F477999

General Info

Members Datasets Scaffolds Average Seq Length
732 196 1464 205

Family's Representative Sequence

Representative Sequence 3300001990|JGI24737J22298_10004344|JGI24737J22298_100043443
Length 255
Sequence VTKVLLVDDHPMIGAALEMLLRNSDYELAGRARTAAEANKQISAIKPDLLLLDVHLPDASGLDVLRRLSRARFKPKVILITAGMDEAQLLTAAELXPQGMVLKTSDPGLLLECMDAVTAGRSWVDPEIAERTRQAEAKAASAPPLTRRERELIELVRQGLRNRDIAAELGVTEGTVKVYLHAIFDKLQVENRTELALRAAELISRXGLDLQLAAELDDPXGRELEELHCAFRALQHPREQFLAPQGHSGAPFRCD

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
167 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
168 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
171 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
172 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
173 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
179 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
180 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
181 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
184 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
195 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
196 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 1.64
Rhizosphere 97.68
Stem 0
Stem Tuber 0
Unclassified 8.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10004344 3300001990 Bacteria 4950
2 JGI24741J21665_1003861 3300001915 Bacteria 3461
3 JGI24740J21852_10001282 3300001979 Bacteria 11418
4 JGI24740J21852_10004638 3300001979 Bacteria 5897
5 JGI24739J22299_10001644 3300001989 Bacteria 8486
6 JGI24739J22299_10025559 3300001989 Bacteria 2076
7 JGI24739J22299_10099765 3300001989 Bacteria 877
8 JGI24737J22298_10002900 3300001990 Bacteria 6077
9 JGI24737J22298_10004225 3300001990 Bacteria 5023
10 JGI24737J22298_10023082 3300001990 Bacteria 1975
11 JGI24743J22301_10050464 3300001991 Bacteria 847
12 JGI24735J21928_10001952 3300002067 Bacteria 7248
13 JGI24735J21928_10002749 3300002067 Bacteria 6067
14 JGI24735J21928_10032828 3300002067 Unclassified 1536
15 JGI24738J21930_10022621 3300002075 Bacteria 1299
16 JGI24744J21845_10000254 3300002077 Bacteria 8669
17 rootH2_10061305 3300003320 Bacteria 2283
18 rootH1_10079218 3300003323 Bacteria 3566
19 Ga0070658_10013387 3300005327 Bacteria 6581
20 Ga0070658_10026507 3300005327 Bacteria 4650
21 Ga0070658_10100939 3300005327 Bacteria 2385
22 Ga0070658_10221444 3300005327 Bacteria 1600
23 Ga0070658_10451243 3300005327 Bacteria 1108
24 Ga0070683_100005100 3300005329 Bacteria 10921
25 Ga0070683_100024838 3300005329 Bacteria 5373
26 Ga0070683_100058892 3300005329 Bacteria 3568
27 Ga0070683_100458866 3300005329 Bacteria 1216
28 Ga0070690_100029089 3300005330 Bacteria 3424
29 Ga0070690_100038681 3300005330 Bacteria 3011
30 Ga0070670_100005108 3300005331 Bacteria 11046
31 Ga0070670_100036816 3300005331 Bacteria 4210
32 Ga0070670_100259335 3300005331 Bacteria 1515
33 Ga0070670_100376761 3300005331 Bacteria 1250
34 Ga0070670_100377281 3300005331 Bacteria 1249
35 Ga0068869_100604788 3300005334 Bacteria 926
36 Ga0070666_10007604 3300005335 Bacteria 6684
37 Ga0070666_10011369 3300005335 Bacteria 5584
38 Ga0070666_10045067 3300005335 Bacteria 2956
39 Ga0070666_10089347 3300005335 Bacteria 2114
40 Ga0070666_10105707 3300005335 Bacteria 1944
41 Ga0070666_10149504 3300005335 Bacteria 1629
42 Ga0070680_100001515 3300005336 Bacteria 16912
43 Ga0070680_100002175 3300005336 Bacteria 14449
44 Ga0070680_100034396 3300005336 Bacteria 4085
45 Ga0070680_100044744 3300005336 Bacteria 3597
46 Ga0070680_100144648 3300005336 Bacteria 1994
47 Ga0070680_100320126 3300005336 Bacteria 1316
48 Ga0070680_100646444 3300005336 Bacteria 909
49 Ga0070682_100003547 3300005337 Bacteria 8633
50 Ga0070682_100010527 3300005337 Bacteria 5249
51 Ga0070682_100025828 3300005337 Bacteria 3509
52 Ga0068868_100024888 3300005338 Bacteria 4546
53 Ga0068868_100026806 3300005338 Bacteria 4394
54 Ga0068868_100049418 3300005338 Bacteria 3301
55 Ga0068868_100422147 3300005338 Bacteria 1155
56 Ga0070660_100001438 3300005339 Bacteria 16242
57 Ga0070660_100006028 3300005339 Bacteria 8383
58 Ga0070660_100010187 3300005339 Bacteria 6635
59 Ga0070660_100014417 3300005339 Bacteria 5693
60 Ga0070660_100028353 3300005339 Bacteria 4188
61 Ga0070660_100028998 3300005339 Bacteria 4145
62 Ga0070660_100038851 3300005339 Bacteria 3615
63 Ga0070660_100050395 3300005339 Bacteria 3204
64 Ga0070660_100052000 3300005339 Bacteria 3157
65 Ga0070660_100111287 3300005339 Bacteria 2179
66 Ga0070660_100171174 3300005339 Bacteria 1754
67 Ga0070660_100204199 3300005339 Bacteria 1603
68 Ga0070660_100260545 3300005339 Bacteria 1416
69 Ga0070660_100347959 3300005339 Bacteria 1220
70 Ga0070689_100086588 3300005340 Bacteria 2464
71 Ga0070689_100369945 3300005340 Bacteria 1206
72 Ga0070691_10004510 3300005341 Bacteria 6319
73 Ga0070661_100003852 3300005344 Bacteria 10323
74 Ga0070661_100011576 3300005344 Bacteria 6148
75 Ga0070661_100018000 3300005344 Bacteria 5018
76 Ga0070661_100035690 3300005344 Bacteria 3612
77 Ga0070661_100077564 3300005344 Bacteria 2450
78 Ga0070661_100110693 3300005344 Bacteria 2050
79 Ga0070661_100120922 3300005344 Bacteria 1961
80 Ga0070661_100167309 3300005344 Unclassified 1668
81 Ga0070661_100392728 3300005344 Bacteria 1096
82 Ga0070661_100416800 3300005344 Bacteria 1064
83 Ga0070692_10096113 3300005345 Bacteria 1618
84 Ga0070692_10307664 3300005345 Bacteria 970
85 Ga0070668_100105278 3300005347 Bacteria 2240
86 Ga0070669_100099219 3300005353 Bacteria 2195
87 Ga0070675_100022564 3300005354 Bacteria 5031
88 Ga0070675_100092439 3300005354 Bacteria 2536
89 Ga0070675_100374579 3300005354 Bacteria 1266
90 Ga0070675_101021822 3300005354 Unclassified 759
91 Ga0070671_100007267 3300005355 Bacteria 8852
92 Ga0070671_100024364 3300005355 Bacteria 4953
93 Ga0070671_100032525 3300005355 Bacteria 4312
94 Ga0070671_100055146 3300005355 Bacteria 3306
95 Ga0070671_100091376 3300005355 Bacteria 2550
96 Ga0070671_100096754 3300005355 Bacteria 2475
97 Ga0070671_100133464 3300005355 Bacteria 2092
98 Ga0070671_100240423 3300005355 Bacteria 1537
99 Ga0070671_100276255 3300005355 Bacteria 1428
100 Ga0070674_100004347 3300005356 Bacteria 8076
101 Ga0070674_100007107 3300005356 Bacteria 6587
102 Ga0070674_100035943 3300005356 Bacteria 3322
103 Ga0070674_100041381 3300005356 Bacteria 3123
104 Ga0070674_100044892 3300005356 Bacteria 3017
105 Ga0070674_100109442 3300005356 Bacteria 2026
106 Ga0070673_100000937 3300005364 Bacteria 16526
107 Ga0070673_100008085 3300005364 Bacteria 6974
108 Ga0070673_100016365 3300005364 Bacteria 5242
109 Ga0070673_100174515 3300005364 Bacteria 1836
110 Ga0070673_101149466 3300005364 Bacteria 726
111 Ga0070688_100178946 3300005365 Bacteria 1469
112 Ga0070659_100027437 3300005366 Bacteria 4388
113 Ga0070659_100073134 3300005366 Bacteria 2728
114 Ga0070659_100074382 3300005366 Bacteria 2706
115 Ga0070659_100077498 3300005366 Bacteria 2651
116 Ga0070659_100105830 3300005366 Bacteria 2267
117 Ga0070659_100164796 3300005366 Unclassified 1813
118 Ga0070659_100210369 3300005366 Bacteria 1603
119 Ga0070659_100253783 3300005366 Bacteria 1458
120 Ga0070659_100485084 3300005366 Bacteria 1052
121 Ga0070659_100712172 3300005366 Bacteria 869
122 Ga0070659_100721495 3300005366 Unclassified 863
123 Ga0070667_100017428 3300005367 Bacteria 5953
124 Ga0070667_100035505 3300005367 Bacteria 4177
125 Ga0070667_100177829 3300005367 Bacteria 1881
126 Ga0070667_100375089 3300005367 Bacteria 1291
127 Ga0070667_100715635 3300005367 Bacteria 927
128 Ga0070714_100334864 3300005435 Bacteria 1418
129 Ga0070713_100001028 3300005436 Bacteria 17831
130 Ga0070713_100025629 3300005436 Bacteria 4614
131 Ga0070713_100364329 3300005436 Bacteria 1343
132 Ga0070663_100005148 3300005455 Bacteria 7740
133 Ga0070663_100055732 3300005455 Bacteria 2831
134 Ga0070663_100061429 3300005455 Bacteria 2706
135 Ga0070663_100158420 3300005455 Bacteria 1741
136 Ga0070663_100184901 3300005455 Unclassified 1619
137 Ga0070663_100543624 3300005455 Bacteria 970
138 Ga0070678_100001158 3300005456 Bacteria 13960
139 Ga0070678_100006078 3300005456 Bacteria 7045
140 Ga0070678_100015539 3300005456 Bacteria 4842
141 Ga0070678_100021280 3300005456 Bacteria 4274
142 Ga0070678_100034693 3300005456 Bacteria 3515
143 Ga0070678_100120146 3300005456 Bacteria 2071
144 Ga0070662_100004986 3300005457 Bacteria 8439
145 Ga0070662_100007983 3300005457 Bacteria 6885
146 Ga0070662_100025995 3300005457 Unclassified 4049
147 Ga0070662_100029902 3300005457 Bacteria 3806
148 Ga0070662_100038370 3300005457 Bacteria 3402
149 Ga0070662_100077749 3300005457 Bacteria 2463
150 Ga0070662_100102675 3300005457 Unclassified 2167
151 Ga0070662_100165153 3300005457 Bacteria 1734
152 Ga0070662_100173443 3300005457 Unclassified 1695
153 Ga0070662_100295616 3300005457 Bacteria 1314
154 Ga0070662_100371232 3300005457 Bacteria 1176
155 Ga0070662_100396706 3300005457 Bacteria 1138
156 Ga0070662_100602987 3300005457 Bacteria 924
157 Ga0070681_10017779 3300005458 Bacteria 7104
158 Ga0070681_10019823 3300005458 Bacteria 6736
159 Ga0070681_10066145 3300005458 Bacteria 3583
160 Ga0068867_100013773 3300005459 Bacteria 5726
161 Ga0068867_100054542 3300005459 Bacteria 2953
162 Ga0068867_100486966 3300005459 Bacteria 1058
163 Ga0068867_101100053 3300005459 Bacteria 725
164 Ga0070685_10295396 3300005466 Bacteria 1090
165 Ga0070679_100028575 3300005530 Bacteria 5499
166 Ga0070679_100077639 3300005530 Bacteria 3310
167 Ga0070679_100110822 3300005530 Bacteria 2731
168 Ga0070679_100133888 3300005530 Bacteria 2460
169 Ga0070679_100157225 3300005530 Bacteria 2248
170 Ga0070679_100234196 3300005530 Unclassified 1795
171 Ga0070679_100281964 3300005530 Bacteria 1614
172 Ga0070684_100003988 3300005535 Bacteria 11176
173 Ga0070684_100029647 3300005535 Bacteria 4640
174 Ga0070684_100033682 3300005535 Bacteria 4376
175 Ga0070684_100123818 3300005535 Bacteria 2327
176 Ga0070684_100160916 3300005535 Bacteria 2036
177 Ga0068853_100006908 3300005539 Bacteria 9060
178 Ga0068853_100012483 3300005539 Bacteria 6911
179 Ga0068853_100041858 3300005539 Bacteria 3915
180 Ga0068853_100323349 3300005539 Bacteria 1430
181 Ga0068853_100468595 3300005539 Bacteria 1186
182 Ga0068853_100792670 3300005539 Bacteria 907
183 Ga0070672_100001634 3300005543 Bacteria 13950
184 Ga0070672_100013444 3300005543 Bacteria 5782
185 Ga0070672_100025262 3300005543 Bacteria 4403
186 Ga0070672_100032692 3300005543 Bacteria 3930
187 Ga0070672_100106110 3300005543 Bacteria 2285
188 Ga0070672_100204649 3300005543 Bacteria 1651
189 Ga0070672_100337062 3300005543 Bacteria 1284
190 Ga0070672_100554489 3300005543 Bacteria 998
191 Ga0070686_100006651 3300005544 Bacteria 6437
192 Ga0070693_100016352 3300005547 Bacteria 3839
193 Ga0070693_100318533 3300005547 Unclassified 1054
194 Ga0070665_100014462 3300005548 Bacteria 7917
195 Ga0070665_100038345 3300005548 Bacteria 4817
196 Ga0070665_100169508 3300005548 Unclassified 2185
197 Ga0070665_100244586 3300005548 Bacteria 1794
198 Ga0068855_100017478 3300005563 Bacteria 8625
199 Ga0068855_100019174 3300005563 Bacteria 8220
200 Ga0068855_100028373 3300005563 Bacteria 6695
201 Ga0068855_100037724 3300005563 Bacteria 5744
202 Ga0068855_100052500 3300005563 Bacteria 4799
203 Ga0068855_100058966 3300005563 Bacteria 4493
204 Ga0068855_100066782 3300005563 Bacteria 4192
205 Ga0068855_100221856 3300005563 Bacteria 2119
206 Ga0068855_100386000 3300005563 Bacteria 1537
207 Ga0068855_100680884 3300005563 Bacteria 1102
208 Ga0068855_100918723 3300005563 Bacteria 924
209 Ga0070664_100002457 3300005564 Bacteria 14923
210 Ga0070664_100002747 3300005564 Bacteria 14203
211 Ga0070664_100006897 3300005564 Bacteria 9156
212 Ga0070664_100013637 3300005564 Bacteria 6623
213 Ga0070664_100015115 3300005564 Bacteria 6304
214 Ga0070664_100077385 3300005564 Bacteria 2860
215 Ga0070664_100139892 3300005564 Bacteria 2131
216 Ga0070664_100781409 3300005564 Bacteria 892
217 Ga0070664_101193818 3300005564 Bacteria 718
218 Ga0068857_100005444 3300005577 Bacteria 10855
219 Ga0068857_100019734 3300005577 Bacteria 5921
220 Ga0068857_100089112 3300005577 Bacteria 2760
221 Ga0068857_100089518 3300005577 Bacteria 2754
222 Ga0068857_100125624 3300005577 Bacteria 2311
223 Ga0068857_100162818 3300005577 Bacteria 2025
224 Ga0068854_100000880 3300005578 Bacteria 18038
225 Ga0068854_100001151 3300005578 Bacteria 15907
226 Ga0068854_100004990 3300005578 Bacteria 8371
227 Ga0068854_100066221 3300005578 Bacteria 2629
228 Ga0068854_100071612 3300005578 Bacteria 2536
229 Ga0068854_100209670 3300005578 Bacteria 1536
230 Ga0068854_100342900 3300005578 Bacteria 1220
231 Ga0068854_100714706 3300005578 Bacteria 866
232 Ga0068856_100008535 3300005614 Bacteria 9959
233 Ga0068856_100019929 3300005614 Bacteria 6509
234 Ga0068856_100055423 3300005614 Bacteria 3912
235 Ga0068856_100105456 3300005614 Bacteria 2813
236 Ga0068856_100142529 3300005614 Bacteria 2403
237 Ga0068856_100181257 3300005614 Bacteria 2119
238 Ga0068856_100215150 3300005614 Bacteria 1937
239 Ga0068856_100219960 3300005614 Bacteria 1914
240 Ga0068856_100592338 3300005614 Bacteria 1130
241 Ga0070702_100687338 3300005615 Bacteria 778
242 Ga0068852_100003663 3300005616 Bacteria 10767
243 Ga0068852_100004213 3300005616 Bacteria 10145
244 Ga0068852_100005297 3300005616 Bacteria 9211
245 Ga0068852_100008688 3300005616 Bacteria 7507
246 Ga0068852_100012887 3300005616 Bacteria 6374
247 Ga0068852_100033964 3300005616 Bacteria 4242
248 Ga0068852_100076803 3300005616 Bacteria 2950
249 Ga0068852_100091932 3300005616 Bacteria 2716
250 Ga0068852_100100815 3300005616 Bacteria 2606
251 Ga0068852_100117566 3300005616 Bacteria 2428
252 Ga0068852_100131728 3300005616 Bacteria 2303
253 Ga0068852_100224356 3300005616 Bacteria 1788
254 Ga0068852_100308787 3300005616 Bacteria 1533
255 Ga0068852_100700054 3300005616 Bacteria 1023
256 Ga0068852_101191125 3300005616 Bacteria 783
257 Ga0068859_100026043 3300005617 Bacteria 5868
258 Ga0068859_100063533 3300005617 Bacteria 3722
259 Ga0068859_100748601 3300005617 Bacteria 1066
260 Ga0068864_100003680 3300005618 Bacteria 12658
261 Ga0068864_100009660 3300005618 Bacteria 7959
262 Ga0068864_100061244 3300005618 Unclassified 3260
263 Ga0068864_100277680 3300005618 Bacteria 1563
264 Ga0068864_100900783 3300005618 Bacteria 873
265 Ga0068866_10014660 3300005718 Bacteria 3466
266 Ga0068851_10015077 3300005834 Bacteria 3678
267 Ga0068851_10031219 3300005834 Bacteria 2645
268 Ga0068851_10037239 3300005834 Bacteria 2438
269 Ga0068851_10057076 3300005834 Bacteria 1993
270 Ga0068851_10085656 3300005834 Bacteria 1652
271 Ga0068870_10037076 3300005840 Bacteria 2512
272 Ga0068863_100002267 3300005841 Bacteria 19113
273 Ga0068863_100007793 3300005841 Bacteria 10471
274 Ga0068863_100015910 3300005841 Bacteria 7215
275 Ga0068863_100063120 3300005841 Bacteria 3503
276 Ga0068863_100207737 3300005841 Bacteria 1885
277 Ga0068858_100005290 3300005842 Bacteria 12652
278 Ga0068858_100037337 3300005842 Bacteria 4505
279 Ga0068860_100336798 3300005843 Bacteria 1483
280 Ga0068860_100803270 3300005843 Unclassified 954
281 Ga0081539_10017407 3300005985 Bacteria 5049
282 Ga0070717_10026157 3300006028 Bacteria 4653
283 Ga0070717_10079075 3300006028 Bacteria 2757
284 Ga0070712_100345727 3300006175 Bacteria 1216
285 Ga0075366_10046039 3300006195 Bacteria 2585
286 Ga0097621_100035814 3300006237 Bacteria 3967
287 Ga0097621_100127390 3300006237 Bacteria 2164
288 Ga0097621_100482365 3300006237 Unclassified 1121
289 Ga0068871_100035112 3300006358 Bacteria 3983
290 Ga0068871_100049304 3300006358 Bacteria 3403
291 Ga0068865_100039856 3300006881 Bacteria 3189
292 Ga0068865_100110272 3300006881 Bacteria 2029
293 Ga0097620_100026045 3300006931 Bacteria 5868
294 Ga0097620_100063532 3300006931 Bacteria 3722
295 Ga0097620_100748552 3300006931 Bacteria 1066
296 Ga0105240_10016800 3300009093 Bacteria 9898
297 Ga0105240_10032076 3300009093 Bacteria 6804
298 Ga0105240_11104356 3300009093 Bacteria 844
299 Ga0105245_10342355 3300009098 Bacteria 1479
300 Ga0105245_11131565 3300009098 Bacteria 830
301 Ga0105243_10009918 3300009148 Bacteria 7242
302 Ga0105248_10018834 3300009177 Bacteria 7635
303 Ga0105248_10077187 3300009177 Bacteria 3744
304 Ga0105248_10098887 3300009177 Bacteria 3287
305 Ga0105248_10174060 3300009177 Bacteria 2426
306 Ga0105248_10550087 3300009177 Bacteria 1302
307 Ga0105237_10152283 3300009545 Bacteria 2309
308 Ga0105238_10017594 3300009551 Bacteria 7266
309 Ga0105238_10140015 3300009551 Bacteria 2396
310 Ga0105238_10303682 3300009551 Bacteria 1580
311 Ga0105249_10449877 3300009553 Unclassified 1326
312 Ga0105239_10431436 3300010375 Bacteria 1494
313 Ga0105239_10952628 3300010375 Bacteria 986
314 Ga0105246_10030406 3300011119 Bacteria 3566
315 Ga0157373_10007128 3300013100 Bacteria 8337
316 Ga0157373_10011683 3300013100 Bacteria 6448
317 Ga0157373_10034406 3300013100 Bacteria 3639
318 Ga0157373_10045311 3300013100 Bacteria 3139
319 Ga0157373_10138533 3300013100 Bacteria 1711
320 Ga0157373_10159902 3300013100 Unclassified 1585
321 Ga0157371_10005460 3300013102 Bacteria 10718
322 Ga0157371_10013053 3300013102 Bacteria 6324
323 Ga0157371_10065970 3300013102 Unclassified 2564
324 Ga0157371_10165975 3300013102 Bacteria 1577
325 Ga0157371_10213360 3300013102 Bacteria 1385
326 Ga0157371_10241591 3300013102 Bacteria 1299
327 Ga0157370_10007934 3300013104 Bacteria 11494
328 Ga0157370_10014992 3300013104 Bacteria 7902
329 Ga0157370_10016408 3300013104 Bacteria 7497
330 Ga0157370_10031461 3300013104 Bacteria 5189
331 Ga0157370_10294220 3300013104 Bacteria 1499
332 Ga0157370_10410176 3300013104 Unclassified 1247
333 Ga0157370_10530418 3300013104 Bacteria 1080
334 Ga0157369_10001567 3300013105 Bacteria 27989
335 Ga0157369_10039016 3300013105 Bacteria 5191
336 Ga0157369_10075273 3300013105 Bacteria 3620
337 Ga0157369_10149394 3300013105 Bacteria 2470
338 Ga0157369_10315556 3300013105 Bacteria 1625
339 Ga0157374_10107310 3300013296 Bacteria 2683
340 Ga0157378_10009617 3300013297 Bacteria 8417
341 Ga0163162_10001772 3300013306 Bacteria 20231
342 Ga0163162_10263697 3300013306 Bacteria 1854
343 Ga0157372_10024553 3300013307 Bacteria 6550
344 Ga0157372_10029242 3300013307 Bacteria 6014
345 Ga0157372_10113217 3300013307 Bacteria 3110
346 Ga0157372_10208252 3300013307 Unclassified 2266
347 Ga0157372_10518164 3300013307 Bacteria 1390
348 Ga0157375_10001232 3300013308 Bacteria 22092
349 Ga0157375_10052769 3300013308 Bacteria 3998
350 Ga0157375_10180527 3300013308 Bacteria 2262
351 Ga0163163_10044455 3300014325 Bacteria 4357
352 Ga0163163_10391462 3300014325 Unclassified 1448
353 Ga0157379_10183070 3300014968 Bacteria 1893
354 Ga0206354_10713871 3300020081 Bacteria 4189
355 Ga0206353_10656612 3300020082 Bacteria 802
356 Ga0206353_11504771 3300020082 Bacteria 3904
357 Ga0213876_10036374 3300021384 Bacteria 2596
358 Ga0207697_10009346 3300025315 Bacteria 4242
359 Ga0207656_10022357 3300025321 Bacteria 2537
360 Ga0207656_10056173 3300025321 Bacteria 1715
361 Ga0207682_10004465 3300025893 Bacteria 5846
362 Ga0207688_10013653 3300025901 Bacteria 4416
363 Ga0207688_10038608 3300025901 Bacteria 2651
364 Ga0207688_10142549 3300025901 Bacteria 1411
365 Ga0207680_10012836 3300025903 Bacteria 4280
366 Ga0207680_10016702 3300025903 Bacteria 3859
367 Ga0207680_10033254 3300025903 Bacteria 2940
368 Ga0207680_10068671 3300025903 Bacteria 2187
369 Ga0207680_10082399 3300025903 Bacteria 2024
370 Ga0207680_10175304 3300025903 Bacteria 1447
371 Ga0207680_10386604 3300025903 Bacteria 987
372 Ga0207647_10001648 3300025904 Bacteria 17173
373 Ga0207647_10008050 3300025904 Bacteria 7578
374 Ga0207647_10018641 3300025904 Bacteria 4687
375 Ga0207647_10035387 3300025904 Bacteria 3183
376 Ga0207647_10072604 3300025904 Bacteria 2075
377 Ga0207647_10074554 3300025904 Unclassified 2043
378 Ga0207647_10140505 3300025904 Bacteria 1415
379 Ga0207647_10229415 3300025904 Bacteria 1068
380 Ga0207647_10293646 3300025904 Bacteria 926
381 Ga0207645_10017895 3300025907 Bacteria 4674
382 Ga0207645_10102932 3300025907 Bacteria 1843
383 Ga0207705_10000275 3300025909 Bacteria 49216
384 Ga0207705_10014446 3300025909 Bacteria 5684
385 Ga0207705_10014962 3300025909 Bacteria 5577
386 Ga0207705_10015513 3300025909 Bacteria 5467
387 Ga0207705_10016667 3300025909 Bacteria 5263
388 Ga0207705_10043266 3300025909 Bacteria 3235
389 Ga0207705_10058968 3300025909 Bacteria 2769
390 Ga0207705_10062866 3300025909 Bacteria 2682
391 Ga0207705_10106635 3300025909 Bacteria 2066
392 Ga0207705_10205381 3300025909 Bacteria 1493
393 Ga0207705_10449725 3300025909 Bacteria 999
394 Ga0207707_10003065 3300025912 Bacteria 14840
395 Ga0207707_10428405 3300025912 Bacteria 1133
396 Ga0207707_10478013 3300025912 Unclassified 1064
397 Ga0207707_10531831 3300025912 Bacteria 1000
398 Ga0207695_10008882 3300025913 Bacteria 12513
399 Ga0207695_10304453 3300025913 Unclassified 1485
400 Ga0207671_10093311 3300025914 Bacteria 2271
401 Ga0207693_10110643 3300025915 Bacteria 2154
402 Ga0207660_10001990 3300025917 Bacteria 13616
403 Ga0207660_10008493 3300025917 Bacteria 6642
404 Ga0207660_10027304 3300025917 Bacteria 3893
405 Ga0207660_10040452 3300025917 Bacteria 3264
406 Ga0207660_10126543 3300025917 Bacteria 1941
407 Ga0207660_10157475 3300025917 Bacteria 1749
408 Ga0207662_10040832 3300025918 Bacteria 2729
409 Ga0207657_10001025 3300025919 Bacteria 29642
410 Ga0207657_10003842 3300025919 Bacteria 15952
411 Ga0207657_10004810 3300025919 Bacteria 14233
412 Ga0207657_10005130 3300025919 Bacteria 13726
413 Ga0207657_10015099 3300025919 Bacteria 7501
414 Ga0207657_10017291 3300025919 Bacteria 6922
415 Ga0207657_10034238 3300025919 Bacteria 4570
416 Ga0207657_10035116 3300025919 Bacteria 4500
417 Ga0207657_10039261 3300025919 Bacteria 4209
418 Ga0207657_10045466 3300025919 Bacteria 3853
419 Ga0207657_10052507 3300025919 Unclassified 3537
420 Ga0207657_10057033 3300025919 Bacteria 3368
421 Ga0207657_10135360 3300025919 Bacteria 2017
422 Ga0207657_10466014 3300025919 Bacteria 991
423 Ga0207657_10547120 3300025919 Bacteria 905
424 Ga0207649_10004550 3300025920 Bacteria 7531
425 Ga0207649_10008753 3300025920 Bacteria 5526
426 Ga0207649_10061533 3300025920 Unclassified 2363
427 Ga0207649_10136753 3300025920 Unclassified 1672
428 Ga0207649_10137708 3300025920 Bacteria 1666
429 Ga0207649_10175105 3300025920 Bacteria 1498
430 Ga0207652_10016593 3300025921 Bacteria 6016
431 Ga0207652_10036986 3300025921 Bacteria 4130
432 Ga0207652_10062665 3300025921 Bacteria 3213
433 Ga0207652_10120250 3300025921 Bacteria 2336
434 Ga0207681_10072210 3300025923 Bacteria 2410
435 Ga0207681_10084057 3300025923 Bacteria 2255
436 Ga0207694_10021310 3300025924 Bacteria 4911
437 Ga0207694_10035363 3300025924 Bacteria 3832
438 Ga0207650_10004522 3300025925 Bacteria 9509
439 Ga0207650_10089873 3300025925 Bacteria 2345
440 Ga0207659_10020133 3300025926 Bacteria 4404
441 Ga0207659_10022843 3300025926 Bacteria 4169
442 Ga0207659_10112133 3300025926 Bacteria 2075
443 Ga0207659_10440468 3300025926 Bacteria 1096
444 Ga0207687_10773692 3300025927 Bacteria 818
445 Ga0207700_10092057 3300025928 Bacteria 2396
446 Ga0207700_10165483 3300025928 Bacteria 1840
447 Ga0207700_10356179 3300025928 Bacteria 1275
448 Ga0207664_10034392 3300025929 Bacteria 3903
449 Ga0207664_10190318 3300025929 Bacteria 1766
450 Ga0207664_10332772 3300025929 Bacteria 1342
451 Ga0207644_10000512 3300025931 Bacteria 25021
452 Ga0207644_10001487 3300025931 Bacteria 15074
453 Ga0207644_10013523 3300025931 Bacteria 5444
454 Ga0207644_10013877 3300025931 Bacteria 5381
455 Ga0207644_10035329 3300025931 Bacteria 3501
456 Ga0207644_10134772 3300025931 Bacteria 1895
457 Ga0207644_10199723 3300025931 Bacteria 1577
458 Ga0207644_10334318 3300025931 Bacteria 1227
459 Ga0207644_10420778 3300025931 Bacteria 1094
460 Ga0207690_10003557 3300025932 Bacteria 9273
461 Ga0207690_10006226 3300025932 Bacteria 7065
462 Ga0207690_10014139 3300025932 Bacteria 4814
463 Ga0207690_10016775 3300025932 Bacteria 4463
464 Ga0207690_10075008 3300025932 Unclassified 2344
465 Ga0207690_10119811 3300025932 Bacteria 1910
466 Ga0207690_10123326 3300025932 Unclassified 1885
467 Ga0207690_10252047 3300025932 Bacteria 1364
468 Ga0207690_10330024 3300025932 Bacteria 1201
469 Ga0207690_10466246 3300025932 Unclassified 1017
470 Ga0207690_10756197 3300025932 Unclassified 801
471 Ga0207706_10000285 3300025933 Bacteria 55179
472 Ga0207706_10001588 3300025933 Bacteria 22567
473 Ga0207706_10002960 3300025933 Bacteria 16388
474 Ga0207706_10006959 3300025933 Bacteria 10453
475 Ga0207706_10016724 3300025933 Bacteria 6621
476 Ga0207706_10029351 3300025933 Bacteria 4910
477 Ga0207706_10031288 3300025933 Bacteria 4741
478 Ga0207706_10043572 3300025933 Bacteria 3976
479 Ga0207706_10050041 3300025933 Bacteria 3693
480 Ga0207706_10064119 3300025933 Bacteria 3235
481 Ga0207706_10104470 3300025933 Unclassified 2492
482 Ga0207706_10134869 3300025933 Unclassified 2172
483 Ga0207706_10335572 3300025933 Bacteria 1315
484 Ga0207706_10341950 3300025933 Bacteria 1301
485 Ga0207706_10542028 3300025933 Bacteria 1002
486 Ga0207706_10592920 3300025933 Bacteria 952
487 Ga0207686_10013596 3300025934 Bacteria 4507
488 Ga0207686_10449703 3300025934 Bacteria 991
489 Ga0207709_10137409 3300025935 Bacteria 1675
490 Ga0207670_10578451 3300025936 Bacteria 920
491 Ga0207670_10995631 3300025936 Bacteria 705
492 Ga0207669_10082301 3300025937 Unclassified 2066
493 Ga0207669_10083539 3300025937 Bacteria 2054
494 Ga0207669_10099280 3300025937 Bacteria 1919
495 Ga0207669_10682371 3300025937 Bacteria 843
496 Ga0207704_10045385 3300025938 Bacteria 2611
497 Ga0207704_10766755 3300025938 Unclassified 803
498 Ga0207665_10083765 3300025939 Bacteria 2200
499 Ga0207691_10009222 3300025940 Bacteria 9470
500 Ga0207691_10027747 3300025940 Bacteria 5306
501 Ga0207691_10032059 3300025940 Bacteria 4902
502 Ga0207691_10038264 3300025940 Bacteria 4439
503 Ga0207691_10053790 3300025940 Bacteria 3674
504 Ga0207691_10131090 3300025940 Bacteria 2215
505 Ga0207691_10189418 3300025940 Bacteria 1795
506 Ga0207711_10010312 3300025941 Bacteria 7760
507 Ga0207711_10018806 3300025941 Bacteria 5744
508 Ga0207711_10018900 3300025941 Bacteria 5730
509 Ga0207711_10075931 3300025941 Bacteria 2925
510 Ga0207711_10277501 3300025941 Bacteria 1543
511 Ga0207711_10366966 3300025941 Bacteria 1335
512 Ga0207689_10014288 3300025942 Bacteria 6757
513 Ga0207661_10012819 3300025944 Bacteria 6107
514 Ga0207661_10116040 3300025944 Bacteria 2272
515 Ga0207661_10172896 3300025944 Bacteria 1881
516 Ga0207661_10464437 3300025944 Bacteria 1154
517 Ga0207679_10002516 3300025945 Bacteria 11298
518 Ga0207679_10011199 3300025945 Bacteria 5796
519 Ga0207679_10049824 3300025945 Bacteria 3057
520 Ga0207679_10064262 3300025945 Bacteria 2742
521 Ga0207679_10123108 3300025945 Unclassified 2068
522 Ga0207679_10136349 3300025945 Bacteria 1977
523 Ga0207667_10016328 3300025949 Bacteria 8391
524 Ga0207667_10021454 3300025949 Bacteria 7156
525 Ga0207667_10042773 3300025949 Bacteria 4813
526 Ga0207667_10050408 3300025949 Bacteria 4392
527 Ga0207667_10052691 3300025949 Bacteria 4284
528 Ga0207667_10065591 3300025949 Bacteria 3786
529 Ga0207667_10120019 3300025949 Bacteria 2709
530 Ga0207667_10132647 3300025949 Bacteria 2566
531 Ga0207667_10152977 3300025949 Bacteria 2374
532 Ga0207667_10176543 3300025949 Bacteria 2194
533 Ga0207667_10225220 3300025949 Unclassified 1921
534 Ga0207667_10471554 3300025949 Bacteria 1275
535 Ga0207651_10003373 3300025960 Bacteria 7841
536 Ga0207651_10013612 3300025960 Bacteria 4662
537 Ga0207651_10092843 3300025960 Bacteria 2214
538 Ga0207651_10362611 3300025960 Bacteria 1223
539 Ga0207668_10174061 3300025972 Bacteria 1691
540 Ga0207668_10396289 3300025972 Bacteria 1166
541 Ga0207640_10010004 3300025981 Bacteria 5327
542 Ga0207640_10025367 3300025981 Bacteria 3588
543 Ga0207640_10068812 3300025981 Bacteria 2374
544 Ga0207640_10094180 3300025981 Bacteria 2082
545 Ga0207640_10317394 3300025981 Bacteria 1239
546 Ga0207640_10542415 3300025981 Bacteria 976
547 Ga0207640_10901895 3300025981 Bacteria 772
548 Ga0207658_10042405 3300025986 Bacteria 3301
549 Ga0207658_10185339 3300025986 Bacteria 1726
550 Ga0207677_10016724 3300026023 Bacteria 4353
551 Ga0207677_10102922 3300026023 Bacteria 2107
552 Ga0207677_10252861 3300026023 Unclassified 1432
553 Ga0207677_10318626 3300026023 Bacteria 1291
554 Ga0207703_10008400 3300026035 Bacteria 8163
555 Ga0207703_10009494 3300026035 Bacteria 7635
556 Ga0207639_10012147 3300026041 Bacteria 5991
557 Ga0207639_10013204 3300026041 Bacteria 5774
558 Ga0207639_10037023 3300026041 Bacteria 3621
559 Ga0207639_10135505 3300026041 Bacteria 2044
560 Ga0207639_10323477 3300026041 Bacteria 1370
561 Ga0207678_10000385 3300026067 Bacteria 40115
562 Ga0207678_10006308 3300026067 Bacteria 10531
563 Ga0207678_10011949 3300026067 Bacteria 7624
564 Ga0207678_10013433 3300026067 Bacteria 7187
565 Ga0207678_10022100 3300026067 Bacteria 5574
566 Ga0207678_10027963 3300026067 Bacteria 4923
567 Ga0207678_10041782 3300026067 Bacteria 3974
568 Ga0207678_10065487 3300026067 Bacteria 3120
569 Ga0207678_10072091 3300026067 Bacteria 2960
570 Ga0207678_10220978 3300026067 Unclassified 1621
571 Ga0207678_10715986 3300026067 Bacteria 881
572 Ga0207702_10026922 3300026078 Bacteria 4775
573 Ga0207702_10071067 3300026078 Bacteria 2995
574 Ga0207702_10096153 3300026078 Bacteria 2604
575 Ga0207702_10107840 3300026078 Bacteria 2470
576 Ga0207702_10156095 3300026078 Bacteria 2080
577 Ga0207702_10225455 3300026078 Bacteria 1748
578 Ga0207702_10421186 3300026078 Bacteria 1291
579 Ga0207702_10606449 3300026078 Bacteria 1074
580 Ga0207702_10618330 3300026078 Bacteria 1064
581 Ga0207641_10006980 3300026088 Bacteria 9448
582 Ga0207641_10011911 3300026088 Bacteria 7134
583 Ga0207648_10007626 3300026089 Bacteria 10608
584 Ga0207648_10016245 3300026089 Bacteria 6811
585 Ga0207648_10055027 3300026089 Bacteria 3474
586 Ga0207648_10618859 3300026089 Bacteria 999
587 Ga0207648_10623490 3300026089 Bacteria 995
588 Ga0207676_10006009 3300026095 Bacteria 8561
589 Ga0207676_10012804 3300026095 Bacteria 6019
590 Ga0207676_10044474 3300026095 Unclassified 3426
591 Ga0207676_10285050 3300026095 Bacteria 1501
592 Ga0207676_11090354 3300026095 Bacteria 789
593 Ga0207674_10002718 3300026116 Bacteria 22070
594 Ga0207674_10003126 3300026116 Bacteria 20421
595 Ga0207674_10006989 3300026116 Bacteria 13205
596 Ga0207674_10052979 3300026116 Bacteria 4136
597 Ga0207674_10234436 3300026116 Bacteria 1783
598 Ga0207675_100066345 3300026118 Bacteria 3373
599 Ga0207683_10007467 3300026121 Bacteria 9377
600 Ga0207683_10011229 3300026121 Bacteria 7634
601 Ga0207683_10031640 3300026121 Bacteria 4591
602 Ga0207683_10152866 3300026121 Bacteria 2083
603 Ga0207698_10000125 3300026142 Bacteria 48032
604 Ga0207698_10003409 3300026142 Bacteria 9567
605 Ga0207698_10009627 3300026142 Bacteria 6170
606 Ga0207698_10015566 3300026142 Bacteria 5097
607 Ga0207698_10060387 3300026142 Bacteria 2948
608 Ga0207698_10061835 3300026142 Bacteria 2921
609 Ga0207698_10125033 3300026142 Bacteria 2185
610 Ga0207698_10154323 3300026142 Bacteria 1998
611 Ga0207698_10244912 3300026142 Bacteria 1636
612 Ga0207698_10254741 3300026142 Bacteria 1608
613 Ga0207698_10264749 3300026142 Bacteria 1581
614 Ga0207698_10577656 3300026142 Unclassified 1105
615 Ga0207698_10590065 3300026142 Bacteria 1094
616 Ga0268266_10137718 3300028379 Bacteria 2188
617 Ga0268266_10166860 3300028379 Bacteria 1995
618 Ga0268266_10422563 3300028379 Bacteria 1263
619 Ga0307410_10042027 3300031852 Bacteria 3018
620 Ga0307410_10112907 3300031852 Bacteria 1969
621 Ga0307406_10256883 3300031901 Bacteria 1319
622 Ga0307412_10022867 3300031911 Bacteria 3839
623 Ga0307409_100035562 3300031995 Bacteria 3651
624 Ga0307416_100029624 3300032002 Bacteria 4092
625 Ga0307415_100012022 3300032126 Bacteria 4987
626 Ga0307415_100162700 3300032126 Bacteria 1731
627 Ga0307415_100239529 3300032126 Bacteria 1466
628 Ga0373946_0053256 3300035171 Bacteria 1699
629 Ga0373935_0197613 3300035692 Bacteria 1388
630 Ga0373947_0397264 3300035725 Bacteria 929
631 Ga0373925_0046755 3300037068 Bacteria 3219
632 Ga0395899_0018221 3300037312 Bacteria 5341
633 Ga0395899_0027624 3300037312 Bacteria 4276
634 Ga0395899_0236829 3300037312 Bacteria 1258
635 Ga0395900_0001979 3300037418 Bacteria 23128
636 Ga0395900_0095326 3300037418 Bacteria 3057
637 Ga0395900_0138479 3300037418 Bacteria 2493
638 Ga0395900_0147778 3300037418 Bacteria 2403
639 Ga0395900_0160267 3300037418 Bacteria 2295
640 Ga0395900_0167307 3300037418 Bacteria 2240
641 Ga0395900_0184000 3300037418 Unclassified 2121
642 Ga0395900_0188087 3300037418 Bacteria 2095
643 Ga0395900_0189109 3300037418 Bacteria 2089
644 Ga0395900_0837670 3300037418 Unclassified 846
645 Ga0395898_0022058 3300037466 Bacteria 6450
646 Ga0395898_0065705 3300037466 Bacteria 3516
647 Ga0395898_0072735 3300037466 Bacteria 3321
648 Ga0395898_0114564 3300037466 Bacteria 2583
649 Ga0395898_0117106 3300037466 Bacteria 2553
650 Ga0395898_0374807 3300037466 Bacteria 1357
651 Ga0395898_1025833 3300037466 Bacteria 760
652 Ga0395905_0018451 3300037471 Bacteria 6622
653 Ga0395905_0019864 3300037471 Bacteria 6367
654 Ga0395905_0028967 3300037471 Bacteria 5219
655 Ga0395905_0071101 3300037471 Bacteria 3262
656 Ga0395905_0074945 3300037471 Unclassified 3171
657 Ga0395905_0108402 3300037471 Bacteria 2607
658 Ga0395905_0124106 3300037471 Bacteria 2428
659 Ga0395905_0130302 3300037471 Bacteria 2365
660 Ga0395905_0156718 3300037471 Unclassified 2142
661 Ga0395905_0360803 3300037471 Unclassified 1346
662 Ga0395905_0564086 3300037471 Bacteria 1040
663 Ga0395901_0013323 3300038443 Bacteria 8352
664 Ga0395901_0055625 3300038443 Bacteria 4115
665 Ga0395901_0076934 3300038443 Bacteria 3482
666 Ga0395901_0179171 3300038443 Unclassified 2222
667 Ga0395901_0180861 3300038443 Bacteria 2211
668 Ga0395901_0190050 3300038443 Bacteria 2153
669 Ga0395901_0211218 3300038443 Bacteria 2031
670 Ga0395901_0244771 3300038443 Bacteria 1869
671 Ga0395901_0298898 3300038443 Bacteria 1669
672 Ga0466969_0020205 3300044656 Bacteria 3451
673 Ga0466966_0004707 3300044684 Bacteria 8982
674 Ga0466966_0064695 3300044684 Bacteria 2301
675 Ga0466961_0029562 3300044693 Bacteria 3520
676 Ga0466961_0093309 3300044693 Bacteria 1899
677 Ga0466961_0364253 3300044693 Bacteria 879
678 Ga0466961_0430332 3300044693 Unclassified 799
679 Ga0466963_0006661 3300044694 Bacteria 6859
680 Ga0466963_0053525 3300044694 Bacteria 2680
681 Ga0466963_0061139 3300044694 Bacteria 2517
682 Ga0466963_0143285 3300044694 Bacteria 1656
683 Ga0466964_0020725 3300044706 Bacteria 2534
684 Ga0466971_0150349 3300044719 Unclassified 1087
685 Ga0466968_0006874 3300044735 Bacteria 4307
686 Ga0466970_0011936 3300044765 Bacteria 4434
687 Ga0466970_0198217 3300044765 Bacteria 1117
688 Ga0466957_0053888 3300044842 Bacteria 2454
689 Ga0466957_0054383 3300044842 Bacteria 2443
690 Ga0466957_0182680 3300044842 Bacteria 1370
691 Ga0466957_0260096 3300044842 Bacteria 1156
692 Ga0466959_0010323 3300045049 Bacteria 6669
693 Ga0466959_0144933 3300045049 Bacteria 1676
694 Ga0466959_0164503 3300045049 Bacteria 1558
695 Ga0466958_0007456 3300045836 Bacteria 6020
696 Ga0466958_0044105 3300045836 Bacteria 2687
697 Ga0466958_0117383 3300045836 Bacteria 1664
698 Ga0466967_0027347 3300045976 Bacteria 4743
699 Ga0466967_0102797 3300045976 Bacteria 2614
700 Ga0466967_0107889 3300045976 Bacteria 2554
701 Ga0466967_0181808 3300045976 Bacteria 1984
702 Ga0466967_0192548 3300045976 Unclassified 1928
703 Ga0466967_0429722 3300045976 Bacteria 1288
704 Ga0466967_0470907 3300045976 Bacteria 1230
705 Ga0495605_0205984 3300046474 Bacteria 856
706 Ga0495663_0002096 3300046525 Bacteria 6099
707 Ga0495663_0132127 3300046525 Unclassified 842
708 Ga0495621_0001157 3300046539 Bacteria 6826
709 Ga0495668_0008968 3300046616 Bacteria 6177
710 Ga0495625_0359906 3300046660 Unclassified 918
711 Ga0495669_0002800 3300046684 Bacteria 7148
712 Ga0495669_0090297 3300046684 Unclassified 1413
713 Ga0495669_0431395 3300046684 Bacteria 639
714 Ga0495677_0001514 3300047445 Bacteria 9354
715 Ga0495677_0140881 3300047445 Bacteria 926
716 Ga0496104_0294332 3300048907 Bacteria 1536
717 Ga0496106_0370589 3300048909 Unclassified 1151
718 Ga0496108_0004792 3300048911 Bacteria 10914
719 Ga0496108_0270973 3300048911 Unclassified 1478
720 Ga0496109_0098739 3300048912 Unclassified 2707
721 Ga0496110_0054913 3300048913 Bacteria 3504
722 Ga0496111_0225280 3300048914 Bacteria 1393
723 Ga0496112_0019551 3300048915 Bacteria 6395
724 Ga0496112_0173384 3300048915 Unclassified 2122
725 Ga0496113_0036658 3300048916 Bacteria 3594
726 Ga0496113_0108254 3300048916 Bacteria 2160
727 Ga0496113_0165678 3300048916 Bacteria 1749
728 Ga0501080_0071919 3300049742 Unclassified 3218
729 nmdc:mga0k408_79305_c1 3300050493 Unclassified 1921
730 Ga0495655_0009504 3300053083 Bacteria 1888
731 Ga0466962_0009267 3300061719 Bacteria 4716
732 Ga0466962_0031353 3300061719 Bacteria 2545
733 JGI24737J22298_10004344
734 JGI24741J21665_1003861
735 JGI24740J21852_10001282
736 JGI24740J21852_10004638
737 JGI24739J22299_10001644
738 JGI24739J22299_10025559
739 JGI24739J22299_10099765
740 JGI24737J22298_10002900
741 JGI24737J22298_10004225
742 JGI24737J22298_10023082
743 JGI24743J22301_10050464
744 JGI24735J21928_10001952
745 JGI24735J21928_10002749
746 JGI24735J21928_10032828
747 JGI24738J21930_10022621
748 JGI24744J21845_10000254
749 rootH2_10061305
750 rootH1_10079218
751 Ga0070658_10013387
752 Ga0070658_10026507
753 Ga0070658_10100939
754 Ga0070658_10221444
755 Ga0070658_10451243
756 Ga0070683_100005100
757 Ga0070683_100024838
758 Ga0070683_100058892
759 Ga0070683_100458866
760 Ga0070690_100029089
761 Ga0070690_100038681
762 Ga0070670_100005108
763 Ga0070670_100036816
764 Ga0070670_100259335
765 Ga0070670_100376761
766 Ga0070670_100377281
767 Ga0068869_100604788
768 Ga0070666_10007604
769 Ga0070666_10011369
770 Ga0070666_10045067
771 Ga0070666_10089347
772 Ga0070666_10105707
773 Ga0070666_10149504
774 Ga0070680_100001515
775 Ga0070680_100002175
776 Ga0070680_100034396
777 Ga0070680_100044744
778 Ga0070680_100144648
779 Ga0070680_100320126
780 Ga0070680_100646444
781 Ga0070682_100003547
782 Ga0070682_100010527
783 Ga0070682_100025828
784 Ga0068868_100024888
785 Ga0068868_100026806
786 Ga0068868_100049418
787 Ga0068868_100422147
788 Ga0070660_100001438
789 Ga0070660_100006028
790 Ga0070660_100010187
791 Ga0070660_100014417
792 Ga0070660_100028353
793 Ga0070660_100028998
794 Ga0070660_100038851
795 Ga0070660_100050395
796 Ga0070660_100052000
797 Ga0070660_100111287
798 Ga0070660_100171174
799 Ga0070660_100204199
800 Ga0070660_100260545
801 Ga0070660_100347959
802 Ga0070689_100086588
803 Ga0070689_100369945
804 Ga0070691_10004510
805 Ga0070661_100003852
806 Ga0070661_100011576
807 Ga0070661_100018000
808 Ga0070661_100035690
809 Ga0070661_100077564
810 Ga0070661_100110693
811 Ga0070661_100120922
812 Ga0070661_100167309
813 Ga0070661_100392728
814 Ga0070661_100416800
815 Ga0070692_10096113
816 Ga0070692_10307664
817 Ga0070668_100105278
818 Ga0070669_100099219
819 Ga0070675_100022564
820 Ga0070675_100092439
821 Ga0070675_100374579
822 Ga0070675_101021822
823 Ga0070671_100007267
824 Ga0070671_100024364
825 Ga0070671_100032525
826 Ga0070671_100055146
827 Ga0070671_100091376
828 Ga0070671_100096754
829 Ga0070671_100133464
830 Ga0070671_100240423
831 Ga0070671_100276255
832 Ga0070674_100004347
833 Ga0070674_100007107
834 Ga0070674_100035943
835 Ga0070674_100041381
836 Ga0070674_100044892
837 Ga0070674_100109442
838 Ga0070673_100000937
839 Ga0070673_100008085
840 Ga0070673_100016365
841 Ga0070673_100174515
842 Ga0070673_101149466
843 Ga0070688_100178946
844 Ga0070659_100027437
845 Ga0070659_100073134
846 Ga0070659_100074382
847 Ga0070659_100077498
848 Ga0070659_100105830
849 Ga0070659_100164796
850 Ga0070659_100210369
851 Ga0070659_100253783
852 Ga0070659_100485084
853 Ga0070659_100712172
854 Ga0070659_100721495
855 Ga0070667_100017428
856 Ga0070667_100035505
857 Ga0070667_100177829
858 Ga0070667_100375089
859 Ga0070667_100715635
860 Ga0070714_100334864
861 Ga0070713_100001028
862 Ga0070713_100025629
863 Ga0070713_100364329
864 Ga0070663_100005148
865 Ga0070663_100055732
866 Ga0070663_100061429
867 Ga0070663_100158420
868 Ga0070663_100184901
869 Ga0070663_100543624
870 Ga0070678_100001158
871 Ga0070678_100006078
872 Ga0070678_100015539
873 Ga0070678_100021280
874 Ga0070678_100034693
875 Ga0070678_100120146
876 Ga0070662_100004986
877 Ga0070662_100007983
878 Ga0070662_100025995
879 Ga0070662_100029902
880 Ga0070662_100038370
881 Ga0070662_100077749
882 Ga0070662_100102675
883 Ga0070662_100165153
884 Ga0070662_100173443
885 Ga0070662_100295616
886 Ga0070662_100371232
887 Ga0070662_100396706
888 Ga0070662_100602987
889 Ga0070681_10017779
890 Ga0070681_10019823
891 Ga0070681_10066145
892 Ga0068867_100013773
893 Ga0068867_100054542
894 Ga0068867_100486966
895 Ga0068867_101100053
896 Ga0070685_10295396
897 Ga0070679_100028575
898 Ga0070679_100077639
899 Ga0070679_100110822
900 Ga0070679_100133888
901 Ga0070679_100157225
902 Ga0070679_100234196
903 Ga0070679_100281964
904 Ga0070684_100003988
905 Ga0070684_100029647
906 Ga0070684_100033682
907 Ga0070684_100123818
908 Ga0070684_100160916
909 Ga0068853_100006908
910 Ga0068853_100012483
911 Ga0068853_100041858
912 Ga0068853_100323349
913 Ga0068853_100468595
914 Ga0068853_100792670
915 Ga0070672_100001634
916 Ga0070672_100013444
917 Ga0070672_100025262
918 Ga0070672_100032692
919 Ga0070672_100106110
920 Ga0070672_100204649
921 Ga0070672_100337062
922 Ga0070672_100554489
923 Ga0070686_100006651
924 Ga0070693_100016352
925 Ga0070693_100318533
926 Ga0070665_100014462
927 Ga0070665_100038345
928 Ga0070665_100169508
929 Ga0070665_100244586
930 Ga0068855_100017478
931 Ga0068855_100019174
932 Ga0068855_100028373
933 Ga0068855_100037724
934 Ga0068855_100052500
935 Ga0068855_100058966
936 Ga0068855_100066782
937 Ga0068855_100221856
938 Ga0068855_100386000
939 Ga0068855_100680884
940 Ga0068855_100918723
941 Ga0070664_100002457
942 Ga0070664_100002747
943 Ga0070664_100006897
944 Ga0070664_100013637
945 Ga0070664_100015115
946 Ga0070664_100077385
947 Ga0070664_100139892
948 Ga0070664_100781409
949 Ga0070664_101193818
950 Ga0068857_100005444
951 Ga0068857_100019734
952 Ga0068857_100089112
953 Ga0068857_100089518
954 Ga0068857_100125624
955 Ga0068857_100162818
956 Ga0068854_100000880
957 Ga0068854_100001151
958 Ga0068854_100004990
959 Ga0068854_100066221
960 Ga0068854_100071612
961 Ga0068854_100209670
962 Ga0068854_100342900
963 Ga0068854_100714706
964 Ga0068856_100008535
965 Ga0068856_100019929
966 Ga0068856_100055423
967 Ga0068856_100105456
968 Ga0068856_100142529
969 Ga0068856_100181257
970 Ga0068856_100215150
971 Ga0068856_100219960
972 Ga0068856_100592338
973 Ga0070702_100687338
974 Ga0068852_100003663
975 Ga0068852_100004213
976 Ga0068852_100005297
977 Ga0068852_100008688
978 Ga0068852_100012887
979 Ga0068852_100033964
980 Ga0068852_100076803
981 Ga0068852_100091932
982 Ga0068852_100100815
983 Ga0068852_100117566
984 Ga0068852_100131728
985 Ga0068852_100224356
986 Ga0068852_100308787
987 Ga0068852_100700054
988 Ga0068852_101191125
989 Ga0068859_100026043
990 Ga0068859_100063533
991 Ga0068859_100748601
992 Ga0068864_100003680
993 Ga0068864_100009660
994 Ga0068864_100061244
995 Ga0068864_100277680
996 Ga0068864_100900783
997 Ga0068866_10014660
998 Ga0068851_10015077
999 Ga0068851_10031219
1000 Ga0068851_10037239
1001 Ga0068851_10057076
1002 Ga0068851_10085656
1003 Ga0068870_10037076
1004 Ga0068863_100002267
1005 Ga0068863_100007793
1006 Ga0068863_100015910
1007 Ga0068863_100063120
1008 Ga0068863_100207737
1009 Ga0068858_100005290
1010 Ga0068858_100037337
1011 Ga0068860_100336798
1012 Ga0068860_100803270
1013 Ga0081539_10017407
1014 Ga0070717_10026157
1015 Ga0070717_10079075
1016 Ga0070712_100345727
1017 Ga0075366_10046039
1018 Ga0097621_100035814
1019 Ga0097621_100127390
1020 Ga0097621_100482365
1021 Ga0068871_100035112
1022 Ga0068871_100049304
1023 Ga0068865_100039856
1024 Ga0068865_100110272
1025 Ga0097620_100026045
1026 Ga0097620_100063532
1027 Ga0097620_100748552
1028 Ga0105240_10016800
1029 Ga0105240_10032076
1030 Ga0105240_11104356
1031 Ga0105245_10342355
1032 Ga0105245_11131565
1033 Ga0105243_10009918
1034 Ga0105248_10018834
1035 Ga0105248_10077187
1036 Ga0105248_10098887
1037 Ga0105248_10174060
1038 Ga0105248_10550087
1039 Ga0105237_10152283
1040 Ga0105238_10017594
1041 Ga0105238_10140015
1042 Ga0105238_10303682
1043 Ga0105249_10449877
1044 Ga0105239_10431436
1045 Ga0105239_10952628
1046 Ga0105246_10030406
1047 Ga0157373_10007128
1048 Ga0157373_10011683
1049 Ga0157373_10034406
1050 Ga0157373_10045311
1051 Ga0157373_10138533
1052 Ga0157373_10159902
1053 Ga0157371_10005460
1054 Ga0157371_10013053
1055 Ga0157371_10065970
1056 Ga0157371_10165975
1057 Ga0157371_10213360
1058 Ga0157371_10241591
1059 Ga0157370_10007934
1060 Ga0157370_10014992
1061 Ga0157370_10016408
1062 Ga0157370_10031461
1063 Ga0157370_10294220
1064 Ga0157370_10410176
1065 Ga0157370_10530418
1066 Ga0157369_10001567
1067 Ga0157369_10039016
1068 Ga0157369_10075273
1069 Ga0157369_10149394
1070 Ga0157369_10315556
1071 Ga0157374_10107310
1072 Ga0157378_10009617
1073 Ga0163162_10001772
1074 Ga0163162_10263697
1075 Ga0157372_10024553
1076 Ga0157372_10029242
1077 Ga0157372_10113217
1078 Ga0157372_10208252
1079 Ga0157372_10518164
1080 Ga0157375_10001232
1081 Ga0157375_10052769
1082 Ga0157375_10180527
1083 Ga0163163_10044455
1084 Ga0163163_10391462
1085 Ga0157379_10183070
1086 Ga0206354_10713871
1087 Ga0206353_10656612
1088 Ga0206353_11504771
1089 Ga0213876_10036374
1090 Ga0207697_10009346
1091 Ga0207656_10022357
1092 Ga0207656_10056173
1093 Ga0207682_10004465
1094 Ga0207688_10013653
1095 Ga0207688_10038608
1096 Ga0207688_10142549
1097 Ga0207680_10012836
1098 Ga0207680_10016702
1099 Ga0207680_10033254
1100 Ga0207680_10068671
1101 Ga0207680_10082399
1102 Ga0207680_10175304
1103 Ga0207680_10386604
1104 Ga0207647_10001648
1105 Ga0207647_10008050
1106 Ga0207647_10018641
1107 Ga0207647_10035387
1108 Ga0207647_10072604
1109 Ga0207647_10074554
1110 Ga0207647_10140505
1111 Ga0207647_10229415
1112 Ga0207647_10293646
1113 Ga0207645_10017895
1114 Ga0207645_10102932
1115 Ga0207705_10000275
1116 Ga0207705_10014446
1117 Ga0207705_10014962
1118 Ga0207705_10015513
1119 Ga0207705_10016667
1120 Ga0207705_10043266
1121 Ga0207705_10058968
1122 Ga0207705_10062866
1123 Ga0207705_10106635
1124 Ga0207705_10205381
1125 Ga0207705_10449725
1126 Ga0207707_10003065
1127 Ga0207707_10428405
1128 Ga0207707_10478013
1129 Ga0207707_10531831
1130 Ga0207695_10008882
1131 Ga0207695_10304453
1132 Ga0207671_10093311
1133 Ga0207693_10110643
1134 Ga0207660_10001990
1135 Ga0207660_10008493
1136 Ga0207660_10027304
1137 Ga0207660_10040452
1138 Ga0207660_10126543
1139 Ga0207660_10157475
1140 Ga0207662_10040832
1141 Ga0207657_10001025
1142 Ga0207657_10003842
1143 Ga0207657_10004810
1144 Ga0207657_10005130
1145 Ga0207657_10015099
1146 Ga0207657_10017291
1147 Ga0207657_10034238
1148 Ga0207657_10035116
1149 Ga0207657_10039261
1150 Ga0207657_10045466
1151 Ga0207657_10052507
1152 Ga0207657_10057033
1153 Ga0207657_10135360
1154 Ga0207657_10466014
1155 Ga0207657_10547120
1156 Ga0207649_10004550
1157 Ga0207649_10008753
1158 Ga0207649_10061533
1159 Ga0207649_10136753
1160 Ga0207649_10137708
1161 Ga0207649_10175105
1162 Ga0207652_10016593
1163 Ga0207652_10036986
1164 Ga0207652_10062665
1165 Ga0207652_10120250
1166 Ga0207681_10072210
1167 Ga0207681_10084057
1168 Ga0207694_10021310
1169 Ga0207694_10035363
1170 Ga0207650_10004522
1171 Ga0207650_10089873
1172 Ga0207659_10020133
1173 Ga0207659_10022843
1174 Ga0207659_10112133
1175 Ga0207659_10440468
1176 Ga0207687_10773692
1177 Ga0207700_10092057
1178 Ga0207700_10165483
1179 Ga0207700_10356179
1180 Ga0207664_10034392
1181 Ga0207664_10190318
1182 Ga0207664_10332772
1183 Ga0207644_10000512
1184 Ga0207644_10001487
1185 Ga0207644_10013523
1186 Ga0207644_10013877
1187 Ga0207644_10035329
1188 Ga0207644_10134772
1189 Ga0207644_10199723
1190 Ga0207644_10334318
1191 Ga0207644_10420778
1192 Ga0207690_10003557
1193 Ga0207690_10006226
1194 Ga0207690_10014139
1195 Ga0207690_10016775
1196 Ga0207690_10075008
1197 Ga0207690_10119811
1198 Ga0207690_10123326
1199 Ga0207690_10252047
1200 Ga0207690_10330024
1201 Ga0207690_10466246
1202 Ga0207690_10756197
1203 Ga0207706_10000285
1204 Ga0207706_10001588
1205 Ga0207706_10002960
1206 Ga0207706_10006959
1207 Ga0207706_10016724
1208 Ga0207706_10029351
1209 Ga0207706_10031288
1210 Ga0207706_10043572
1211 Ga0207706_10050041
1212 Ga0207706_10064119
1213 Ga0207706_10104470
1214 Ga0207706_10134869
1215 Ga0207706_10335572
1216 Ga0207706_10341950
1217 Ga0207706_10542028
1218 Ga0207706_10592920
1219 Ga0207686_10013596
1220 Ga0207686_10449703
1221 Ga0207709_10137409
1222 Ga0207670_10578451
1223 Ga0207670_10995631
1224 Ga0207669_10082301
1225 Ga0207669_10083539
1226 Ga0207669_10099280
1227 Ga0207669_10682371
1228 Ga0207704_10045385
1229 Ga0207704_10766755
1230 Ga0207665_10083765
1231 Ga0207691_10009222
1232 Ga0207691_10027747
1233 Ga0207691_10032059
1234 Ga0207691_10038264
1235 Ga0207691_10053790
1236 Ga0207691_10131090
1237 Ga0207691_10189418
1238 Ga0207711_10010312
1239 Ga0207711_10018806
1240 Ga0207711_10018900
1241 Ga0207711_10075931
1242 Ga0207711_10277501
1243 Ga0207711_10366966
1244 Ga0207689_10014288
1245 Ga0207661_10012819
1246 Ga0207661_10116040
1247 Ga0207661_10172896
1248 Ga0207661_10464437
1249 Ga0207679_10002516
1250 Ga0207679_10011199
1251 Ga0207679_10049824
1252 Ga0207679_10064262
1253 Ga0207679_10123108
1254 Ga0207679_10136349
1255 Ga0207667_10016328
1256 Ga0207667_10021454
1257 Ga0207667_10042773
1258 Ga0207667_10050408
1259 Ga0207667_10052691
1260 Ga0207667_10065591
1261 Ga0207667_10120019
1262 Ga0207667_10132647
1263 Ga0207667_10152977
1264 Ga0207667_10176543
1265 Ga0207667_10225220
1266 Ga0207667_10471554
1267 Ga0207651_10003373
1268 Ga0207651_10013612
1269 Ga0207651_10092843
1270 Ga0207651_10362611
1271 Ga0207668_10174061
1272 Ga0207668_10396289
1273 Ga0207640_10010004
1274 Ga0207640_10025367
1275 Ga0207640_10068812
1276 Ga0207640_10094180
1277 Ga0207640_10317394
1278 Ga0207640_10542415
1279 Ga0207640_10901895
1280 Ga0207658_10042405
1281 Ga0207658_10185339
1282 Ga0207677_10016724
1283 Ga0207677_10102922
1284 Ga0207677_10252861
1285 Ga0207677_10318626
1286 Ga0207703_10008400
1287 Ga0207703_10009494
1288 Ga0207639_10012147
1289 Ga0207639_10013204
1290 Ga0207639_10037023
1291 Ga0207639_10135505
1292 Ga0207639_10323477
1293 Ga0207678_10000385
1294 Ga0207678_10006308
1295 Ga0207678_10011949
1296 Ga0207678_10013433
1297 Ga0207678_10022100
1298 Ga0207678_10027963
1299 Ga0207678_10041782
1300 Ga0207678_10065487
1301 Ga0207678_10072091
1302 Ga0207678_10220978
1303 Ga0207678_10715986
1304 Ga0207702_10026922
1305 Ga0207702_10071067
1306 Ga0207702_10096153
1307 Ga0207702_10107840
1308 Ga0207702_10156095
1309 Ga0207702_10225455
1310 Ga0207702_10421186
1311 Ga0207702_10606449
1312 Ga0207702_10618330
1313 Ga0207641_10006980
1314 Ga0207641_10011911
1315 Ga0207648_10007626
1316 Ga0207648_10016245
1317 Ga0207648_10055027
1318 Ga0207648_10618859
1319 Ga0207648_10623490
1320 Ga0207676_10006009
1321 Ga0207676_10012804
1322 Ga0207676_10044474
1323 Ga0207676_10285050
1324 Ga0207676_11090354
1325 Ga0207674_10002718
1326 Ga0207674_10003126
1327 Ga0207674_10006989
1328 Ga0207674_10052979
1329 Ga0207674_10234436
1330 Ga0207675_100066345
1331 Ga0207683_10007467
1332 Ga0207683_10011229
1333 Ga0207683_10031640
1334 Ga0207683_10152866
1335 Ga0207698_10000125
1336 Ga0207698_10003409
1337 Ga0207698_10009627
1338 Ga0207698_10015566
1339 Ga0207698_10060387
1340 Ga0207698_10061835
1341 Ga0207698_10125033
1342 Ga0207698_10154323
1343 Ga0207698_10244912
1344 Ga0207698_10254741
1345 Ga0207698_10264749
1346 Ga0207698_10577656
1347 Ga0207698_10590065
1348 Ga0268266_10137718
1349 Ga0268266_10166860
1350 Ga0268266_10422563
1351 Ga0307410_10042027
1352 Ga0307410_10112907
1353 Ga0307406_10256883
1354 Ga0307412_10022867
1355 Ga0307409_100035562
1356 Ga0307416_100029624
1357 Ga0307415_100012022
1358 Ga0307415_100162700
1359 Ga0307415_100239529
1360 Ga0373946_0053256
1361 Ga0373935_0197613
1362 Ga0373947_0397264
1363 Ga0373925_0046755
1364 Ga0395899_0018221
1365 Ga0395899_0027624
1366 Ga0395899_0236829
1367 Ga0395900_0001979
1368 Ga0395900_0095326
1369 Ga0395900_0138479
1370 Ga0395900_0147778
1371 Ga0395900_0160267
1372 Ga0395900_0167307
1373 Ga0395900_0184000
1374 Ga0395900_0188087
1375 Ga0395900_0189109
1376 Ga0395900_0837670
1377 Ga0395898_0022058
1378 Ga0395898_0065705
1379 Ga0395898_0072735
1380 Ga0395898_0114564
1381 Ga0395898_0117106
1382 Ga0395898_0374807
1383 Ga0395898_1025833
1384 Ga0395905_0018451
1385 Ga0395905_0019864
1386 Ga0395905_0028967
1387 Ga0395905_0071101
1388 Ga0395905_0074945
1389 Ga0395905_0108402
1390 Ga0395905_0124106
1391 Ga0395905_0130302
1392 Ga0395905_0156718
1393 Ga0395905_0360803
1394 Ga0395905_0564086
1395 Ga0395901_0013323
1396 Ga0395901_0055625
1397 Ga0395901_0076934
1398 Ga0395901_0179171
1399 Ga0395901_0180861
1400 Ga0395901_0190050
1401 Ga0395901_0211218
1402 Ga0395901_0244771
1403 Ga0395901_0298898
1404 Ga0466969_0020205
1405 Ga0466966_0004707
1406 Ga0466966_0064695
1407 Ga0466961_0029562
1408 Ga0466961_0093309
1409 Ga0466961_0364253
1410 Ga0466961_0430332
1411 Ga0466963_0006661
1412 Ga0466963_0053525
1413 Ga0466963_0061139
1414 Ga0466963_0143285
1415 Ga0466964_0020725
1416 Ga0466971_0150349
1417 Ga0466968_0006874
1418 Ga0466970_0011936
1419 Ga0466970_0198217
1420 Ga0466957_0053888
1421 Ga0466957_0054383
1422 Ga0466957_0182680
1423 Ga0466957_0260096
1424 Ga0466959_0010323
1425 Ga0466959_0144933
1426 Ga0466959_0164503
1427 Ga0466958_0007456
1428 Ga0466958_0044105
1429 Ga0466958_0117383
1430 Ga0466967_0027347
1431 Ga0466967_0102797
1432 Ga0466967_0107889
1433 Ga0466967_0181808
1434 Ga0466967_0192548
1435 Ga0466967_0429722
1436 Ga0466967_0470907
1437 Ga0495605_0205984
1438 Ga0495663_0002096
1439 Ga0495663_0132127
1440 Ga0495621_0001157
1441 Ga0495668_0008968
1442 Ga0495625_0359906
1443 Ga0495669_0002800
1444 Ga0495669_0090297
1445 Ga0495669_0431395
1446 Ga0495677_0001514
1447 Ga0495677_0140881
1448 Ga0496104_0294332
1449 Ga0496106_0370589
1450 Ga0496108_0004792
1451 Ga0496108_0270973
1452 Ga0496109_0098739
1453 Ga0496110_0054913
1454 Ga0496111_0225280
1455 Ga0496112_0019551
1456 Ga0496112_0173384
1457 Ga0496113_0036658
1458 Ga0496113_0108254
1459 Ga0496113_0165678
1460 Ga0501080_0071919
1461 nmdc:mga0k408_79305_c1
1462 Ga0495655_0009504
1463 Ga0466962_0009267
1464 Ga0466962_0031353

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

4

115

0.96

PF00196

GerE

Bacterial regulatory proteins, luxR family

143

199

0.96

PF08281

Sigma70_r4_2

Sigma-70, region 4

145

187

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ulq-assembly1.cif.gz_B crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain 0.9673 145 200
1zlj-assembly2.cif.gz_C crystal structure of the mycobacterium tuberculosis hypoxic response regulator dosr c-terminal domain 0.9524 145 202
4wsz-assembly1.cif.gz_A crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9509 145 201
7ve5-assembly1.cif.gz_B c-terminal domain of vrar 0.9415 145 201
4wul-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9404 145 201
ID Description Score Start End Superfamily
3ulqB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9673 145 200 1.10.10.10
af_P52106_149_214_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9512 141 201 1.10.10.10
af_O53213_1064_1134_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9381 145 201 1.10.10.10
4if4C02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9371 145 201 1.10.10.10
af_P06993_830_894_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9284 144 202 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A661KWW2-F1-model_v4 Response regulatory domain-containing protein 0.9435 2 137 GO:0000160
GO:0003677
AF-A0A7K3W4Z8-F1-model_v4 Response regulator transcription factor 0.9341 1 131 GO:0000160
AF-A0A563VZT4-F1-model_v4 Response regulatory domain-containing protein 0.9129 1 132 GO:0000160
GO:0003677
GO:0016020
AF-A0A7W2J905-F1-model_v4 deleted 0.9062 1 130
AF-A0A2N2H3R0-F1-model_v4 Response regulatory domain-containing protein 0.9055 1 143 GO:0000160

Map