0838146_39_440 128
322 3300042005 Ga0439448_0024047 Ga0439448_0024047_1094_1486 128
323 3300044694 Ga0466963_0465383 Ga0466963_0465383_237_626 128
324 3300045976 Ga0466967_0425673 Ga0466967_0425673_636_1025 128
325 3300046454 Ga0495592_0526491 Ga0495592_0526491_176_580 128
326 3300046459 Ga0495629_0490397 Ga0495629_0490397_154_558 128
327 3300046461 Ga0495641_0564264 Ga0495641_0564264_41_445 128
328 3300046462 Ga0495651_0598183 Ga0495651_0598183_170_574 128
329 3300046476 Ga0495662_0186743 Ga0495662_0186743_580_984 128
330 3300046477 Ga0495664_0126535 Ga0495664_0126535_580_984 128
331 3300046516 Ga0495628_0925357 Ga0495628_0925357_10_414 128
332 3300046517 Ga0495630_0396983 Ga0495630_0396983_375_779 128
333 3300046559 Ga0495667_0067182 Ga0495667_0067182_1573_1977 128
334 3300046615 Ga0495656_0284636 Ga0495656_0284636_343_741 128
335 3300046642 Ga0495634_0403898 Ga0495634_0403898_314_718 128
336 3300046663 Ga0495635_0234895 Ga0495635_0234895_701_1105 128
337 3300046665 Ga0495661_0343974 Ga0495661_0343974_27_425 128
338 3300046675 Ga0495657_0139457 Ga0495657_0139457_228_632 128
339 3300047317 Ga0495604_0319024 Ga0495604_0319024_544_948 128
340 3300047319 Ga0495674_0434514 Ga0495674_0434514_450_854 128
341 3300047321 Ga0495676_0383783 Ga0495676_0383783_324_728 128
342 3300047322 Ga0495680_0197745 Ga0495680_0197745_588_992 128
343 3300048917 Ga0496114_0457288 Ga0496114_0457288_192_596 128
344 3300053077 Ga0495601_0584331 Ga0495601_0584331_160_564 128
345 3300053084 Ga0495595_0187844 Ga0495595_0187844_39_443 128
346 3300053085 Ga0495619_0230186 Ga0495619_0230186_26_430 128
347 3300001991 JGI24743J22301_10045839 JGI24743J22301_100458391 129
348 3300002077 JGI24744J21845_10000622 JGI24744J21845_100006225 129
349 3300003911 JGI25405J52794_10083919 JGI25405J52794_100839191 129
350 3300005329 Ga0070683_100619576 Ga0070683_1006195762 129
351 3300005329 Ga0070683_100937589 Ga0070683_1009375892 129
352 3300005329 Ga0070683_100945383 Ga0070683_1009453831 129
353 3300005330 Ga0070690_100007009 Ga0070690_1000070096 129
354 3300005330 Ga0070690_100007646 Ga0070690_1000076466 129
355 3300005334 Ga0068869_100229275 Ga0068869_1002292752 129
356 3300005336 Ga0070680_100049628 Ga0070680_1000496282 129
357 3300005336 Ga0070680_100207710 Ga0070680_1002077103 129
358 3300005336 Ga0070680_100272761 Ga0070680_1002727611 129
359 3300005337 Ga0070682_100007893 Ga0070682_1000078935 129
360 3300005337 Ga0070682_100809864 Ga0070682_1008098641 129
361 3300005338 Ga0068868_100042584 Ga0068868_1000425842 129
362 3300005338 Ga0068868_100925271 Ga0068868_1009252712 129
363 3300005338 Ga0068868_101460763 Ga0068868_1014607631 129
364 3300005338 Ga0068868_101712880 Ga0068868_1017128801 129
365 3300005338 Ga0068868_101941983 Ga0068868_1019419831 129
366 3300005339 Ga0070660_100014662 Ga0070660_1000146622 129
367 3300005339 Ga0070660_100016236 Ga0070660_1000162362 129
368 3300005339 Ga0070660_100088499 Ga0070660_1000884992 129
369 3300005340 Ga0070689_100001929 Ga0070689_1000019295 129
370 3300005341 Ga0070691_10014538 Ga0070691_100145384 129
371 3300005341 Ga0070691_10060012 Ga0070691_100600122 129
372 3300005343 Ga0070687_100016945 Ga0070687_1000169454 129
373 3300005343 Ga0070687_100143302 Ga0070687_1001433022 129
374 3300005345 Ga0070692_10003456 Ga0070692_100034565 129
375 3300005345 Ga0070692_10016755 Ga0070692_100167554 129
376 3300005347 Ga0070668_100054346 Ga0070668_1000543461 129
377 3300005347 Ga0070668_100955672 Ga0070668_1009556721 129
378 3300005353 Ga0070669_100055884 Ga0070669_1000558844 129
379 3300005354 Ga0070675_100138657 Ga0070675_1001386572 129
380 3300005354 Ga0070675_100434258 Ga0070675_1004342582 129
381 3300005355 Ga0070671_100138439 Ga0070671_1001384392 129
382 3300005356 Ga0070674_100004383 Ga0070674_1000043836 129
383 3300005356 Ga0070674_100014406 Ga0070674_1000144064 129
384 3300005364 Ga0070673_100012370 Ga0070673_1000123706 129
385 3300005364 Ga0070673_100173255 Ga0070673_1001732554 129
386 3300005365 Ga0070688_100027090 Ga0070688_1000270902 129
387 3300005366 Ga0070659_100003504 Ga0070659_10000350410 129
388 3300005366 Ga0070659_100020196 Ga0070659_1000201965 129
389 3300005366 Ga0070659_100250168 Ga0070659_1002501681 129
390 3300005366 Ga0070659_100272169 Ga0070659_1002721692 129
391 3300005367 Ga0070667_100360629 Ga0070667_1003606292 129
392 3300005367 Ga0070667_100797232 Ga0070667_1007972321 129
393 3300005406 Ga0070703_10042315 Ga0070703_100423151 129
394 3300005434 Ga0070709_10006351 Ga0070709_100063516 129
395 3300005435 Ga0070714_100432599 Ga0070714_1004325993 129
396 3300005437 Ga0070710_10004670 Ga0070710_100046706 129
397 3300005438 Ga0070701_10002084 Ga0070701_100020844 129
398 3300005438 Ga0070701_10080816 Ga0070701_100808162 129
399 3300005438 Ga0070701_10140634 Ga0070701_101406343 129
400 3300005439 Ga0070711_100174269 Ga0070711_1001742693 129
401 3300005440 Ga0070705_100071436 Ga0070705_1000714361 129
402 3300005441 Ga0070700_100196915 Ga0070700_1001969152 129
403 3300005441 Ga0070700_100447030 Ga0070700_1004470303 129
404 3300005444 Ga0070694_100006339 Ga0070694_1000063396 129
405 3300005444 Ga0070694_100015580 Ga0070694_1000155805 129
406 3300005455 Ga0070663_100009824 Ga0070663_1000098246 129
407 3300005455 Ga0070663_100688211 Ga0070663_1006882112 129
408 3300005456 Ga0070678_100001355 Ga0070678_1000013555 129
409 3300005456 Ga0070678_100024433 Ga0070678_1000244333 129
410 3300005456 Ga0070678_100905202 Ga0070678_1009052022 129
411 3300005457 Ga0070662_100014629 Ga0070662_1000146293 129
412 3300005457 Ga0070662_100032138 Ga0070662_1000321385 129
413 3300005457 Ga0070662_100066548 Ga0070662_1000665483 129
414 3300005458 Ga0070681_10281295 Ga0070681_102812952 129
415 3300005458 Ga0070681_10628878 Ga0070681_106288782 129
416 3300005459 Ga0068867_100004104 Ga0068867_1000041045 129
417 3300005466 Ga0070685_10060121 Ga0070685_100601212 129
418 3300005467 Ga0070706_100015559 Ga0070706_1000155596 129
419 3300005471 Ga0070698_100018972 Ga0070698_1000189726 129
420 3300005530 Ga0070679_100025017 Ga0070679_1000250178 129
421 3300005530 Ga0070679_100100735 Ga0070679_1001007352 129
422 3300005530 Ga0070679_100145965 Ga0070679_1001459653 129
423 3300005530 Ga0070679_100285032 Ga0070679_1002850322 129
424 3300005530 Ga0070679_100481822 Ga0070679_1004818222 129
425 3300005530 Ga0070679_101460179 Ga0070679_1014601791 129
426 3300005535 Ga0070684_100955018 Ga0070684_1009550182 129
427 3300005539 Ga0068853_100003775 Ga0068853_1000037756 129
428 3300005539 Ga0068853_100067026 Ga0068853_1000670264 129
429 3300005539 Ga0068853_100418115 Ga0068853_1004181152 129
430 3300005539 Ga0068853_100471891 Ga0068853_1004718912 129
431 3300005545 Ga0070695_100006793 Ga0070695_1000067937 129
432 3300005546 Ga0070696_100008063 Ga0070696_1000080635 129
433 3300005546 Ga0070696_100013726 Ga0070696_1000137262 129
434 3300005546 Ga0070696_100016796 Ga0070696_1000167966 129
435 3300005546 Ga0070696_101531295 Ga0070696_1015312951 129
436 3300005547 Ga0070693_100109962 Ga0070693_1001099622 129
437 3300005547 Ga0070693_100221042 Ga0070693_1002210423 129
438 3300005548 Ga0070665_100229666 Ga0070665_1002296663 129
439 3300005549 Ga0070704_100017949 Ga0070704_1000179493 129
440 3300005549 Ga0070704_100055926 Ga0070704_1000559264 129
441 3300005563 Ga0068855_100039995 Ga0068855_1000399955 129
442 3300005563 Ga0068855_100040250 Ga0068855_1000402504 129
443 3300005563 Ga0068855_100329890 Ga0068855_1003298904 129
444 3300005563 Ga0068855_100699520 Ga0068855_1006995202 129
445 3300005563 Ga0068855_100746606 Ga0068855_1007466062 129
446 3300005578 Ga0068854_100032576 Ga0068854_1000325764 129
447 3300005578 Ga0068854_100623591 Ga0068854_1006235912 129
448 3300005578 Ga0068854_101765634 Ga0068854_1017656341 129
449 3300005614 Ga0068856_100007081 Ga0068856_1000070814 129
450 3300005614 Ga0068856_101594374 Ga0068856_1015943741 129
451 3300005615 Ga0070702_100021016 Ga0070702_1000210163 129
452 3300005615 Ga0070702_100077498 Ga0070702_1000774982 129
453 3300005616 Ga0068852_100327449 Ga0068852_1003274492 129
454 3300005616 Ga0068852_100597961 Ga0068852_1005979613 129
455 3300005617 Ga0068859_100120993 Ga0068859_1001209934 129
456 3300005617 Ga0068859_100483423 Ga0068859_1004834232 129
457 3300005718 Ga0068866_10012434 Ga0068866_100124343 129
458 3300005718 Ga0068866_10013230 Ga0068866_100132303 129
459 3300005719 Ga0068861_100018958 Ga0068861_1000189584 129
460 3300005719 Ga0068861_100077252 Ga0068861_1000772523 129
461 3300005719 Ga0068861_100295761 Ga0068861_1002957611 129
462 3300005844 Ga0068862_100069889 Ga0068862_1000698894 129
463 3300005937 Ga0081455_10005481 Ga0081455_100054818 129
464 3300005981 Ga0081538_10005013 Ga0081538_1000501315 129
465 3300005983 Ga0081540_1010083 Ga0081540_10100836 129
466 3300005983 Ga0081540_1020045 Ga0081540_10200454 129
467 3300006038 Ga0075365_10088285 Ga0075365_100882852 129
468 3300006058 Ga0075432_10007341 Ga0075432_100073413 129
469 3300006163 Ga0070715_10118432 Ga0070715_101184322 129
470 3300006173 Ga0070716_100295463 Ga0070716_1002954632 129
471 3300006173 Ga0070716_100700007 Ga0070716_1007000071 129
472 3300006175 Ga0070712_100016882 Ga0070712_1000168823 129
473 3300006178 Ga0075367_10129912 Ga0075367_101299123 129
474 3300006237 Ga0097621_100005876 Ga0097621_10000587610 129
475 3300006358 Ga0068871_100138006 Ga0068871_1001380062 129
476 3300006847 Ga0075431_100006169 Ga0075431_1000061693 129
477 3300006847 Ga0075431_100278062 Ga0075431_1002780623 129
478 3300006847 Ga0075431_101876898 Ga0075431_1018768981 129
479 3300006871 Ga0075434_100098662 Ga0075434_1000986622 129
480 3300006871 Ga0075434_100131466 Ga0075434_1001314662 129
481 3300006880 Ga0075429_100038949 Ga0075429_1000389494 129
482 3300006881 Ga0068865_100008007 Ga0068865_1000080073 129
483 3300006881 Ga0068865_100016053 Ga0068865_1000160536 129
484 3300006914 Ga0075436_100011666 Ga0075436_1000116663 129
485 3300006931 Ga0097620_100120997 Ga0097620_1001209974 129
486 3300006931 Ga0097620_100483446 Ga0097620_1004834462 129
487 3300007076 Ga0075435_100054169 Ga0075435_1000541693 129
488 3300009092 Ga0105250_10187788 Ga0105250_101877882 129
489 3300009093 Ga0105240_10388353 Ga0105240_103883533 129
490 3300009094 Ga0111539_10129955 Ga0111539_101299552 129
491 3300009094 Ga0111539_11489475 Ga0111539_114894752 129
492 3300009098 Ga0105245_10026959 Ga0105245_100269594 129
493 3300009098 Ga0105245_10033334 Ga0105245_100333347 129
494 3300009098 Ga0105245_10676799 Ga0105245_106767992 129
495 3300009147 Ga0114129_10118719 Ga0114129_101187194 129
496 3300009148 Ga0105243_10068354 Ga0105243_100683544 129
497 3300009148 Ga0105243_11004036 Ga0105243_110040362 129
498 3300009176 Ga0105242_10009803 Ga0105242_100098036 129
499 3300009176 Ga0105242_10049217 Ga0105242_100492174 129
500 3300009177 Ga0105248_10051290 Ga0105248_100512902 129
501 3300009177 Ga0105248_11104389 Ga0105248_111043892 129
502 3300009545 Ga0105237_10586598 Ga0105237_105865982 129
503 3300009545 Ga0105237_10803775 Ga0105237_108037751 129
504 3300009551 Ga0105238_11287724 Ga0105238_112877241 129
505 3300009553 Ga0105249_10017306 Ga0105249_100173066 129
506 3300009553 Ga0105249_10269560 Ga0105249_102695601 129
507 3300010375 Ga0105239_10039565 Ga0105239_100395652 129
508 3300010375 Ga0105239_10054523 Ga0105239_100545233 129
509 3300010375 Ga0105239_10111319 Ga0105239_101113192 129
510 3300010375 Ga0105239_10326454 Ga0105239_103264541 129
511 3300011119 Ga0105246_11510152 Ga0105246_115101521 129
512 3300013102 Ga0157371_10059211 Ga0157371_100592114 129
513 3300013105 Ga0157369_11048051 Ga0157369_110480511 129
514 3300013297 Ga0157378_10500455 Ga0157378_105004552 129
515 3300013306 Ga0163162_10194728 Ga0163162_101947283 129
516 3300013307 Ga0157372_10059494 Ga0157372_100594943 129
517 3300013308 Ga0157375_12389446 Ga0157375_123894462 129
518 3300014325 Ga0163163_11110528 Ga0163163_111105281 129
519 3300014326 Ga0157380_11215358 Ga0157380_112153582 129
520 3300014968 Ga0157379_10426745 Ga0157379_104267453 129
521 3300017792 Ga0163161_10416536 Ga0163161_104165363 129
522 3300020069 Ga0197907_10551217 Ga0197907_105512172 129
523 3300020081 Ga0206354_10514906 Ga0206354_105149064 129
524 3300020081 Ga0206354_11598535 Ga0206354_115985352 129
525 3300020082 Ga0206353_10357655 Ga0206353_103576552 129
526 3300020082 Ga0206353_10693181 Ga0206353_106931815 129
527 3300025321 Ga0207656_10332846 Ga0207656_103328462 129
528 3300025885 Ga0207653_10009818 Ga0207653_100098183 129
529 3300025893 Ga0207682_10090035 Ga0207682_100900351 129
530 3300025898 Ga0207692_10043747 Ga0207692_100437473 129
531 3300025901 Ga0207688_10052488 Ga0207688_100524884 129
532 3300025903 Ga0207680_10075491 Ga0207680_100754912 129
533 3300025905 Ga0207685_10083663 Ga0207685_100836632 129
534 3300025906 Ga0207699_10082672 Ga0207699_100826724 129
535 3300025910 Ga0207684_10014015 Ga0207684_100140153 129
536 3300025910 Ga0207684_10475833 Ga0207684_104758331 129
537 3300025912 Ga0207707_10064009 Ga0207707_100640093 129
538 3300025912 Ga0207707_10087336 Ga0207707_100873362 129
539 3300025912 Ga0207707_11050666 Ga0207707_110506662 129
540 3300025914 Ga0207671_10407307 Ga0207671_104073073 129
541 3300025914 Ga0207671_11251326 Ga0207671_112513261 129
542 3300025915 Ga0207693_10000778 Ga0207693_1000077830 129
543 3300025916 Ga0207663_10144465 Ga0207663_101444652 129
544 3300025917 Ga0207660_10043173 Ga0207660_100431734 129
545 3300025917 Ga0207660_10079261 Ga0207660_100792614 129
546 3300025917 Ga0207660_10175083 Ga0207660_101750833 129
547 3300025918 Ga0207662_10143107 Ga0207662_101431073 129
548 3300025919 Ga0207657_10012421 Ga0207657_100124215 129
549 3300025919 Ga0207657_10053411 Ga0207657_100534112 129
550 3300025919 Ga0207657_10120872 Ga0207657_101208722 129
551 3300025919 Ga0207657_10240791 Ga0207657_102407913 129
552 3300025921 Ga0207652_10018732 Ga0207652_100187322 129
553 3300025921 Ga0207652_10102648 Ga0207652_101026484 129
554 3300025921 Ga0207652_10118863 Ga0207652_101188632 129
555 3300025921 Ga0207652_10119579 Ga0207652_101195792 129
556 3300025921 Ga0207652_10137085 Ga0207652_101370852 129
557 3300025921 Ga0207652_11099849 Ga0207652_110998492 129
558 3300025922 Ga0207646_10608923 Ga0207646_106089232 129
559 3300025923 Ga0207681_10234729 Ga0207681_102347293 129
560 3300025924 Ga0207694_10309847 Ga0207694_103098472 129
561 3300025926 Ga0207659_10042011 Ga0207659_100420113 129
562 3300025926 Ga0207659_10263969 Ga0207659_102639692 129
563 3300025927 Ga0207687_10018420 Ga0207687_100184204 129
564 3300025927 Ga0207687_10033989 Ga0207687_100339894 129
565 3300025929 Ga0207664_10803203 Ga0207664_108032032 129
566 3300025931 Ga0207644_10179775 Ga0207644_101797751 129
567 3300025932 Ga0207690_10071533 Ga0207690_100715332 129
568 3300025932 Ga0207690_10083304 Ga0207690_100833042 129
569 3300025932 Ga0207690_10245659 Ga0207690_102456592 129
570 3300025932 Ga0207690_10354611 Ga0207690_103546112 129
571 3300025932 Ga0207690_10845119 Ga0207690_108451192 129
572 3300025933 Ga0207706_10015721 Ga0207706_100157214 129
573 3300025933 Ga0207706_10047569 Ga0207706_100475694 129
574 3300025934 Ga0207686_10069082 Ga0207686_100690824 129
575 3300025935 Ga0207709_10031487 Ga0207709_100314874 129
576 3300025935 Ga0207709_10192125 Ga0207709_101921252 129
577 3300025936 Ga0207670_10174928 Ga0207670_101749282 129
578 3300025937 Ga0207669_10003176 Ga0207669_100031764 129
579 3300025937 Ga0207669_10538121 Ga0207669_105381211 129
580 3300025938 Ga0207704_10018471 Ga0207704_100184715 129
581 3300025938 Ga0207704_10025797 Ga0207704_100257972 129
582 3300025939 Ga0207665_10025299 Ga0207665_100252993 129
583 3300025940 Ga0207691_10017123 Ga0207691_100171232 129
584 3300025940 Ga0207691_10398484 Ga0207691_103984842 129
585 3300025941 Ga0207711_10221812 Ga0207711_102218122 129
586 3300025942 Ga0207689_10125421 Ga0207689_101254212 129
587 3300025942 Ga0207689_10268418 Ga0207689_102684183 129
588 3300025942 Ga0207689_11166964 Ga0207689_111669642 129
589 3300025944 Ga0207661_10856073 Ga0207661_108560732 129
590 3300025944 Ga0207661_11682482 Ga0207661_116824821 129
591 3300025949 Ga0207667_10114531 Ga0207667_101145313 129
592 3300025949 Ga0207667_10217497 Ga0207667_102174972 129
593 3300025949 Ga0207667_10296724 Ga0207667_102967242 129
594 3300025960 Ga0207651_10011111 Ga0207651_100111114 129
595 3300025960 Ga0207651_10081749 Ga0207651_100817494 129
596 3300025961 Ga0207712_10059287 Ga0207712_100592872 129
597 3300025961 Ga0207712_10328821 Ga0207712_103288213 129
598 3300025961 Ga0207712_11525472 Ga0207712_115254722 129
599 3300025972 Ga0207668_10634384 Ga0207668_106343842 129
600 3300025972 Ga0207668_11051881 Ga0207668_110518811 129
601 3300025981 Ga0207640_10041232 Ga0207640_100412324 129
602 3300025981 Ga0207640_10314602 Ga0207640_103146022 129
603 3300025981 Ga0207640_10587548 Ga0207640_105875482 129
604 3300025986 Ga0207658_10412003 Ga0207658_104120032 129
605 3300026023 Ga0207677_10316876 Ga0207677_103168762 129
606 3300026023 Ga0207677_11548282 Ga0207677_115482822 129
607 3300026041 Ga0207639_10015667 Ga0207639_100156674 129
608 3300026041 Ga0207639_10098640 Ga0207639_100986404 129
609 3300026041 Ga0207639_10296368 Ga0207639_102963682 129
610 3300026067 Ga0207678_10012714 Ga0207678_100127146 129
611 3300026075 Ga0207708_10003195 Ga0207708_1000319516 129
612 3300026075 Ga0207708_10080217 Ga0207708_100802172 129
613 3300026078 Ga0207702_11194741 Ga0207702_111947412 129
614 3300026089 Ga0207648_10002086 Ga0207648_100020867 129
615 3300026089 Ga0207648_10004570 Ga0207648_100045707 129
616 3300026118 Ga0207675_100015447 Ga0207675_1000154474 129
617 3300026118 Ga0207675_100046297 Ga0207675_1000462975 129
618 3300026121 Ga0207683_10000041 Ga0207683_1000004176 129
619 3300026121 Ga0207683_10036784 Ga0207683_100367844 129
620 3300026121 Ga0207683_10863968 Ga0207683_108639681 129
621 3300026142 Ga0207698_10207669 Ga0207698_102076692 129
622 3300027665 Ga0209983_1122351 Ga0209983_11223512 129
623 3300027717 Ga0209998_10010246 Ga0209998_100102463 129
624 3300027907 Ga0207428_10000892 Ga0207428_1000089230 129
625 3300027907 Ga0207428_10002067 Ga0207428_1000206713 129
626 3300028379 Ga0268266_10896920 Ga0268266_108969202 129
627 3300031548 Ga0307408_100101790 Ga0307408_1001017901 129
628 3300031731 Ga0307405_10167921 Ga0307405_101679213 129
629 3300031901 Ga0307406_11039426 Ga0307406_110394261 129
630 3300032002 Ga0307416_101827999 Ga0307416_1018279992 129
631 3300032126 Ga0307415_100065331 Ga0307415_1000653312 129
632 3300032126 Ga0307415_100088096 Ga0307415_1000880963 129
633 3300034820 Ga0373959_0191654 Ga0373959_0191654_43_438 129
634 3300035091 Ga0373951_0152433 Ga0373951_0152433_104_499 129
635 3300035112 Ga0373932_0038275 Ga0373932_0038275_800_1195 129
636 3300035113 Ga0373936_0142413 Ga0373936_0142413_276_671 129
637 3300035115 Ga0373941_0219299 Ga0373941_0219299_258_653 129
638 3300035116 Ga0373945_0018054 Ga0373945_0018054_1961_2356 129
639 3300035121 Ga0373960_0093402 Ga0373960_0093402_440_835 129
640 3300035241 Ga0373961_0129816 Ga0373961_0129816_231_626 129
641 3300037312 Ga0395899_0116376 Ga0395899_0116376_599_988 129
642 3300037312 Ga0395899_0264069 Ga0395899_0264069_40_432 129
643 3300037418 Ga0395900_0012510 Ga0395900_0012510_2313_2705 129
644 3300037418 Ga0395900_0039626 Ga0395900_0039626_4005_4394 129
645 3300037466 Ga0395898_0001862 Ga0395898_0001862_8331_8720 129
646 3300037466 Ga0395898_0008942 Ga0395898_0008942_4070_4462 129
647 3300037466 Ga0395898_0269908 Ga0395898_0269908_305_703 129
648 3300037466 Ga0395898_1563840 Ga0395898_1563840_117_506 129
649 3300037471 Ga0395905_0012603 Ga0395905_0012603_5970_6359 129
650 3300037471 Ga0395905_0039785 Ga0395905_0039785_2253_2645 129
651 3300037471 Ga0395905_0092114 Ga0395905_0092114_989_1387 129
652 3300037471 Ga0395905_0107670 Ga0395905_0107670_1098_1487 129
653 3300038443 Ga0395901_0006362 Ga0395901_0006362_9450_9842 129
654 3300038443 Ga0395901_0009061 Ga0395901_0009061_8691_9089 129
655 3300038443 Ga0395901_0013690 Ga0395901_0013690_6166_6555 129
656 3300038443 Ga0395901_0624181 Ga0395901_0624181_15_407 129
657 3300038443 Ga0395901_0792224 Ga0395901_0792224_45_434 129
658 3300038996 Ga0242420_020251 Ga0242420_020251_637_1026 129
659 3300041443 Ga0451789_0958954 Ga0451789_0958954_26_418 129
660 3300041458 Ga0451798_0067737 Ga0451798_0067737_180_587 129
661 3300041459 Ga0451800_0962065 Ga0451800_0962065_122_511 129
662 3300041505 Ga0451849_1263875 Ga0451849_1263875_57_449 129
663 3300041512 Ga0451853_0324016 Ga0451853_0324016_159_566 129
664 3300042005 Ga0439448_0001968 Ga0439448_0001968_2603_2998 129
665 3300045836 Ga0466958_0000480 Ga0466958_0000480_5697_6092 129
666 3300045976 Ga0466967_0034221 Ga0466967_0034221_1132_1527 129
667 3300045976 Ga0466967_0389284 Ga0466967_0389284_528_935 129
668 3300045976 Ga0466967_1160218 Ga0466967_1160218_302_709 129
669 3300046454 Ga0495592_0552510 Ga0495592_0552510_91_492 129
670 3300046455 Ga0495603_0043669 Ga0495603_0043669_199_594 129
671 3300046455 Ga0495603_0305353 Ga0495603_0305353_311_718 129
672 3300046473 Ga0495582_0242706 Ga0495582_0242706_569_958 129
673 3300046474 Ga0495605_0343941 Ga0495605_0343941_148_546 129
674 3300046491 Ga0495584_0040909 Ga0495584_0040909_958_1347 129
675 3300046491 Ga0495584_0270372 Ga0495584_0270372_192_587 129
676 3300046491 Ga0495584_0339608 Ga0495584_0339608_125_523 129
677 3300046499 Ga0495594_0506557 Ga0495594_0506557_96_485 129
678 3300046506 Ga0495583_0287467 Ga0495583_0287467_181_570 129
679 3300046518 Ga0495631_0216644 Ga0495631_0216644_92_484 129
680 3300046520 Ga0495637_0076799 Ga0495637_0076799_591_989 129
681 3300046523 Ga0495644_0049631 Ga0495644_0049631_284_682 129
682 3300046525 Ga0495663_0009546 Ga0495663_0009546_2079_2468 129
683 3300046525 Ga0495663_0038384 Ga0495663_0038384_111_509 129
684 3300046526 Ga0495666_0025960 Ga0495666_0025960_1875_2270 129
685 3300046528 Ga0495642_0036910 Ga0495642_0036910_17_406 129
686 3300046528 Ga0495642_0163311 Ga0495642_0163311_18_416 129
687 3300046537 Ga0495598_0348435 Ga0495598_0348435_58_447 129
688 3300046537 Ga0495598_0439402 Ga0495598_0439402_107_505 129
689 3300046615 Ga0495656_0141384 Ga0495656_0141384_335_730 129
690 3300046615 Ga0495656_0791917 Ga0495656_0791917_91_480 129
691 3300046665 Ga0495661_0582427 Ga0495661_0582427_73_471 129
692 3300046674 Ga0495588_0322846 Ga0495588_0322846_309_716 129
693 3300046691 Ga0495670_0349269 Ga0495670_0349269_73_462 129
694 3300046694 Ga0495649_0137797 Ga0495649_0137797_398_805 129
695 3300047318 Ga0495636_0130097 Ga0495636_0130097_31_420 129
696 3300047318 Ga0495636_0376457 Ga0495636_0376457_122_511 129
697 3300047321 Ga0495676_0581928 Ga0495676_0581928_272_661 129
698 3300047323 Ga0495683_0343216 Ga0495683_0343216_107_511 129
699 3300048904 Ga0496101_0047646 Ga0496101_0047646_853_1251 129
700 3300048904 Ga0496101_0676087 Ga0496101_0676087_36_452 129
701 3300048905 Ga0496102_0023315 Ga0496102_0023315_2952_3350 129
702 3300048905 Ga0496102_0038410 Ga0496102_0038410_2152_2547 129
703 3300048905 Ga0496102_0241458 Ga0496102_0241458_852_1241 129
704 3300048906 Ga0496103_0073420 Ga0496103_0073420_1079_1477 129
705 3300048906 Ga0496103_0324372 Ga0496103_0324372_287_703 129
706 3300048907 Ga0496104_0016248 Ga0496104_0016248_3614_4012 129
707 3300048910 Ga0496107_0079003 Ga0496107_0079003_1883_2281 129
708 3300048912 Ga0496109_0032399 Ga0496109_0032399_410_826 129
709 3300048912 Ga0496109_0205067 Ga0496109_0205067_1184_1573 129
710 3300048913 Ga0496110_0000686 Ga0496110_0000686_5370_5768 129
711 3300048913 Ga0496110_0025179 Ga0496110_0025179_2184_2579 129
712 3300048914 Ga0496111_0003353 Ga0496111_0003353_1454_1852 129
713 3300048915 Ga0496112_0248553 Ga0496112_0248553_502_897 129
714 3300048915 Ga0496112_0290804 Ga0496112_0290804_391_807 129
715 3300048915 Ga0496112_0710091 Ga0496112_0710091_274_669 129
716 3300048916 Ga0496113_0328992 Ga0496113_0328992_158_547 129
717 3300048916 Ga0496113_0438040 Ga0496113_0438040_194_589 129
718 3300048917 Ga0496114_0047277 Ga0496114_0047277_791_1189 129
719 3300048917 Ga0496114_0067201 Ga0496114_0067201_2036_2431 129
720 3300050490 nmdc:mga03n38_129858_c1 nmdc:mga03n38_129858_c1_53_448 129
721 3300050492 nmdc:mga0yw44_136274_c1 nmdc:mga0yw44_136274_c1_293_685 129
722 3300050494 nmdc:mga06z11_350217_c1 nmdc:mga06z11_350217_c1_246_641 129
723 3300050507 nmdc:mga05p37_102731_c1 nmdc:mga05p37_102731_c1_1069_1461 129
724 3300050507 nmdc:mga05p37_41257_c1 nmdc:mga05p37_41257_c1_636_1031 129
725 3300050510 nmdc:mga06r32_324075_c1 nmdc:mga06r32_324075_c1_591_986 129
726 3300050511 nmdc:mga08y16_169317_c1 nmdc:mga08y16_169317_c1_623_1015 129
727 3300050511 nmdc:mga08y16_84209_c1 nmdc:mga08y16_84209_c1_1186_1581 129
728 3300050512 nmdc:mga0n895_151250_c1 nmdc:mga0n895_151250_c1_460_852 129
729 3300050512 nmdc:mga0n895_19897_c1 nmdc:mga0n895_19897_c1_2688_3083 129
730 3300050513 nmdc:mga0rr50_27592_c1 nmdc:mga0rr50_27592_c1_300_695 129
731 3300050514 nmdc:mga08x19_18219_c1 nmdc:mga08x19_18219_c1_1087_1482 129
732 3300050515 nmdc:mga0a205_329898_c1 nmdc:mga0a205_329898_c1_702_1097 129
733 3300050515 nmdc:mga0a205_469750_c1 nmdc:mga0a205_469750_c1_124_516 129

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03100

CcmE

CcmE

3

128

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
8h53-assembly2.cif.gz_C human asparaginyl-trna synthetase in complex with asparagine-amp 0.7997 35 112
8h53-assembly1.cif.gz_A human asparaginyl-trna synthetase in complex with asparagine-amp 0.7932 35 112
1j6q-assembly1.cif.gz_A solution structure and characterization of the heme chaperone ccme 0.7802 34 120
5ihe-assembly2.cif.gz_B d-family dna polymerase - dp1 subunit (3'-5' proof-reading exonuclease) 0.7504 34 112
6t8h-assembly1.cif.gz_A cryo-em structure of the dna-bound pold-pcna processive complex from p. abyssi 0.7435 34 112
ID Description Score Start End Superfamily
4ywkA02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.814 36 106 2.40.50.140
1j6qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7802 34 120 2.40.50.140
af_Q9GYL9_118_221_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.765 36 113 2.40.50.140
4me3A02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7579 37 113 2.40.50.140
4pofA02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7508 37 112 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A7W1JIT1-F1-model_v4 Cytochrome c maturation protein CcmE 0.8397 51 129 GO:0005886
GO:0017004
GO:0020037
AF-A0A7W1BRT6-F1-model_v4 Cytochrome c maturation protein CcmE 0.8193 26 129 GO:0005886
GO:0017004
GO:0020037
AF-A0A7W1JIT1-F1-model_v4 Cytochrome c maturation protein CcmE 0.8115 51 129 GO:0005886
GO:0017004
GO:0020037
AF-A0A7W0MXY0-F1-model_v4 RecG wedge domain-containing protein 0.8036 34 113 GO:0003677
GO:0003678
GO:0005524
GO:0006281
GO:0016787
AF-A0A550HTD9-F1-model_v4 DNA polymerase II small subunit (Pol II) (EC 2.7.7.7) (Exodeoxyribonuclease small subunit) (EC 3.1.11.1) 0.7891 36 114 GO:0003677
GO:0003887
GO:0006271
GO:0006308
GO:0008310
GO:0042575

Feature Viewer

pLDDT pTM Quality
81.02 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map