F477930

General Info

Members Datasets Scaffolds Average Seq Length
730 309 598 239

Family's Representative Sequence

Representative Sequence 3300046455|Ga0495603_0042926|Ga0495603_0042926_92_820
Length 242
Sequence MRHLPKTLIAAALGVFLSANACAHGLWTEERRGNIEVVFGDGAEDDAYKAEQVKNAWAYDAAGKAIAVSIEPQADHARLKPVSKAATLFVTMDGGLWAQKPDETWVPQGKRDVPDALEALRSVRYSLAIHEEKAKIVVPKDVYFVIVPQVDPLHVGVGKDLPVQVLLDGKPVKDVSLLGDFRGAPHTVTAKTDAEGRASIPVRNDGLNIIAAYTSQDVAKDPDANKNSYFTSLTFIGTPEDE

Samples

Sample ID Description Type Environment
1 2511231004 Pseudomonas sp. GM102 Isolate Nodule
2 2511231007 Pseudomonas sp. GM18 Isolate Nodule
3 2511231010 Pseudomonas sp. GM25 Isolate Nodule
4 2511231016 Pseudomonas sp. GM50 Isolate Nodule
5 2511231021 Pseudomonas sp. GM78 Isolate Nodule
6 2511231022 Pseudomonas sp. GM79 Isolate Nodule
7 2511231023 Pseudomonas sp. GM80 Isolate Nodule
8 2511231031 Pseudomonas sp. GM16 Isolate Nodule
9 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
10 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
11 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
12 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
13 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
14 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
15 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
16 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
17 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
18 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
19 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
20 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
21 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
22 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
23 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
24 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
25 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
26 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
27 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
28 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
29 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
30 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
31 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
32 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
33 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
34 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
35 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
36 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
37 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
38 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
39 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
40 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
41 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
42 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
43 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
44 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
45 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
46 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
47 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
48 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
49 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
50 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
51 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
52 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
53 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
54 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
55 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
56 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
57 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
58 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
59 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
60 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
61 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
62 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
63 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
64 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
65 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
66 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
67 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
68 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
69 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
70 2765235841 Pseudomonas putida AA7 Isolate Unclassified
71 2773857673 Pseudomonas sp. 443 Isolate Unclassified
72 2784132063 Pseudomonas sp. 424 Isolate Unclassified
73 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
74 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
75 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
76 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
77 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
78 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
79 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
80 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
81 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
82 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
83 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
84 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
85 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
86 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
87 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
88 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
89 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
90 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
91 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
92 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
93 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
94 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
95 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
96 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
97 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
98 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
99 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
100 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
101 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
102 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
103 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
104 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
105 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
106 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
107 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
108 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
109 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
110 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
111 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
112 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
113 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
114 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
115 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
116 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
117 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
118 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
119 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
120 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
121 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
122 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
123 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
124 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
125 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
126 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
127 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
128 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
129 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
130 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
131 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
132 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
133 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
134 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
135 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
136 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
137 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
138 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
139 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
140 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
141 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
142 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
143 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
144 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
145 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
146 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
147 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
148 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
149 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
150 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
151 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
152 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
153 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
154 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
155 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
156 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
157 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
158 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
159 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
160 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
161 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
172 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
175 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
176 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
190 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
191 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
192 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
193 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
194 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
195 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
196 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
197 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
198 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
199 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
200 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
201 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
202 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
203 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
204 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
205 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
206 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
207 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
208 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
209 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
210 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
211 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
212 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
213 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
214 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
215 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
216 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
217 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
218 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
219 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
220 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
221 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
222 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
223 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
224 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
225 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
226 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
227 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
228 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
229 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
230 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
231 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
232 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
233 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
234 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
235 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
236 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
237 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
238 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
239 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
240 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
241 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
242 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
243 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
244 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
245 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
246 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
247 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
248 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
249 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
250 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
251 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
252 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
253 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
254 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
255 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
256 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
257 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
258 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
259 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
260 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
261 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
262 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
263 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
264 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
265 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
266 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
267 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
268 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
269 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
270 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
271 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
272 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
273 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
274 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
275 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
276 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
277 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
278 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
279 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
280 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
281 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
282 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
283 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
284 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
285 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
286 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
287 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
288 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
289 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
290 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
291 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
292 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
293 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
294 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
296 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
297 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
298 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
299 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
300 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
301 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
302 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
303 8052494512 Pseudomonas putida LD6 Isolate Unclassified
304 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
305 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
306 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
307 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
308 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
309 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.92
Metatranscriptomes 0
Isolates 18.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.25
Nodule 2.19
Rhizoplane 6.85
Rhizosphere 77.53
Stem 0
Stem Tuber 0
Unclassified 9.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1001787 3300002737 Bacteria 10189
2 JGI25162J39368_1002085 3300002737 Bacteria 8564
3 JGI25163J39215_1000708 3300002771 Bacteria 8718
4 JGI25163J39215_1001519 3300002771 Bacteria 3650
5 JGI25164J39214_1000879 3300002772 Bacteria 10189
6 JGI25164J39214_1001023 3300002772 Bacteria 8564
7 JGI25165J46597_1001661 3300003214 Bacteria 10189
8 JGI25165J46597_1001881 3300003214 Bacteria 8564
9 Ga0055536_1002228 3300003781 Bacteria 11034
10 Ga0055530_10000336 3300003791 Bacteria 42387
11 Ga0055540_1000322 3300003792 Bacteria 42387
12 Ga0065714_10010863 3300005288 Bacteria 3270
13 Ga0065714_10065517 3300005288 Bacteria 9630
14 Ga0065714_10072086 3300005288 Bacteria 3432
15 Ga0065714_10120069 3300005288 Bacteria 1351
16 Ga0065704_10000256 3300005289 Bacteria 48908
17 Ga0065704_10310478 3300005289 Bacteria 869
18 Ga0065712_10068510 3300005290 Bacteria 10186
19 Ga0070662_100018398 3300005457 Bacteria 4725
20 Ga0070665_100044593 3300005548 Bacteria 4453
21 Ga0075364_10046204 3300006051 Bacteria 2835
22 Ga0075364_10147150 3300006051 Bacteria 1586
23 Ga0075362_10202306 3300006177 Bacteria 967
24 Ga0099823_1000007 3300006944 Bacteria 111486
25 Ga0079104_1003794 3300006946 Bacteria 6796
26 Ga0079104_1003813 3300006946 Bacteria 6769
27 Ga0099826_10037194 3300006948 Bacteria 3432
28 Ga0105251_10000060 3300009011 Bacteria 102799
29 Ga0105251_10015004 3300009011 Bacteria 4251
30 Ga0105251_10017266 3300009011 Bacteria 3874
31 Ga0105251_10022468 3300009011 Bacteria 3275
32 Ga0105244_10000737 3300009036 Bacteria 27987
33 Ga0105244_10009994 3300009036 Bacteria 5781
34 Ga0105244_10025589 3300009036 Bacteria 3207
35 Ga0105250_10004277 3300009092 Bacteria 6601
36 Ga0105250_10010281 3300009092 Bacteria 3902
37 Ga0105250_10026147 3300009092 Bacteria 2351
38 Ga0105243_10009919 3300009148 Bacteria 7241
39 Ga0105243_10010698 3300009148 Bacteria 6953
40 Ga0105249_10015623 3300009553 Bacteria 6721
41 Ga0105239_10457170 3300010375 Bacteria 1449
42 Ga0157345_1000238 3300012498 Bacteria 8004
43 Ga0157373_10010754 3300013100 Bacteria 6734
44 Ga0157373_10011755 3300013100 Bacteria 6431
45 Ga0157373_10050194 3300013100 Bacteria 2971
46 Ga0157373_10075618 3300013100 Bacteria 2376
47 Ga0157371_10002584 3300013102 Bacteria 17178
48 Ga0157371_10008144 3300013102 Bacteria 8376
49 Ga0157371_10009323 3300013102 Bacteria 7736
50 Ga0157371_10041781 3300013102 Bacteria 3271
51 Ga0157370_10003874 3300013104 Bacteria 17428
52 Ga0157370_10108791 3300013104 Bacteria 2591
53 Ga0157370_10636913 3300013104 Bacteria 975
54 Ga0157369_10027248 3300013105 Bacteria 6336
55 Ga0157369_10390597 3300013105 Bacteria 1444
56 Ga0163162_10008280 3300013306 Bacteria 10147
57 Ga0163162_10055631 3300013306 Bacteria 3984
58 Ga0157372_10032360 3300013307 Bacteria 5734
59 Ga0157375_10003699 3300013308 Bacteria 13279
60 Ga0182008_10002235 3300014497 Bacteria 12239
61 Ga0182008_10022683 3300014497 Bacteria 3214
62 Ga0182008_10029811 3300014497 Bacteria 2754
63 Ga0182006_1003667 3300015261 Bacteria 7790
64 Ga0182006_1005837 3300015261 Bacteria 5801
65 Ga0182006_1011364 3300015261 Bacteria 3920
66 Ga0182006_1023141 3300015261 Bacteria 2575
67 Ga0182006_1023176 3300015261 Bacteria 2573
68 Ga0182006_1025538 3300015261 Bacteria 2425
69 Ga0182006_1029057 3300015261 Bacteria 2242
70 Ga0163161_10010000 3300017792 Bacteria 6570
71 Ga0163161_10037903 3300017792 Bacteria 3456
72 Ga0163161_10084697 3300017792 Bacteria 2338
73 Ga0163161_10234044 3300017792 Bacteria 1426
74 Ga0209760_100133 3300025207 Bacteria 48364
75 Ga0209760_100170 3300025207 Bacteria 36991
76 Ga0207427_100001 3300025231 Bacteria 1410763
77 Ga0207427_100004 3300025231 Bacteria 939600
78 Ga0209437_100003 3300025233 Bacteria 1517827
79 Ga0209437_100028 3300025233 Bacteria 540136
80 Ga0209233_1000007 3300025261 Bacteria 1411234
81 Ga0209233_1000008 3300025261 Bacteria 1356712
82 Ga0209676_1000101 3300025292 Bacteria 227976
83 Ga0209676_1006732 3300025292 Bacteria 5589
84 Ga0209050_1000027 3300025298 Bacteria 483261
85 Ga0209050_1043091 3300025298 Bacteria 1223
86 Ga0209051_1000102 3300025303 Bacteria 162911
87 Ga0209257_1011392 3300025304 Bacteria 4290
88 Ga0207696_1000032 3300025711 Bacteria 380071
89 Ga0207696_1003100 3300025711 Bacteria 7744
90 Ga0207696_1004141 3300025711 Bacteria 6340
91 Ga0207655_1004283 3300025728 Bacteria 10206
92 Ga0207655_1013621 3300025728 Bacteria 4655
93 Ga0207655_1020163 3300025728 Bacteria 3442
94 Ga0207655_1023667 3300025728 Bacteria 3038
95 Ga0207655_1056036 3300025728 Bacteria 1557
96 Ga0207713_1000150 3300025735 Bacteria 105170
97 Ga0207713_1005905 3300025735 Bacteria 7558
98 Ga0207713_1009882 3300025735 Bacteria 5336
99 Ga0207713_1014734 3300025735 Bacteria 4040
100 Ga0207713_1015550 3300025735 Bacteria 3899
101 Ga0207706_10003352 3300025933 Bacteria 15321
102 Ga0207709_10005850 3300025935 Bacteria 6951
103 Ga0207709_10621422 3300025935 Bacteria 857
104 Ga0207712_10008162 3300025961 Bacteria 6616
105 Ga0209281_1000015 3300027111 Bacteria 590084
106 Ga0209281_1006660 3300027111 Bacteria 2986
107 Ga0209281_1007647 3300027111 Bacteria 2696
108 Ga0209389_1000050 3300027296 Bacteria 111494
109 Ga0268266_10029099 3300028379 Bacteria 4695
110 Ga0307511_10020062 3300030521 Bacteria 6341
111 Ga0316178_1023745 3300030735 Bacteria 38907
112 Ga0316181_1111488 3300030744 Bacteria 3150
113 Ga0307408_100000020 3300031548 Bacteria 340408
114 Ga0307408_100007609 3300031548 Bacteria 7163
115 Ga0307408_100009277 3300031548 Bacteria 6487
116 Ga0307408_100011411 3300031548 Bacteria 5870
117 Ga0307408_100762096 3300031548 Bacteria 875
118 Ga0307516_10160597 3300031730 Bacteria 1998
119 Ga0307405_10002918 3300031731 Bacteria 7709
120 Ga0307405_10008612 3300031731 Bacteria 5182
121 Ga0307405_10058752 3300031731 Bacteria 2421
122 Ga0307405_10199978 3300031731 Bacteria 1450
123 Ga0307413_10036436 3300031824 Bacteria 2831
124 Ga0307413_10037803 3300031824 Bacteria 2791
125 Ga0307410_10487493 3300031852 Bacteria 1012
126 Ga0307406_10021155 3300031901 Bacteria 3843
127 Ga0307406_10323315 3300031901 Bacteria 1194
128 Ga0307407_10028872 3300031903 Bacteria 2971
129 Ga0307407_10103498 3300031903 Bacteria 1772
130 Ga0307412_10017230 3300031911 Bacteria 4321
131 Ga0307412_10017991 3300031911 Bacteria 4241
132 Ga0307412_10022480 3300031911 Bacteria 3866
133 Ga0307412_10031217 3300031911 Bacteria 3362
134 Ga0307412_10050941 3300031911 Bacteria 2734
135 Ga0307409_100050436 3300031995 Bacteria 3178
136 Ga0307409_100059292 3300031995 Bacteria 2978
137 Ga0307416_100252610 3300032002 Bacteria 1717
138 Ga0307416_100579008 3300032002 Bacteria 1199
139 Ga0307414_10002569 3300032004 Bacteria 9549
140 Ga0307414_10084800 3300032004 Bacteria 2331
141 Ga0307414_10128910 3300032004 Bacteria 1960
142 Ga0307414_10737550 3300032004 Bacteria 894
143 Ga0307411_10005294 3300032005 Bacteria 6319
144 Ga0307411_10016793 3300032005 Bacteria 4151
145 Ga0307411_10046041 3300032005 Bacteria 2809
146 Ga0307411_10176883 3300032005 Bacteria 1615
147 Ga0307510_10027015 3300033180 Bacteria 6584
148 Ga0439436_0000436 3300041404 Bacteria 10589
149 Ga0439438_000126 3300041405 Bacteria 34403
150 Ga0439438_002663 3300041405 Bacteria 7531
151 Ga0439438_003164 3300041405 Bacteria 6752
152 Ga0439438_003304 3300041405 Bacteria 6579
153 Ga0439438_003373 3300041405 Bacteria 6466
154 Ga0439438_004635 3300041405 Bacteria 5230
155 Ga0439438_005883 3300041405 Bacteria 4436
156 Ga0439438_005887 3300041405 Bacteria 4434
157 Ga0439438_006220 3300041405 Bacteria 4246
158 Ga0439447_001626 3300041407 Bacteria 8240
159 Ga0439447_002894 3300041407 Bacteria 6149
160 Ga0439447_003897 3300041407 Bacteria 5232
161 Ga0439447_006049 3300041407 Bacteria 3969
162 Ga0439447_007036 3300041407 Bacteria 3602
163 Ga0439447_007295 3300041407 Bacteria 3521
164 Ga0439447_022559 3300041407 Bacteria 1646
165 Ga0439447_037403 3300041407 Bacteria 1196
166 Ga0439466_0003558 3300041411 Bacteria 6020
167 Ga0439466_0004879 3300041411 Bacteria 5156
168 Ga0439466_0006567 3300041411 Bacteria 4417
169 Ga0439466_0007250 3300041411 Bacteria 4196
170 Ga0439466_0011556 3300041411 Bacteria 3264
171 Ga0439466_0017434 3300041411 Bacteria 2587
172 Ga0439466_0020995 3300041411 Bacteria 2321
173 Ga0439466_0026103 3300041411 Bacteria 2034
174 Ga0439466_0026724 3300041411 Bacteria 2004
175 Ga0439466_0071894 3300041411 Bacteria 1100
176 Ga0439466_0091768 3300041411 Bacteria 951
177 Ga0439465_0012542 3300041413 Bacteria 2649
178 Ga0439431_0003989 3300041997 Bacteria 3250
179 Ga0439431_0029928 3300041997 Bacteria 1347
180 Ga0439437_000800 3300042000 Bacteria 3225
181 Ga0439432_000460 3300042006 Bacteria 15202
182 Ga0439432_001259 3300042006 Bacteria 9580
183 Ga0439432_006458 3300042006 Bacteria 4186
184 Ga0439432_017200 3300042006 Bacteria 2428
185 Ga0439432_021238 3300042006 Bacteria 2154
186 Ga0439432_028342 3300042006 Bacteria 1823
187 Ga0439432_034709 3300042006 Bacteria 1618
188 Ga0439432_038741 3300042006 Bacteria 1517
189 Ga0439451_001025 3300042009 Bacteria 5427
190 Ga0439451_001338 3300042009 Bacteria 4856
191 Ga0439451_003240 3300042009 Bacteria 3303
192 Ga0439451_011550 3300042009 Bacteria 1782
193 Ga0439451_017038 3300042009 Bacteria 1463
194 Ga0439451_018725 3300042009 Bacteria 1397
195 Ga0439452_000071 3300042010 Bacteria 89088
196 Ga0439452_001530 3300042010 Bacteria 9317
197 Ga0439452_001780 3300042010 Bacteria 8403
198 Ga0439452_003342 3300042010 Bacteria 5640
199 Ga0439452_007159 3300042010 Bacteria 3434
200 Ga0439452_011907 3300042010 Bacteria 2488
201 Ga0439452_014825 3300042010 Bacteria 2154
202 Ga0439452_015158 3300042010 Bacteria 2121
203 Ga0439455_0006654 3300042012 Bacteria 2410
204 Ga0439456_001033 3300042013 Bacteria 5528
205 Ga0439456_002492 3300042013 Bacteria 3714
206 Ga0439456_013219 3300042013 Bacteria 1716
207 Ga0439456_051036 3300042013 Bacteria 904
208 Ga0439463_012183 3300042016 Bacteria 2112
209 Ga0439463_020531 3300042016 Bacteria 1648
210 Ga0450911_000028 3300042115 Bacteria 77694
211 Ga0450911_000748 3300042115 Bacteria 9304
212 Ga0450911_002001 3300042115 Bacteria 4232
213 Ga0450911_002031 3300042115 Bacteria 4181
214 Ga0450919_000651 3300042121 Bacteria 4406
215 Ga0450919_006381 3300042121 Bacteria 1396
216 Ga0450919_007847 3300042121 Bacteria 1242
217 Ga0450922_000751 3300042124 Bacteria 3337
218 Ga0450922_004723 3300042124 Bacteria 1255
219 Ga0450923_001749 3300042125 Bacteria 2964
220 Ga0450923_003448 3300042125 Bacteria 2387
221 Ga0450890_000564 3300042127 Bacteria 5403
222 Ga0450902_002522 3300042137 Bacteria 2603
223 Ga0450903_001782 3300042138 Bacteria 3942
224 Ga0450903_003992 3300042138 Bacteria 2534
225 Ga0450903_005313 3300042138 Bacteria 2160
226 Ga0450904_000355 3300042139 Bacteria 9574
227 Ga0450904_004439 3300042139 Bacteria 1456
228 Ga0450905_000878 3300042142 Bacteria 3756
229 Ga0450905_004456 3300042142 Bacteria 1858
230 Ga0450905_007538 3300042142 Bacteria 1482
231 Ga0450905_009342 3300042142 Bacteria 1349
232 Ga0450905_013089 3300042142 Bacteria 1173
233 Ga0450906_000598 3300042145 Bacteria 7669
234 Ga0450907_000494 3300042146 Bacteria 10908
235 Ga0450907_001799 3300042146 Bacteria 4415
236 Ga0450907_002002 3300042146 Bacteria 4088
237 Ga0450907_018928 3300042146 Bacteria 1153
238 Ga0450910_001041 3300042147 Bacteria 3391
239 Ga0450910_030529 3300042147 Bacteria 845
240 Ga0439446_0000627 3300042156 Bacteria 7316
241 Ga0439446_0001258 3300042156 Bacteria 5695
242 Ga0439446_0005245 3300042156 Bacteria 3325
243 Ga0439446_0015166 3300042156 Bacteria 2135
244 Ga0450908_004617 3300042184 Bacteria 2651
245 Ga0450908_028165 3300042184 Bacteria 978
246 Ga0450909_001463 3300042185 Bacteria 3291
247 Ga0450909_012163 3300042185 Bacteria 1261
248 Ga0439434_0006838 3300042435 Bacteria 3332
249 Ga0439434_0012889 3300042435 Bacteria 2477
250 Ga0439459_0003268 3300042438 Bacteria 2558
251 Ga0439464_0001903 3300042439 Bacteria 5044
252 Ga0439464_0002953 3300042439 Bacteria 4242
253 Ga0439464_0012800 3300042439 Bacteria 2238
254 Ga0439460_0008217 3300042461 Bacteria 2633
255 Ga0439460_0009408 3300042461 Bacteria 2481
256 Ga0450918_002190 3300042531 Bacteria 3725
257 Ga0450918_019941 3300042531 Bacteria 1171
258 Ga0450893_0000624 3300042532 Bacteria 5053
259 Ga0450893_0004524 3300042532 Bacteria 2214
260 Ga0450893_0020164 3300042532 Bacteria 1144
261 Ga0450901_001834 3300042533 Bacteria 2381
262 Ga0439440_0001555 3300042993 Bacteria 4199
263 Ga0439440_0070175 3300042993 Bacteria 910
264 Ga0495617_019899 3300046452 Bacteria 2268
265 Ga0495617_029590 3300046452 Bacteria 1841
266 Ga0495617_051661 3300046452 Bacteria 1366
267 Ga0495617_072940 3300046452 Bacteria 1128
268 Ga0495617_116051 3300046452 Bacteria 864
269 Ga0495627_002049 3300046453 Bacteria 10309
270 Ga0495627_002833 3300046453 Bacteria 8027
271 Ga0495627_003142 3300046453 Bacteria 7463
272 Ga0495627_005093 3300046453 Bacteria 5368
273 Ga0495627_007469 3300046453 Bacteria 4179
274 Ga0495627_036835 3300046453 Bacteria 1519
275 Ga0495603_0042926 3300046455 Bacteria 2702
276 Ga0495590_0009490 3300046457 Bacteria 3694
277 Ga0495590_0033099 3300046457 Bacteria 1807
278 Ga0495590_0127936 3300046457 Bacteria 912
279 Ga0495591_003237 3300046458 Bacteria 8555
280 Ga0495591_004091 3300046458 Bacteria 7264
281 Ga0495591_004533 3300046458 Bacteria 6746
282 Ga0495591_004779 3300046458 Bacteria 6480
283 Ga0495591_005870 3300046458 Bacteria 5570
284 Ga0495591_007361 3300046458 Bacteria 4691
285 Ga0495591_009928 3300046458 Bacteria 3736
286 Ga0495591_010598 3300046458 Bacteria 3558
287 Ga0495591_013124 3300046458 Bacteria 3050
288 Ga0495591_017138 3300046458 Bacteria 2497
289 Ga0495638_0001043 3300046460 Bacteria 27399
290 Ga0495638_0011366 3300046460 Bacteria 6135
291 Ga0495638_0036577 3300046460 Bacteria 3127
292 Ga0495638_0037311 3300046460 Bacteria 3091
293 Ga0495638_0168231 3300046460 Bacteria 1259
294 Ga0495653_0002473 3300046463 Bacteria 14693
295 Ga0495650_0002071 3300046471 Bacteria 17389
296 Ga0495650_0014864 3300046471 Bacteria 4020
297 Ga0495650_0029959 3300046471 Bacteria 2472
298 Ga0495650_0030168 3300046471 Bacteria 2459
299 Ga0495650_0068724 3300046471 Bacteria 1396
300 Ga0495605_0000032 3300046474 Bacteria 210550
301 Ga0495605_0000220 3300046474 Bacteria 70521
302 Ga0495605_0009851 3300046474 Bacteria 5360
303 Ga0495605_0011164 3300046474 Bacteria 5017
304 Ga0495605_0053716 3300046474 Bacteria 1953
305 Ga0495605_0101545 3300046474 Bacteria 1321
306 Ga0495605_0106503 3300046474 Bacteria 1283
307 Ga0495605_0215949 3300046474 Bacteria 830
308 Ga0495584_0006588 3300046491 Bacteria 6067
309 Ga0495584_0008641 3300046491 Bacteria 5272
310 Ga0495584_0011141 3300046491 Bacteria 4609
311 Ga0495584_0011373 3300046491 Bacteria 4558
312 Ga0495584_0053020 3300046491 Bacteria 2041
313 Ga0495584_0080957 3300046491 Bacteria 1634
314 Ga0495585_0000449 3300046492 Bacteria 39379
315 Ga0495585_0004849 3300046492 Bacteria 8632
316 Ga0495585_0006937 3300046492 Bacteria 6978
317 Ga0495585_0012352 3300046492 Bacteria 5032
318 Ga0495585_0013780 3300046492 Bacteria 4724
319 Ga0495585_0016148 3300046492 Bacteria 4327
320 Ga0495585_0023743 3300046492 Bacteria 3519
321 Ga0495585_0054211 3300046492 Bacteria 2217
322 Ga0495585_0084519 3300046492 Bacteria 1716
323 Ga0495585_0105008 3300046492 Bacteria 1507
324 Ga0495594_0001546 3300046499 Bacteria 11948
325 Ga0495596_0119663 3300046500 Bacteria 1022
326 Ga0495607_0002064 3300046501 Bacteria 16791
327 Ga0495607_0002552 3300046501 Bacteria 14727
328 Ga0495607_0009239 3300046501 Bacteria 6696
329 Ga0495607_0009674 3300046501 Bacteria 6511
330 Ga0495607_0012852 3300046501 Bacteria 5506
331 Ga0495607_0013273 3300046501 Bacteria 5405
332 Ga0495607_0028107 3300046501 Bacteria 3472
333 Ga0495607_0036152 3300046501 Bacteria 2979
334 Ga0495607_0050616 3300046501 Bacteria 2417
335 Ga0495607_0056541 3300046501 Bacteria 2252
336 Ga0495583_0000052 3300046506 Bacteria 211902
337 Ga0495583_0003705 3300046506 Bacteria 11368
338 Ga0495583_0012898 3300046506 Bacteria 4696
339 Ga0495583_0047538 3300046506 Bacteria 1972
340 Ga0495606_0002555 3300046507 Bacteria 20910
341 Ga0495606_0003634 3300046507 Bacteria 16193
342 Ga0495606_0015001 3300046507 Bacteria 6006
343 Ga0495606_0015518 3300046507 Bacteria 5863
344 Ga0495606_0016129 3300046507 Bacteria 5714
345 Ga0495606_0034793 3300046507 Bacteria 3453
346 Ga0495606_0043570 3300046507 Bacteria 2991
347 Ga0495606_0059978 3300046507 Bacteria 2438
348 Ga0495606_0060058 3300046507 Bacteria 2436
349 Ga0495606_0091027 3300046507 Bacteria 1876
350 Ga0495606_0301236 3300046507 Bacteria 868
351 Ga0495610_0007817 3300046512 Bacteria 7043
352 Ga0495610_0007867 3300046512 Bacteria 7007
353 Ga0495610_0014877 3300046512 Bacteria 4549
354 Ga0495610_0015869 3300046512 Bacteria 4357
355 Ga0495610_0041504 3300046512 Bacteria 2309
356 Ga0495610_0074237 3300046512 Bacteria 1578
357 Ga0495610_0213719 3300046512 Bacteria 783
358 Ga0495616_0006260 3300046513 Bacteria 7229
359 Ga0495616_0010101 3300046513 Bacteria 5477
360 Ga0495616_0010526 3300046513 Bacteria 5351
361 Ga0495616_0010704 3300046513 Bacteria 5294
362 Ga0495616_0041270 3300046513 Bacteria 2354
363 Ga0495616_0135730 3300046513 Bacteria 1124
364 Ga0495620_0000019 3300046515 Bacteria 150014
365 Ga0495620_0005607 3300046515 Bacteria 6988
366 Ga0495620_0005828 3300046515 Bacteria 6841
367 Ga0495620_0007062 3300046515 Bacteria 6126
368 Ga0495620_0010117 3300046515 Bacteria 4986
369 Ga0495620_0020366 3300046515 Bacteria 3240
370 Ga0495620_0028495 3300046515 Bacteria 2596
371 Ga0495631_0001876 3300046518 Bacteria 12399
372 Ga0495631_0005758 3300046518 Bacteria 6467
373 Ga0495631_0055746 3300046518 Bacteria 1722
374 Ga0495631_0065134 3300046518 Bacteria 1577
375 Ga0495632_0009438 3300046519 Bacteria 5887
376 Ga0495632_0010308 3300046519 Bacteria 5547
377 Ga0495632_0013229 3300046519 Bacteria 4717
378 Ga0495632_0014534 3300046519 Bacteria 4448
379 Ga0495632_0026518 3300046519 Bacteria 3049
380 Ga0495632_0103665 3300046519 Bacteria 1339
381 Ga0495632_0171166 3300046519 Bacteria 997
382 Ga0495632_0229958 3300046519 Bacteria 836
383 Ga0495637_0003727 3300046520 Bacteria 8048
384 Ga0495637_0008047 3300046520 Bacteria 5191
385 Ga0495637_0008249 3300046520 Bacteria 5122
386 Ga0495637_0013834 3300046520 Bacteria 3820
387 Ga0495637_0016092 3300046520 Bacteria 3501
388 Ga0495637_0022442 3300046520 Bacteria 2878
389 Ga0495637_0026803 3300046520 Bacteria 2583
390 Ga0495637_0026832 3300046520 Bacteria 2581
391 Ga0495637_0046035 3300046520 Bacteria 1847
392 Ga0495637_0069569 3300046520 Bacteria 1423
393 Ga0495643_0000992 3300046522 Bacteria 28984
394 Ga0495643_0005101 3300046522 Bacteria 8982
395 Ga0495643_0010882 3300046522 Bacteria 5572
396 Ga0495643_0031951 3300046522 Bacteria 2925
397 Ga0495643_0046463 3300046522 Bacteria 2354
398 Ga0495643_0051210 3300046522 Bacteria 2221
399 Ga0495643_0242126 3300046522 Bacteria 846
400 Ga0495644_0020911 3300046523 Bacteria 2496
401 Ga0495644_0033861 3300046523 Bacteria 1929
402 Ga0495648_0000438 3300046524 Bacteria 45257
403 Ga0495648_0011838 3300046524 Bacteria 6544
404 Ga0495648_0013448 3300046524 Bacteria 6049
405 Ga0495648_0015180 3300046524 Bacteria 5607
406 Ga0495648_0034364 3300046524 Bacteria 3299
407 Ga0495648_0038088 3300046524 Bacteria 3081
408 Ga0495648_0042292 3300046524 Bacteria 2868
409 Ga0495648_0076004 3300046524 Bacteria 1929
410 Ga0495648_0088274 3300046524 Bacteria 1743
411 Ga0495648_0236915 3300046524 Bacteria 889
412 Ga0495642_0002385 3300046528 Bacteria 7651
413 Ga0495654_0003101 3300046530 Bacteria 10330
414 Ga0495654_0003994 3300046530 Bacteria 8881
415 Ga0495654_0028074 3300046530 Bacteria 2880
416 Ga0495654_0031674 3300046530 Bacteria 2684
417 Ga0495654_0038798 3300046530 Bacteria 2379
418 Ga0495654_0041431 3300046530 Bacteria 2290
419 Ga0495654_0046636 3300046530 Bacteria 2133
420 Ga0495654_0046667 3300046530 Bacteria 2133
421 Ga0495609_0000032 3300046538 Bacteria 211021
422 Ga0495609_0006113 3300046538 Bacteria 6194
423 Ga0495609_0008722 3300046538 Bacteria 4943
424 Ga0495609_0015536 3300046538 Bacteria 3562
425 Ga0495609_0118893 3300046538 Bacteria 1137
426 Ga0495609_0154730 3300046538 Bacteria 974
427 Ga0495597_0007490 3300046542 Bacteria 5535
428 Ga0495597_0022290 3300046542 Bacteria 2938
429 Ga0495597_0033654 3300046542 Bacteria 2319
430 Ga0495597_0106683 3300046542 Bacteria 1177
431 Ga0495622_0004645 3300046557 Bacteria 6362
432 Ga0495622_0115394 3300046557 Bacteria 1228
433 Ga0495633_0000040 3300046558 Bacteria 177876
434 Ga0495633_0020542 3300046558 Bacteria 3320
435 Ga0495656_0005554 3300046615 Bacteria 4357
436 Ga0495656_0169915 3300046615 Bacteria 1065
437 Ga0495668_0010212 3300046616 Bacteria 5702
438 Ga0495668_0278984 3300046616 Bacteria 915
439 Ga0495611_0000703 3300046648 Bacteria 18958
440 Ga0495611_0002592 3300046648 Bacteria 8179
441 Ga0495611_0009888 3300046648 Bacteria 4036
442 Ga0495611_0136228 3300046648 Bacteria 1146
443 Ga0495625_0005388 3300046660 Bacteria 11699
444 Ga0495625_0024482 3300046660 Bacteria 4593
445 Ga0495625_0053601 3300046660 Bacteria 2883
446 Ga0495625_0087920 3300046660 Bacteria 2153
447 Ga0495625_0167557 3300046660 Bacteria 1468
448 Ga0495625_0329868 3300046660 Bacteria 969
449 Ga0495659_0065846 3300046664 Bacteria 1348
450 Ga0495661_0000007 3300046665 Bacteria 411832
451 Ga0495661_0000037 3300046665 Bacteria 164234
452 Ga0495661_0007918 3300046665 Bacteria 7382
453 Ga0495661_0025864 3300046665 Bacteria 3785
454 Ga0495661_0032941 3300046665 Bacteria 3271
455 Ga0495661_0055669 3300046665 Bacteria 2370
456 Ga0495661_0079164 3300046665 Bacteria 1899
457 Ga0495661_0238437 3300046665 Bacteria 934
458 Ga0495669_0000839 3300046684 Bacteria 13092
459 Ga0495670_0003137 3300046691 Bacteria 8141
460 Ga0495670_0006885 3300046691 Bacteria 5593
461 Ga0495670_0007924 3300046691 Bacteria 5221
462 Ga0495670_0029087 3300046691 Bacteria 2741
463 Ga0495670_0034791 3300046691 Bacteria 2510
464 Ga0495670_0051596 3300046691 Bacteria 2058
465 Ga0495671_0004249 3300046692 Bacteria 8616
466 Ga0495671_0005553 3300046692 Bacteria 7373
467 Ga0495671_0014649 3300046692 Bacteria 4214
468 Ga0495671_0029200 3300046692 Bacteria 2834
469 Ga0495671_0043788 3300046692 Bacteria 2246
470 Ga0495671_0050013 3300046692 Bacteria 2082
471 Ga0495671_0094744 3300046692 Bacteria 1460
472 Ga0495671_0099842 3300046692 Bacteria 1419
473 Ga0495671_0107753 3300046692 Bacteria 1360
474 Ga0495649_0006668 3300046694 Bacteria 7166
475 Ga0495649_0006673 3300046694 Bacteria 7163
476 Ga0495649_0009526 3300046694 Bacteria 5762
477 Ga0495649_0012630 3300046694 Bacteria 4901
478 Ga0495649_0020952 3300046694 Bacteria 3663
479 Ga0495649_0033526 3300046694 Bacteria 2826
480 Ga0495649_0068101 3300046694 Bacteria 1910
481 Ga0495649_0071077 3300046694 Bacteria 1865
482 Ga0495649_0124239 3300046694 Bacteria 1363
483 Ga0495589_0000394 3300046794 Bacteria 33438
484 Ga0495589_0005644 3300046794 Bacteria 6596
485 Ga0495589_0017022 3300046794 Bacteria 3732
486 Ga0495589_0022591 3300046794 Bacteria 3209
487 Ga0495589_0129314 3300046794 Bacteria 1213
488 Ga0495589_0140343 3300046794 Bacteria 1157
489 Ga0495660_0000333 3300046810 Bacteria 41657
490 Ga0495660_0002226 3300046810 Bacteria 12475
491 Ga0495660_0011766 3300046810 Bacteria 5074
492 Ga0495660_0025501 3300046810 Bacteria 3357
493 Ga0495660_0038498 3300046810 Bacteria 2658
494 Ga0495660_0038782 3300046810 Bacteria 2647
495 Ga0495660_0043148 3300046810 Bacteria 2488
496 Ga0495660_0107879 3300046810 Bacteria 1424
497 Ga0495660_0110453 3300046810 Bacteria 1403
498 Ga0495660_0193617 3300046810 Bacteria 975
499 Ga0495660_0230782 3300046810 Bacteria 867
500 Ga0495636_0129286 3300047318 Bacteria 1122
501 Ga0495672_0026318 3300047320 Bacteria 3713
502 Ga0495672_0031792 3300047320 Bacteria 3291
503 Ga0495672_0031933 3300047320 Bacteria 3283
504 Ga0495672_0033751 3300047320 Bacteria 3168
505 Ga0495672_0059096 3300047320 Bacteria 2219
506 Ga0495676_0016572 3300047321 Bacteria 6534
507 Ga0495680_0053382 3300047322 Bacteria 3146
508 Ga0495683_0000006 3300047323 Bacteria 272409
509 Ga0495683_0000011 3300047323 Bacteria 212053
510 Ga0495683_0010975 3300047323 Bacteria 4778
511 Ga0495683_0019600 3300047323 Bacteria 3491
512 Ga0495683_0023801 3300047323 Bacteria 3146
513 Ga0495683_0100606 3300047323 Bacteria 1390
514 Ga0495683_0114147 3300047323 Bacteria 1287
515 Ga0495683_0161103 3300047323 Bacteria 1037
516 Ga0495677_0006568 3300047445 Bacteria 4392
517 Ga0495679_000192 3300047446 Bacteria 54152
518 Ga0495679_009017 3300047446 Bacteria 4018
519 Ga0495679_011497 3300047446 Bacteria 3415
520 Ga0495679_020356 3300047446 Bacteria 2312
521 Ga0495679_036462 3300047446 Bacteria 1553
522 Ga0495679_043488 3300047446 Bacteria 1381
523 Ga0495679_061674 3300047446 Bacteria 1098
524 Ga0495679_071841 3300047446 Bacteria 995
525 Ga0495673_0006524 3300047469 Bacteria 6847
526 Ga0495673_0009193 3300047469 Bacteria 5485
527 Ga0495673_0014480 3300047469 Bacteria 4098
528 Ga0495673_0021559 3300047469 Bacteria 3178
529 Ga0495673_0022410 3300047469 Bacteria 3096
530 Ga0495673_0033043 3300047469 Bacteria 2405
531 Ga0495673_0036516 3300047469 Bacteria 2253
532 Ga0495681_0002128 3300047470 Bacteria 14377
533 Ga0495681_0008666 3300047470 Bacteria 6350
534 Ga0495681_0019411 3300047470 Bacteria 3712
535 Ga0495681_0042555 3300047470 Bacteria 2197
536 Ga0495681_0056471 3300047470 Bacteria 1826
537 Ga0495681_0069826 3300047470 Bacteria 1595
538 Ga0495686_0007810 3300047472 Bacteria 7957
539 Ga0495686_0019747 3300047472 Bacteria 4499
540 Ga0495686_0052034 3300047472 Bacteria 2568
541 Ga0495686_0111209 3300047472 Bacteria 1643
542 Ga0495626_0005132 3300048091 Bacteria 7781
543 Ga0495626_0006480 3300048091 Bacteria 6662
544 Ga0495626_0010352 3300048091 Bacteria 4981
545 Ga0495626_0015898 3300048091 Bacteria 3839
546 Ga0495626_0028345 3300048091 Bacteria 2716
547 Ga0495626_0059546 3300048091 Bacteria 1742
548 Ga0496112_0197990 3300048915 Bacteria 1969
549 Ga0496116_0002889 3300048919 Bacteria 17575
550 Ga0496116_0013366 3300048919 Bacteria 6626
551 Ga0496116_0018246 3300048919 Bacteria 5416
552 Ga0496116_0020950 3300048919 Bacteria 4945
553 Ga0496117_0015839 3300048920 Bacteria 6395
554 Ga0496117_0020601 3300048920 Bacteria 5370
555 Ga0496117_0025888 3300048920 Bacteria 4600
556 Ga0496117_0038938 3300048920 Bacteria 3515
557 Ga0496118_0014619 3300048921 Bacteria 7336
558 Ga0496118_0018544 3300048921 Bacteria 6270
559 Ga0496118_0063638 3300048921 Bacteria 2712
560 Ga0496118_0250630 3300048921 Bacteria 1006
561 Ga0496119_0032994 3300048922 Bacteria 3442
562 Ga0496120_0012754 3300048923 Bacteria 5697
563 Ga0496120_0031272 3300048923 Bacteria 3225
564 Ga0496121_0005129 3300048924 Bacteria 17058
565 Ga0496121_0034600 3300048924 Bacteria 4545
566 Ga0496121_0056483 3300048924 Bacteria 3260
567 Ga0496122_0016760 3300048925 Bacteria 6903
568 Ga0496122_0019635 3300048925 Bacteria 6161
569 Ga0496122_0056891 3300048925 Bacteria 2910
570 Ga0496122_0219751 3300048925 Bacteria 1091
571 Ga0496123_0004084 3300048926 Bacteria 15709
572 Ga0496123_0006688 3300048926 Bacteria 11108
573 Ga0496123_0016755 3300048926 Bacteria 5930
574 Ga0496123_0031854 3300048926 Bacteria 3827
575 Ga0496123_0172637 3300048926 Bacteria 1138
576 Ga0496124_0002584 3300048927 Bacteria 23434
577 Ga0496125_0002457 3300048928 Bacteria 24077
578 Ga0496125_0043431 3300048928 Bacteria 3815
579 Ga0496126_0249771 3300048929 Bacteria 1479
580 Ga0496126_0367678 3300048929 Bacteria 1173
581 Ga0495678_000033 3300049459 Bacteria 211804
582 Ga0495678_007019 3300049459 Bacteria 5903
583 Ga0495678_007071 3300049459 Bacteria 5871
584 Ga0495678_007414 3300049459 Bacteria 5684
585 Ga0495678_008780 3300049459 Bacteria 5064
586 Ga0495678_010166 3300049459 Bacteria 4587
587 Ga0495678_036822 3300049459 Bacteria 1993
588 Ga0495678_041294 3300049459 Bacteria 1847
589 Ga0495678_097077 3300049459 Bacteria 1027
590 Ga0495682_0006524 3300049460 Bacteria 4714
591 Ga0495682_0022762 3300049460 Bacteria 2342
592 Ga0495682_0050870 3300049460 Bacteria 1507
593 Ga0501034_0000055 3300049571 Bacteria 205427
594 Ga0501241_000825 3300049758 Bacteria 6570
595 Ga0501226_000032 3300049853 Bacteria 73400
596 Ga0500572_004620 3300053111 Bacteria 3121
597 Ga0500618_005167 3300053125 Bacteria 4012
598 Ga0500659_0024100 3300053135 Bacteria 3319

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032004 Ga0307414_10737550 Ga0307414_107375501 203
2 3300031911 Ga0307412_10022480 Ga0307412_100224802 206
3 3300048923 Ga0496120_0031272 Ga0496120_0031272_887_1507 206
4 3300046452 Ga0495617_116051 Ga0495617_116051_155_853 232
5 iso_pu_bacteria 2738543020 2739286888 234
6 iso_pu_bacteria 2738543021 2739292201 234
7 iso_pu_bacteria 2808606373 2808905052 234
8 iso_pu_bacteria 2842805378 2842809174 234
9 iso_pu_bacteria 2842843487 2842848035 234
10 3300046501 Ga0495607_0050616 Ga0495607_0050616_791_1522 235
11 3300047446 Ga0495679_061674 Ga0495679_061674_340_1071 235
12 3300047469 Ga0495673_0033043 Ga0495673_0033043_874_1605 235
13 iso_pu_bacteria 2511231004 2511255705 235
14 iso_pu_bacteria 2511231010 2511289411 235
15 iso_pu_bacteria 2511231016 2511325668 235
16 iso_pu_bacteria 2511231021 2511353470 235
17 iso_pu_bacteria 2511231022 2511362381 235
18 iso_pu_bacteria 2511231023 2511370849 235
19 iso_pu_bacteria 2511231031 2511412711 235
20 iso_pu_bacteria 2511231156 2511826891 235
21 iso_pu_bacteria 2599185188 2599502758 235
22 iso_pu_bacteria 2599185212 2599614046 235
23 iso_pu_bacteria 2599185248 2599771415 235
24 iso_pu_bacteria 2599185289 2599888638 235
25 iso_pu_bacteria 2599185291 2599900647 235
26 iso_pu_bacteria 2599185300 2599930212 235
27 iso_pu_bacteria 2599185302 2599943168 235
28 iso_pu_bacteria 2599185304 2599953793 235
29 iso_pu_bacteria 2599185305 2599963502 235
30 iso_pu_bacteria 2599185306 2599966645 235
31 iso_pu_bacteria 2599185308 2599977790 235
32 iso_pu_bacteria 2599185309 2599983369 235
33 iso_pu_bacteria 2599185310 2599987390 235
34 iso_pu_bacteria 2599185311 2599996290 235
35 iso_pu_bacteria 2599185312 2599999781 235
36 iso_pu_bacteria 2599185313 2600005809 235
37 iso_pu_bacteria 2599185314 2600011951 235
38 iso_pu_bacteria 2599185315 2600020662 235
39 iso_pu_bacteria 2599185316 2600024239 235
40 iso_pu_bacteria 2599185317 2600027958 235
41 iso_pu_bacteria 2599185318 2600033341 235
42 iso_pu_bacteria 2599185319 2600043371 235
43 iso_pu_bacteria 2599185320 2600045715 235
44 iso_pu_bacteria 2599185321 2600055327 235
45 iso_pu_bacteria 2599185322 2600060779 235
46 iso_pu_bacteria 2599185323 2600066901 235
47 iso_pu_bacteria 2599185324 2600071187 235
48 iso_pu_bacteria 2599185325 2600078699 235
49 iso_pu_bacteria 2600254930 2600357125 235
50 iso_pu_bacteria 2600254954 2600443527 235
51 iso_pu_bacteria 2600255389 2602009019 235
52 iso_pu_bacteria 2643221565 2643844080 235
53 iso_pu_bacteria 2643221650 2644285897 235
54 iso_pu_bacteria 2651869719 2652548424 235
55 iso_pu_bacteria 2667528170 2671092930 235
56 iso_pu_bacteria 2667528176 2671125735 235
57 iso_pu_bacteria 2675903420 2677898567 235
58 iso_pu_bacteria 2675903515 2678265262 235
59 iso_pu_bacteria 2713897148 2715750940 235
60 iso_pu_bacteria 2718217725 2718632582 235
61 iso_pu_bacteria 2738543025 2739314753 235
62 iso_pu_bacteria 2744054620 2745005719 235
63 iso_pu_bacteria 2773857673 2774136837 235
64 iso_pu_bacteria 2784132063 2784260591 235
65 iso_pu_bacteria 2791355520 2794595440 235
66 iso_pu_bacteria 2808606361 2808853934 235
67 iso_pu_bacteria 2808606376 2808923227 235
68 iso_pu_bacteria 2808606378 2808933966 235
69 iso_pu_bacteria 2808606380 2808945498 235
70 iso_pu_bacteria 2808606382 2808956313 235
71 iso_pu_bacteria 2808606383 2808962633 235
72 iso_pu_bacteria 2808606389 2808997326 235
73 iso_pu_bacteria 2808606445 2809215627 235
74 iso_pu_bacteria 2825651385 2825655845 235
75 iso_pu_bacteria 2842832357 2842835836 235
76 iso_pu_bacteria 2842854478 2842856249 235
77 iso_pu_bacteria 2852657418 2852661624 235
78 iso_pu_bacteria 2880230671 2880231561 235
79 iso_pu_bacteria 2904518522 2904523315 235
80 iso_pu_bacteria 2908446538 2908447379 235
81 iso_pu_bacteria 2913036834 2913037756 235
82 iso_pu_bacteria 2919385768 2919390860 235
83 iso_pu_bacteria 2919481497 2919482630 235
84 iso_pu_bacteria 2919487758 2919492523 235
85 iso_pu_bacteria 2919501602 2919501854 235
86 iso_pu_bacteria 2923586266 2923590515 235
87 iso_pu_bacteria 2926063275 2926063527 235
88 iso_pu_bacteria 2929144301 2929149185 235
89 iso_pu_bacteria 2931369376 2931373402 235
90 iso_pu_bacteria 2939636861 2939638288 235
91 iso_pu_bacteria 2945961074 2945961181 235
92 iso_pu_bacteria 2946006987 2946012149 235
93 iso_pu_bacteria 2969304461 2969305476 235
94 iso_pu_bacteria 2974289157 2974292887 235
95 iso_pu_bacteria 2988728565 2988732718 235
96 iso_pu_bacteria 2998139840 2998140920 235
97 iso_pu_bacteria 3007395558 3007401697 235
98 iso_pu_bacteria 3007614139 3007618596 235
99 iso_pu_bacteria 3007855910 3007860814 235
100 iso_pu_bacteria 3007861166 3007863860 235
101 iso_pu_bacteria 3007866637 3007867466 235
102 iso_pu_bacteria 8029995093 8029999838 235
103 iso_pu_bacteria 8034962539 8034963108 235
104 iso_pu_bacteria 8052494512 8052497060 235
105 iso_pu_bacteria 8056143049 8056144200 235
106 iso_pu_bacteria 8056155041 8056161051 235
107 iso_pu_bacteria 8056166840 8056170130 235
108 iso_pu_bacteria 8056177738 8056180750 235
109 iso_pu_bacteria 8056569372 8056569573 235
110 iso_pu_bacteria 2808606377 2808928898 237
111 iso_pu_bacteria 2808606381 2808951019 237
112 3300013104 Ga0157370_10003874 Ga0157370_100038745 238
113 3300013104 Ga0157370_10108791 Ga0157370_101087911 238
114 3300015261 Ga0182006_1003667 Ga0182006_10036674 238
115 3300015261 Ga0182006_1023141 Ga0182006_10231413 238
116 3300031824 Ga0307413_10037803 Ga0307413_100378033 238
117 3300032004 Ga0307414_10002569 Ga0307414_100025694 238
118 3300032004 Ga0307414_10128910 Ga0307414_101289102 238
119 3300041407 Ga0439447_003897 Ga0439447_003897_2781_3500 238
120 3300041411 Ga0439466_0026103 Ga0439466_0026103_509_1228 238
121 3300042156 Ga0439446_0000627 Ga0439446_0000627_1834_2550 238
122 3300046501 Ga0495607_0002064 Ga0495607_0002064_8783_9508 238
123 3300046507 Ga0495606_0002555 Ga0495606_0002555_1823_2539 238
124 3300046522 Ga0495643_0000992 Ga0495643_0000992_4984_5700 238
125 3300046522 Ga0495643_0005101 Ga0495643_0005101_4326_5042 238
126 3300046692 Ga0495671_0005553 Ga0495671_0005553_1838_2554 238
127 3300046694 Ga0495649_0006673 Ga0495649_0006673_1770_2486 238
128 3300046694 Ga0495649_0068101 Ga0495649_0068101_572_1288 238
129 3300046810 Ga0495660_0193617 Ga0495660_0193617_202_918 238
130 iso_pu_bacteria 2511231007 2511274134 238
131 iso_pu_bacteria 2554235341 2555667888 238
132 iso_pu_bacteria 2599185155 2599326863 238
133 iso_pu_bacteria 2599185160 2599354893 238
134 iso_pu_bacteria 2599185161 2599361282 238
135 iso_pu_bacteria 2599185162 2599367604 238
136 iso_pu_bacteria 2599185163 2599374394 238
137 iso_pu_bacteria 2599185164 2599379999 238
138 iso_pu_bacteria 2599185165 2599386446 238
139 iso_pu_bacteria 2599185166 2599393252 238
140 iso_pu_bacteria 2599185168 2599405019 238
141 iso_pu_bacteria 2599185181 2599461727 238
142 iso_pu_bacteria 2599185182 2599467229 238
143 iso_pu_bacteria 2599185186 2599491180 238
144 iso_pu_bacteria 2599185356 2600214348 238
145 iso_pu_bacteria 2600255313 2601774947 238
146 iso_pu_bacteria 2667528171 2671097495 238
147 iso_pu_bacteria 2765235841 2765584838 238
148 iso_pu_bacteria 2818991464 2819702577 238
149 iso_pu_bacteria 2826581358 2826584650 238
150 iso_pu_bacteria 2842815866 2842816521 238
151 iso_pu_bacteria 2842849001 2842850107 238
152 iso_pu_bacteria 2844665904 2844668403 238
153 iso_pu_bacteria 2904550169 2904555789 238
154 iso_pu_bacteria 2917070673 2917071650 238
155 iso_pu_bacteria 2935353572 2935353823 238
156 iso_pu_bacteria 637000220 637318271 238
157 iso_pu_bacteria 8057798959 8057803182 238
158 3300003781 Ga0055536_1002228 Ga0055536_10022284 239
159 3300003791 Ga0055530_10000336 Ga0055530_1000033635 239
160 3300003792 Ga0055540_1000322 Ga0055540_10003229 239
161 3300005288 Ga0065714_10010863 Ga0065714_100108632 239
162 3300005288 Ga0065714_10065517 Ga0065714_100655179 239
163 3300005288 Ga0065714_10120069 Ga0065714_101200692 239
164 3300005289 Ga0065704_10000256 Ga0065704_1000025616 239
165 3300005289 Ga0065704_10310478 Ga0065704_103104781 239
166 3300005457 Ga0070662_100018398 Ga0070662_1000183984 239
167 3300005548 Ga0070665_100044593 Ga0070665_1000445934 239
168 3300006051 Ga0075364_10046204 Ga0075364_100462042 239
169 3300006051 Ga0075364_10147150 Ga0075364_101471502 239
170 3300006177 Ga0075362_10202306 Ga0075362_102023061 239
171 3300006944 Ga0099823_1000007 Ga0099823_100000785 239
172 3300006946 Ga0079104_1003794 Ga0079104_10037944 239
173 3300006946 Ga0079104_1003813 Ga0079104_10038134 239
174 3300006948 Ga0099826_10037194 Ga0099826_100371942 239
175 3300009011 Ga0105251_10015004 Ga0105251_100150042 239
176 3300009011 Ga0105251_10017266 Ga0105251_100172661 239
177 3300009036 Ga0105244_10009994 Ga0105244_100099944 239
178 3300009036 Ga0105244_10025589 Ga0105244_100255891 239
179 3300009092 Ga0105250_10004277 Ga0105250_100042773 239
180 3300009092 Ga0105250_10010281 Ga0105250_100102813 239
181 3300009092 Ga0105250_10026147 Ga0105250_100261472 239
182 3300010375 Ga0105239_10457170 Ga0105239_104571702 239
183 3300012498 Ga0157345_1000238 Ga0157345_10002383 239
184 3300013100 Ga0157373_10010754 Ga0157373_100107543 239
185 3300013100 Ga0157373_10011755 Ga0157373_100117553 239
186 3300013100 Ga0157373_10050194 Ga0157373_100501941 239
187 3300013100 Ga0157373_10075618 Ga0157373_100756182 239
188 3300013102 Ga0157371_10008144 Ga0157371_100081444 239
189 3300013102 Ga0157371_10009323 Ga0157371_100093235 239
190 3300013102 Ga0157371_10041781 Ga0157371_100417812 239
191 3300013104 Ga0157370_10636913 Ga0157370_106369132 239
192 3300013105 Ga0157369_10027248 Ga0157369_100272483 239
193 3300013105 Ga0157369_10390597 Ga0157369_103905972 239
194 3300013306 Ga0163162_10008280 Ga0163162_100082806 239
195 3300013306 Ga0163162_10055631 Ga0163162_100556313 239
196 3300013307 Ga0157372_10032360 Ga0157372_100323603 239
197 3300013308 Ga0157375_10003699 Ga0157375_100036999 239
198 3300014497 Ga0182008_10022683 Ga0182008_100226832 239
199 3300015261 Ga0182006_1005837 Ga0182006_10058373 239
200 3300015261 Ga0182006_1011364 Ga0182006_10113642 239
201 3300015261 Ga0182006_1023176 Ga0182006_10231762 239
202 3300015261 Ga0182006_1025538 Ga0182006_10255382 239
203 3300015261 Ga0182006_1029057 Ga0182006_10290572 239
204 3300017792 Ga0163161_10010000 Ga0163161_100100003 239
205 3300017792 Ga0163161_10037903 Ga0163161_100379032 239
206 3300017792 Ga0163161_10084697 Ga0163161_100846972 239
207 3300017792 Ga0163161_10234044 Ga0163161_102340442 239
208 3300025292 Ga0209676_1000101 Ga0209676_100010137 239
209 3300025292 Ga0209676_1006732 Ga0209676_10067325 239
210 3300025298 Ga0209050_1000027 Ga0209050_1000027379 239
211 3300025298 Ga0209050_1043091 Ga0209050_10430912 239
212 3300025303 Ga0209051_1000102 Ga0209051_100010293 239
213 3300025304 Ga0209257_1011392 Ga0209257_10113922 239
214 3300025711 Ga0207696_1000032 Ga0207696_100003217 239
215 3300025711 Ga0207696_1003100 Ga0207696_10031003 239
216 3300025711 Ga0207696_1004141 Ga0207696_10041414 239
217 3300025728 Ga0207655_1013621 Ga0207655_10136212 239
218 3300025728 Ga0207655_1020163 Ga0207655_10201633 239
219 3300025728 Ga0207655_1023667 Ga0207655_10236673 239
220 3300025728 Ga0207655_1056036 Ga0207655_10560362 239
221 3300025735 Ga0207713_1005905 Ga0207713_10059053 239
222 3300025735 Ga0207713_1009882 Ga0207713_10098824 239
223 3300025735 Ga0207713_1014734 Ga0207713_10147344 239
224 3300025735 Ga0207713_1015550 Ga0207713_10155503 239
225 3300025933 Ga0207706_10003352 Ga0207706_100033523 239
226 3300025935 Ga0207709_10621422 Ga0207709_106214221 239
227 3300027111 Ga0209281_1000015 Ga0209281_1000015204 239
228 3300027111 Ga0209281_1006660 Ga0209281_10066602 239
229 3300027111 Ga0209281_1007647 Ga0209281_10076472 239
230 3300027296 Ga0209389_1000050 Ga0209389_100005017 239
231 3300028379 Ga0268266_10029099 Ga0268266_100290992 239
232 3300030521 Ga0307511_10020062 Ga0307511_100200625 239
233 3300030735 Ga0316178_1023745 Ga0316178_10237456 239
234 3300030744 Ga0316181_1111488 Ga0316181_11114882 239
235 3300031548 Ga0307408_100000020 Ga0307408_100000020172 239
236 3300031548 Ga0307408_100007609 Ga0307408_1000076094 239
237 3300031548 Ga0307408_100009277 Ga0307408_1000092773 239
238 3300031548 Ga0307408_100011411 Ga0307408_1000114113 239
239 3300031548 Ga0307408_100762096 Ga0307408_1007620961 239
240 3300031730 Ga0307516_10160597 Ga0307516_101605971 239
241 3300031731 Ga0307405_10002918 Ga0307405_100029185 239
242 3300031731 Ga0307405_10008612 Ga0307405_100086123 239
243 3300031731 Ga0307405_10058752 Ga0307405_100587522 239
244 3300031731 Ga0307405_10199978 Ga0307405_101999781 239
245 3300031824 Ga0307413_10036436 Ga0307413_100364362 239
246 3300031852 Ga0307410_10487493 Ga0307410_104874931 239
247 3300031901 Ga0307406_10021155 Ga0307406_100211552 239
248 3300031901 Ga0307406_10323315 Ga0307406_103233151 239
249 3300031903 Ga0307407_10028872 Ga0307407_100288722 239
250 3300031903 Ga0307407_10103498 Ga0307407_101034982 239
251 3300031911 Ga0307412_10017230 Ga0307412_100172302 239
252 3300031911 Ga0307412_10017991 Ga0307412_100179913 239
253 3300031911 Ga0307412_10031217 Ga0307412_100312172 239
254 3300031911 Ga0307412_10050941 Ga0307412_100509412 239
255 3300031995 Ga0307409_100050436 Ga0307409_1000504362 239
256 3300031995 Ga0307409_100059292 Ga0307409_1000592922 239
257 3300032002 Ga0307416_100579008 Ga0307416_1005790082 239
258 3300032004 Ga0307414_10084800 Ga0307414_100848002 239
259 3300032005 Ga0307411_10005294 Ga0307411_100052943 239
260 3300032005 Ga0307411_10016793 Ga0307411_100167933 239
261 3300032005 Ga0307411_10046041 Ga0307411_100460412 239
262 3300032005 Ga0307411_10176883 Ga0307411_101768832 239
263 3300033180 Ga0307510_10027015 Ga0307510_100270153 239
264 3300041405 Ga0439438_000126 Ga0439438_000126_782_1504 239
265 3300041405 Ga0439438_003164 Ga0439438_003164_2896_3615 239
266 3300041405 Ga0439438_003304 Ga0439438_003304_3367_4086 239
267 3300041405 Ga0439438_004635 Ga0439438_004635_1767_2486 239
268 3300041405 Ga0439438_005883 Ga0439438_005883_3296_4015 239
269 3300041405 Ga0439438_005887 Ga0439438_005887_2586_3305 239
270 3300041405 Ga0439438_006220 Ga0439438_006220_2751_3470 239
271 3300041407 Ga0439447_002894 Ga0439447_002894_3057_3779 239
272 3300041407 Ga0439447_006049 Ga0439447_006049_48_767 239
273 3300041407 Ga0439447_007295 Ga0439447_007295_2418_3137 239
274 3300041407 Ga0439447_022559 Ga0439447_022559_537_1256 239
275 3300041407 Ga0439447_037403 Ga0439447_037403_281_1003 239
276 3300041411 Ga0439466_0004879 Ga0439466_0004879_4045_4764 239
277 3300041411 Ga0439466_0007250 Ga0439466_0007250_1203_1925 239
278 3300041411 Ga0439466_0017434 Ga0439466_0017434_259_978 239
279 3300041411 Ga0439466_0026724 Ga0439466_0026724_537_1256 239
280 3300041411 Ga0439466_0071894 Ga0439466_0071894_125_844 239
281 3300041997 Ga0439431_0003989 Ga0439431_0003989_2295_3014 239
282 3300041997 Ga0439431_0029928 Ga0439431_0029928_374_1093 239
283 3300042000 Ga0439437_000800 Ga0439437_000800_1828_2547 239
284 3300042006 Ga0439432_006458 Ga0439432_006458_2673_3392 239
285 3300042006 Ga0439432_017200 Ga0439432_017200_448_1170 239
286 3300042006 Ga0439432_021238 Ga0439432_021238_1211_1930 239
287 3300042006 Ga0439432_028342 Ga0439432_028342_106_825 239
288 3300042006 Ga0439432_034709 Ga0439432_034709_330_1049 239
289 3300042006 Ga0439432_038741 Ga0439432_038741_304_1026 239
290 3300042009 Ga0439451_011550 Ga0439451_011550_1043_1762 239
291 3300042009 Ga0439451_017038 Ga0439451_017038_423_1142 239
292 3300042009 Ga0439451_018725 Ga0439451_018725_355_1074 239
293 3300042010 Ga0439452_000071 Ga0439452_000071_44313_45035 239
294 3300042010 Ga0439452_001530 Ga0439452_001530_4112_4831 239
295 3300042010 Ga0439452_001780 Ga0439452_001780_3254_3973 239
296 3300042010 Ga0439452_011907 Ga0439452_011907_1550_2269 239
297 3300042010 Ga0439452_014825 Ga0439452_014825_1125_1844 239
298 3300042010 Ga0439452_015158 Ga0439452_015158_882_1601 239
299 3300042012 Ga0439455_0006654 Ga0439455_0006654_1187_1906 239
300 3300042013 Ga0439456_001033 Ga0439456_001033_2874_3593 239
301 3300042013 Ga0439456_013219 Ga0439456_013219_397_1116 239
302 3300042013 Ga0439456_051036 Ga0439456_051036_96_815 239
303 3300042016 Ga0439463_020531 Ga0439463_020531_702_1421 239
304 3300042115 Ga0450911_000028 Ga0450911_000028_45969_46688 239
305 3300042115 Ga0450911_000748 Ga0450911_000748_4482_5201 239
306 3300042115 Ga0450911_002001 Ga0450911_002001_2803_3522 239
307 3300042121 Ga0450919_006381 Ga0450919_006381_188_907 239
308 3300042124 Ga0450922_000751 Ga0450922_000751_1490_2209 239
309 3300042125 Ga0450923_001749 Ga0450923_001749_1727_2446 239
310 3300042127 Ga0450890_000564 Ga0450890_000564_2890_3609 239
311 3300042137 Ga0450902_002522 Ga0450902_002522_460_1182 239
312 3300042138 Ga0450903_001782 Ga0450903_001782_2277_2999 239
313 3300042138 Ga0450903_005313 Ga0450903_005313_719_1438 239
314 3300042139 Ga0450904_000355 Ga0450904_000355_1072_1791 239
315 3300042139 Ga0450904_004439 Ga0450904_004439_210_929 239
316 3300042142 Ga0450905_000878 Ga0450905_000878_1114_1836 239
317 3300042142 Ga0450905_004456 Ga0450905_004456_777_1499 239
318 3300042142 Ga0450905_009342 Ga0450905_009342_16_735 239
319 3300042145 Ga0450906_000598 Ga0450906_000598_2494_3213 239
320 3300042146 Ga0450907_000494 Ga0450907_000494_5785_6504 239
321 3300042146 Ga0450907_002002 Ga0450907_002002_1108_1827 239
322 3300042146 Ga0450907_018928 Ga0450907_018928_134_853 239
323 3300042147 Ga0450910_001041 Ga0450910_001041_2246_2965 239
324 3300042156 Ga0439446_0001258 Ga0439446_0001258_4074_4793 239
325 3300042156 Ga0439446_0015166 Ga0439446_0015166_1048_1767 239
326 3300042184 Ga0450908_028165 Ga0450908_028165_35_754 239
327 3300042185 Ga0450909_001463 Ga0450909_001463_207_926 239
328 3300042435 Ga0439434_0006838 Ga0439434_0006838_214_933 239
329 3300042438 Ga0439459_0003268 Ga0439459_0003268_1800_2519 239
330 3300042439 Ga0439464_0001903 Ga0439464_0001903_4006_4731 239
331 3300042439 Ga0439464_0002953 Ga0439464_0002953_350_1069 239
332 3300042461 Ga0439460_0008217 Ga0439460_0008217_1822_2541 239
333 3300042531 Ga0450918_019941 Ga0450918_019941_290_1009 239
334 3300042532 Ga0450893_0000624 Ga0450893_0000624_2234_2953 239
335 3300042532 Ga0450893_0020164 Ga0450893_0020164_297_1016 239
336 3300042533 Ga0450901_001834 Ga0450901_001834_1236_1955 239
337 3300042993 Ga0439440_0001555 Ga0439440_0001555_1078_1797 239
338 3300046452 Ga0495617_019899 Ga0495617_019899_1144_1863 239
339 3300046452 Ga0495617_029590 Ga0495617_029590_742_1461 239
340 3300046452 Ga0495617_051661 Ga0495617_051661_550_1269 239
341 3300046452 Ga0495617_072940 Ga0495617_072940_358_1077 239
342 3300046453 Ga0495627_002833 Ga0495627_002833_3960_4679 239
343 3300046453 Ga0495627_003142 Ga0495627_003142_2308_3027 239
344 3300046453 Ga0495627_005093 Ga0495627_005093_1784_2503 239
345 3300046453 Ga0495627_007469 Ga0495627_007469_754_1473 239
346 3300046453 Ga0495627_036835 Ga0495627_036835_176_895 239
347 3300046455 Ga0495603_0042926 Ga0495603_0042926_92_820 239
348 3300046457 Ga0495590_0009490 Ga0495590_0009490_1608_2327 239
349 3300046457 Ga0495590_0033099 Ga0495590_0033099_659_1378 239
350 3300046457 Ga0495590_0127936 Ga0495590_0127936_165_884 239
351 3300046458 Ga0495591_003237 Ga0495591_003237_4488_5207 239
352 3300046458 Ga0495591_004091 Ga0495591_004091_4397_5116 239
353 3300046458 Ga0495591_004533 Ga0495591_004533_3269_3988 239
354 3300046458 Ga0495591_005870 Ga0495591_005870_1845_2564 239
355 3300046458 Ga0495591_007361 Ga0495591_007361_1514_2233 239
356 3300046458 Ga0495591_009928 Ga0495591_009928_382_1101 239
357 3300046458 Ga0495591_010598 Ga0495591_010598_2345_3064 239
358 3300046458 Ga0495591_013124 Ga0495591_013124_1507_2226 239
359 3300046458 Ga0495591_017138 Ga0495591_017138_567_1286 239
360 3300046460 Ga0495638_0001043 Ga0495638_0001043_973_1695 239
361 3300046460 Ga0495638_0011366 Ga0495638_0011366_2943_3662 239
362 3300046460 Ga0495638_0036577 Ga0495638_0036577_1058_1777 239
363 3300046460 Ga0495638_0037311 Ga0495638_0037311_27_746 239
364 3300046460 Ga0495638_0168231 Ga0495638_0168231_134_853 239
365 3300046463 Ga0495653_0002473 Ga0495653_0002473_9011_9739 239
366 3300046471 Ga0495650_0014864 Ga0495650_0014864_520_1239 239
367 3300046471 Ga0495650_0029959 Ga0495650_0029959_789_1508 239
368 3300046471 Ga0495650_0030168 Ga0495650_0030168_909_1628 239
369 3300046471 Ga0495650_0068724 Ga0495650_0068724_529_1248 239
370 3300046474 Ga0495605_0009851 Ga0495605_0009851_1925_2644 239
371 3300046474 Ga0495605_0053716 Ga0495605_0053716_324_1052 239
372 3300046474 Ga0495605_0101545 Ga0495605_0101545_302_1021 239
373 3300046474 Ga0495605_0106503 Ga0495605_0106503_87_806 239
374 3300046474 Ga0495605_0215949 Ga0495605_0215949_22_741 239
375 3300046491 Ga0495584_0006588 Ga0495584_0006588_3631_4350 239
376 3300046491 Ga0495584_0008641 Ga0495584_0008641_2378_3097 239
377 3300046491 Ga0495584_0011141 Ga0495584_0011141_3212_3931 239
378 3300046491 Ga0495584_0011373 Ga0495584_0011373_3006_3725 239
379 3300046491 Ga0495584_0053020 Ga0495584_0053020_79_798 239
380 3300046491 Ga0495584_0080957 Ga0495584_0080957_188_907 239
381 3300046492 Ga0495585_0000449 Ga0495585_0000449_8842_9570 239
382 3300046492 Ga0495585_0004849 Ga0495585_0004849_5408_6127 239
383 3300046492 Ga0495585_0006937 Ga0495585_0006937_3844_4563 239
384 3300046492 Ga0495585_0012352 Ga0495585_0012352_1769_2488 239
385 3300046492 Ga0495585_0013780 Ga0495585_0013780_637_1356 239
386 3300046492 Ga0495585_0016148 Ga0495585_0016148_2263_2982 239
387 3300046492 Ga0495585_0023743 Ga0495585_0023743_1604_2332 239
388 3300046492 Ga0495585_0054211 Ga0495585_0054211_856_1575 239
389 3300046492 Ga0495585_0084519 Ga0495585_0084519_721_1440 239
390 3300046492 Ga0495585_0105008 Ga0495585_0105008_530_1249 239
391 3300046500 Ga0495596_0119663 Ga0495596_0119663_177_896 239
392 3300046501 Ga0495607_0002552 Ga0495607_0002552_11158_11886 239
393 3300046501 Ga0495607_0009239 Ga0495607_0009239_2393_3112 239
394 3300046501 Ga0495607_0009674 Ga0495607_0009674_3293_4012 239
395 3300046501 Ga0495607_0012852 Ga0495607_0012852_3449_4168 239
396 3300046501 Ga0495607_0013273 Ga0495607_0013273_1781_2500 239
397 3300046501 Ga0495607_0028107 Ga0495607_0028107_2066_2785 239
398 3300046501 Ga0495607_0036152 Ga0495607_0036152_1672_2391 239
399 3300046501 Ga0495607_0056541 Ga0495607_0056541_722_1441 239
400 3300046506 Ga0495583_0003705 Ga0495583_0003705_1582_2301 239
401 3300046506 Ga0495583_0012898 Ga0495583_0012898_261_980 239
402 3300046506 Ga0495583_0047538 Ga0495583_0047538_531_1259 239
403 3300046507 Ga0495606_0003634 Ga0495606_0003634_10512_11240 239
404 3300046507 Ga0495606_0015001 Ga0495606_0015001_2840_3559 239
405 3300046507 Ga0495606_0015518 Ga0495606_0015518_1800_2519 239
406 3300046507 Ga0495606_0016129 Ga0495606_0016129_2475_3194 239
407 3300046507 Ga0495606_0034793 Ga0495606_0034793_84_803 239
408 3300046507 Ga0495606_0043570 Ga0495606_0043570_1390_2109 239
409 3300046507 Ga0495606_0059978 Ga0495606_0059978_1707_2426 239
410 3300046507 Ga0495606_0060058 Ga0495606_0060058_670_1389 239
411 3300046507 Ga0495606_0091027 Ga0495606_0091027_21_740 239
412 3300046507 Ga0495606_0301236 Ga0495606_0301236_63_782 239
413 3300046512 Ga0495610_0007867 Ga0495610_0007867_1789_2508 239
414 3300046512 Ga0495610_0014877 Ga0495610_0014877_1551_2270 239
415 3300046512 Ga0495610_0015869 Ga0495610_0015869_3296_4015 239
416 3300046512 Ga0495610_0041504 Ga0495610_0041504_559_1278 239
417 3300046512 Ga0495610_0074237 Ga0495610_0074237_170_889 239
418 3300046512 Ga0495610_0213719 Ga0495610_0213719_47_766 239
419 3300046513 Ga0495616_0006260 Ga0495616_0006260_3212_3931 239
420 3300046513 Ga0495616_0010101 Ga0495616_0010101_1803_2522 239
421 3300046513 Ga0495616_0010526 Ga0495616_0010526_2956_3675 239
422 3300046513 Ga0495616_0010704 Ga0495616_0010704_1735_2454 239
423 3300046513 Ga0495616_0135730 Ga0495616_0135730_100_819 239
424 3300046515 Ga0495620_0005607 Ga0495620_0005607_3392_4111 239
425 3300046515 Ga0495620_0005828 Ga0495620_0005828_2461_3180 239
426 3300046515 Ga0495620_0007062 Ga0495620_0007062_1052_1771 239
427 3300046515 Ga0495620_0010117 Ga0495620_0010117_1900_2619 239
428 3300046515 Ga0495620_0020366 Ga0495620_0020366_901_1620 239
429 3300046515 Ga0495620_0028495 Ga0495620_0028495_1665_2384 239
430 3300046518 Ga0495631_0005758 Ga0495631_0005758_2621_3340 239
431 3300046518 Ga0495631_0055746 Ga0495631_0055746_420_1139 239
432 3300046518 Ga0495631_0065134 Ga0495631_0065134_451_1170 239
433 3300046519 Ga0495632_0009438 Ga0495632_0009438_1826_2545 239
434 3300046519 Ga0495632_0010308 Ga0495632_0010308_2143_2862 239
435 3300046519 Ga0495632_0013229 Ga0495632_0013229_1781_2500 239
436 3300046519 Ga0495632_0014534 Ga0495632_0014534_1099_1818 239
437 3300046519 Ga0495632_0026518 Ga0495632_0026518_1790_2509 239
438 3300046519 Ga0495632_0103665 Ga0495632_0103665_562_1281 239
439 3300046519 Ga0495632_0171166 Ga0495632_0171166_266_985 239
440 3300046519 Ga0495632_0229958 Ga0495632_0229958_76_795 239
441 3300046520 Ga0495637_0003727 Ga0495637_0003727_3405_4124 239
442 3300046520 Ga0495637_0008249 Ga0495637_0008249_1794_2513 239
443 3300046520 Ga0495637_0013834 Ga0495637_0013834_887_1606 239
444 3300046520 Ga0495637_0016092 Ga0495637_0016092_270_998 239
445 3300046520 Ga0495637_0022442 Ga0495637_0022442_483_1211 239
446 3300046520 Ga0495637_0026803 Ga0495637_0026803_649_1368 239
447 3300046520 Ga0495637_0046035 Ga0495637_0046035_350_1069 239
448 3300046520 Ga0495637_0069569 Ga0495637_0069569_72_791 239
449 3300046522 Ga0495643_0010882 Ga0495643_0010882_1802_2521 239
450 3300046522 Ga0495643_0031951 Ga0495643_0031951_771_1490 239
451 3300046522 Ga0495643_0046463 Ga0495643_0046463_1369_2088 239
452 3300046522 Ga0495643_0051210 Ga0495643_0051210_844_1563 239
453 3300046522 Ga0495643_0242126 Ga0495643_0242126_31_750 239
454 3300046523 Ga0495644_0020911 Ga0495644_0020911_1647_2366 239
455 3300046523 Ga0495644_0033861 Ga0495644_0033861_298_1017 239
456 3300046524 Ga0495648_0011838 Ga0495648_0011838_2515_3234 239
457 3300046524 Ga0495648_0013448 Ga0495648_0013448_2289_3008 239
458 3300046524 Ga0495648_0015180 Ga0495648_0015180_3198_3917 239
459 3300046524 Ga0495648_0034364 Ga0495648_0034364_81_809 239
460 3300046524 Ga0495648_0038088 Ga0495648_0038088_665_1384 239
461 3300046524 Ga0495648_0042292 Ga0495648_0042292_2049_2768 239
462 3300046524 Ga0495648_0076004 Ga0495648_0076004_862_1581 239
463 3300046524 Ga0495648_0088274 Ga0495648_0088274_724_1443 239
464 3300046524 Ga0495648_0236915 Ga0495648_0236915_79_798 239
465 3300046528 Ga0495642_0002385 Ga0495642_0002385_4517_5236 239
466 3300046530 Ga0495654_0003994 Ga0495654_0003994_4812_5531 239
467 3300046530 Ga0495654_0028074 Ga0495654_0028074_682_1401 239
468 3300046530 Ga0495654_0038798 Ga0495654_0038798_1218_1937 239
469 3300046530 Ga0495654_0041431 Ga0495654_0041431_516_1235 239
470 3300046530 Ga0495654_0046636 Ga0495654_0046636_668_1387 239
471 3300046530 Ga0495654_0046667 Ga0495654_0046667_1051_1770 239
472 3300046538 Ga0495609_0006113 Ga0495609_0006113_3062_3781 239
473 3300046538 Ga0495609_0008722 Ga0495609_0008722_1664_2383 239
474 3300046538 Ga0495609_0015536 Ga0495609_0015536_264_983 239
475 3300046538 Ga0495609_0118893 Ga0495609_0118893_217_936 239
476 3300046538 Ga0495609_0154730 Ga0495609_0154730_140_859 239
477 3300046542 Ga0495597_0007490 Ga0495597_0007490_3020_3739 239
478 3300046542 Ga0495597_0033654 Ga0495597_0033654_605_1324 239
479 3300046542 Ga0495597_0106683 Ga0495597_0106683_63_782 239
480 3300046557 Ga0495622_0004645 Ga0495622_0004645_3235_3954 239
481 3300046558 Ga0495633_0020542 Ga0495633_0020542_978_1697 239
482 3300046615 Ga0495656_0005554 Ga0495656_0005554_1227_1946 239
483 3300046615 Ga0495656_0169915 Ga0495656_0169915_249_968 239
484 3300046616 Ga0495668_0010212 Ga0495668_0010212_3401_4120 239
485 3300046616 Ga0495668_0278984 Ga0495668_0278984_70_789 239
486 3300046648 Ga0495611_0002592 Ga0495611_0002592_3349_4068 239
487 3300046648 Ga0495611_0009888 Ga0495611_0009888_1802_2521 239
488 3300046648 Ga0495611_0136228 Ga0495611_0136228_286_1005 239
489 3300046660 Ga0495625_0005388 Ga0495625_0005388_299_1021 239
490 3300046660 Ga0495625_0024482 Ga0495625_0024482_919_1638 239
491 3300046660 Ga0495625_0053601 Ga0495625_0053601_597_1316 239
492 3300046660 Ga0495625_0087920 Ga0495625_0087920_999_1718 239
493 3300046660 Ga0495625_0167557 Ga0495625_0167557_678_1397 239
494 3300046660 Ga0495625_0329868 Ga0495625_0329868_197_916 239
495 3300046664 Ga0495659_0065846 Ga0495659_0065846_500_1219 239
496 3300046665 Ga0495661_0000007 Ga0495661_0000007_59288_60016 239
497 3300046665 Ga0495661_0007918 Ga0495661_0007918_2223_2942 239
498 3300046665 Ga0495661_0025864 Ga0495661_0025864_1417_2136 239
499 3300046665 Ga0495661_0032941 Ga0495661_0032941_802_1521 239
500 3300046665 Ga0495661_0055669 Ga0495661_0055669_185_913 239
501 3300046665 Ga0495661_0079164 Ga0495661_0079164_585_1304 239
502 3300046665 Ga0495661_0238437 Ga0495661_0238437_60_779 239
503 3300046684 Ga0495669_0000839 Ga0495669_0000839_1539_2258 239
504 3300046691 Ga0495670_0006885 Ga0495670_0006885_1807_2526 239
505 3300046691 Ga0495670_0007924 Ga0495670_0007924_4330_5049 239
506 3300046691 Ga0495670_0029087 Ga0495670_0029087_534_1253 239
507 3300046691 Ga0495670_0034791 Ga0495670_0034791_1675_2394 239
508 3300046691 Ga0495670_0051596 Ga0495670_0051596_460_1188 239
509 3300046692 Ga0495671_0004249 Ga0495671_0004249_5645_6364 239
510 3300046692 Ga0495671_0029200 Ga0495671_0029200_941_1660 239
511 3300046692 Ga0495671_0043788 Ga0495671_0043788_568_1287 239
512 3300046692 Ga0495671_0050013 Ga0495671_0050013_958_1677 239
513 3300046692 Ga0495671_0094744 Ga0495671_0094744_393_1112 239
514 3300046692 Ga0495671_0099842 Ga0495671_0099842_167_886 239
515 3300046692 Ga0495671_0107753 Ga0495671_0107753_154_873 239
516 3300046694 Ga0495649_0006668 Ga0495649_0006668_6358_7086 239
517 3300046694 Ga0495649_0009526 Ga0495649_0009526_2853_3572 239
518 3300046694 Ga0495649_0012630 Ga0495649_0012630_3224_3943 239
519 3300046694 Ga0495649_0020952 Ga0495649_0020952_2619_3338 239
520 3300046694 Ga0495649_0033526 Ga0495649_0033526_1607_2326 239
521 3300046694 Ga0495649_0071077 Ga0495649_0071077_881_1600 239
522 3300046694 Ga0495649_0124239 Ga0495649_0124239_521_1240 239
523 3300046794 Ga0495589_0005644 Ga0495589_0005644_3127_3846 239
524 3300046794 Ga0495589_0017022 Ga0495589_0017022_2425_3144 239
525 3300046794 Ga0495589_0022591 Ga0495589_0022591_57_776 239
526 3300046794 Ga0495589_0129314 Ga0495589_0129314_76_795 239
527 3300046794 Ga0495589_0140343 Ga0495589_0140343_86_805 239
528 3300046810 Ga0495660_0011766 Ga0495660_0011766_1747_2475 239
529 3300046810 Ga0495660_0025501 Ga0495660_0025501_1986_2705 239
530 3300046810 Ga0495660_0038498 Ga0495660_0038498_102_821 239
531 3300046810 Ga0495660_0038782 Ga0495660_0038782_1827_2546 239
532 3300046810 Ga0495660_0043148 Ga0495660_0043148_1347_2066 239
533 3300046810 Ga0495660_0107879 Ga0495660_0107879_593_1312 239
534 3300046810 Ga0495660_0110453 Ga0495660_0110453_25_744 239
535 3300046810 Ga0495660_0230782 Ga0495660_0230782_35_754 239
536 3300047318 Ga0495636_0129286 Ga0495636_0129286_159_878 239
537 3300047320 Ga0495672_0031792 Ga0495672_0031792_398_1117 239
538 3300047320 Ga0495672_0031933 Ga0495672_0031933_1076_1795 239
539 3300047320 Ga0495672_0033751 Ga0495672_0033751_437_1156 239
540 3300047320 Ga0495672_0059096 Ga0495672_0059096_1210_1938 239
541 3300047321 Ga0495676_0016572 Ga0495676_0016572_2474_3193 239
542 3300047322 Ga0495680_0053382 Ga0495680_0053382_662_1381 239
543 3300047323 Ga0495683_0000006 Ga0495683_0000006_112197_112925 239
544 3300047323 Ga0495683_0010975 Ga0495683_0010975_627_1346 239
545 3300047323 Ga0495683_0019600 Ga0495683_0019600_1057_1776 239
546 3300047323 Ga0495683_0023801 Ga0495683_0023801_2416_3135 239
547 3300047323 Ga0495683_0100606 Ga0495683_0100606_363_1082 239
548 3300047323 Ga0495683_0114147 Ga0495683_0114147_508_1227 239
549 3300047323 Ga0495683_0161103 Ga0495683_0161103_77_796 239
550 3300047445 Ga0495677_0006568 Ga0495677_0006568_1248_1967 239
551 3300047446 Ga0495679_009017 Ga0495679_009017_771_1490 239
552 3300047446 Ga0495679_011497 Ga0495679_011497_91_810 239
553 3300047446 Ga0495679_020356 Ga0495679_020356_832_1551 239
554 3300047446 Ga0495679_036462 Ga0495679_036462_79_798 239
555 3300047446 Ga0495679_043488 Ga0495679_043488_165_884 239
556 3300047446 Ga0495679_071841 Ga0495679_071841_214_933 239
557 3300047469 Ga0495673_0006524 Ga0495673_0006524_3240_3959 239
558 3300047469 Ga0495673_0009193 Ga0495673_0009193_1704_2423 239
559 3300047469 Ga0495673_0021559 Ga0495673_0021559_829_1548 239
560 3300047469 Ga0495673_0022410 Ga0495673_0022410_700_1428 239
561 3300047469 Ga0495673_0036516 Ga0495673_0036516_1232_1951 239
562 3300047470 Ga0495681_0008666 Ga0495681_0008666_2374_3093 239
563 3300047470 Ga0495681_0019411 Ga0495681_0019411_184_903 239
564 3300047470 Ga0495681_0042555 Ga0495681_0042555_559_1278 239
565 3300047470 Ga0495681_0056471 Ga0495681_0056471_556_1275 239
566 3300047470 Ga0495681_0069826 Ga0495681_0069826_839_1558 239
567 3300047472 Ga0495686_0007810 Ga0495686_0007810_4124_4843 239
568 3300047472 Ga0495686_0019747 Ga0495686_0019747_526_1245 239
569 3300047472 Ga0495686_0052034 Ga0495686_0052034_200_919 239
570 3300047472 Ga0495686_0111209 Ga0495686_0111209_770_1489 239
571 3300048091 Ga0495626_0005132 Ga0495626_0005132_4598_5317 239
572 3300048091 Ga0495626_0006480 Ga0495626_0006480_3378_4097 239
573 3300048091 Ga0495626_0010352 Ga0495626_0010352_1316_2035 239
574 3300048091 Ga0495626_0015898 Ga0495626_0015898_2230_2949 239
575 3300048091 Ga0495626_0059546 Ga0495626_0059546_26_745 239
576 3300048919 Ga0496116_0013366 Ga0496116_0013366_3344_4063 239
577 3300048919 Ga0496116_0018246 Ga0496116_0018246_2876_3595 239
578 3300048919 Ga0496116_0020950 Ga0496116_0020950_2136_2855 239
579 3300048920 Ga0496117_0015839 Ga0496117_0015839_2779_3498 239
580 3300048920 Ga0496117_0020601 Ga0496117_0020601_4541_5260 239
581 3300048920 Ga0496117_0025888 Ga0496117_0025888_788_1507 239
582 3300048920 Ga0496117_0038938 Ga0496117_0038938_2492_3211 239
583 3300048921 Ga0496118_0014619 Ga0496118_0014619_2288_3007 239
584 3300048921 Ga0496118_0018544 Ga0496118_0018544_2295_3014 239
585 3300048921 Ga0496118_0250630 Ga0496118_0250630_245_964 239
586 3300048922 Ga0496119_0032994 Ga0496119_0032994_2636_3355 239
587 3300048923 Ga0496120_0012754 Ga0496120_0012754_2277_2996 239
588 3300048924 Ga0496121_0034600 Ga0496121_0034600_2860_3579 239
589 3300048924 Ga0496121_0056483 Ga0496121_0056483_1188_1907 239
590 3300048925 Ga0496122_0056891 Ga0496122_0056891_2101_2820 239
591 3300048925 Ga0496122_0219751 Ga0496122_0219751_259_978 239
592 3300048926 Ga0496123_0016755 Ga0496123_0016755_3026_3745 239
593 3300048926 Ga0496123_0031854 Ga0496123_0031854_352_1071 239
594 3300048926 Ga0496123_0172637 Ga0496123_0172637_129_848 239
595 3300048927 Ga0496124_0002584 Ga0496124_0002584_18368_19087 239
596 3300048928 Ga0496125_0002457 Ga0496125_0002457_18321_19040 239
597 3300048928 Ga0496125_0043431 Ga0496125_0043431_2353_3072 239
598 3300048929 Ga0496126_0367678 Ga0496126_0367678_289_1008 239
599 3300049459 Ga0495678_007019 Ga0495678_007019_1935_2654 239
600 3300049459 Ga0495678_007071 Ga0495678_007071_2520_3239 239
601 3300049459 Ga0495678_007414 Ga0495678_007414_3134_3853 239
602 3300049459 Ga0495678_008780 Ga0495678_008780_85_813 239
603 3300049459 Ga0495678_036822 Ga0495678_036822_844_1563 239
604 3300049459 Ga0495678_041294 Ga0495678_041294_393_1112 239
605 3300049459 Ga0495678_097077 Ga0495678_097077_77_805 239
606 3300049460 Ga0495682_0006524 Ga0495682_0006524_2492_3211 239
607 3300049460 Ga0495682_0022762 Ga0495682_0022762_1157_1885 239
608 3300049460 Ga0495682_0050870 Ga0495682_0050870_763_1482 239
609 3300049571 Ga0501034_0000055 Ga0501034_0000055_46219_46941 239
610 3300049758 Ga0501241_000825 Ga0501241_000825_3035_3754 239
611 3300049853 Ga0501226_000032 Ga0501226_000032_31222_31941 239
612 3300053111 Ga0500572_004620 Ga0500572_004620_572_1291 239
613 3300053125 Ga0500618_005167 Ga0500618_005167_3234_3962 239
614 3300053135 Ga0500659_0024100 Ga0500659_0024100_499_1221 239
615 3300046557 Ga0495622_0115394 Ga0495622_0115394_66_803 240
616 3300046810 Ga0495660_0000333 Ga0495660_0000333_22455_23177 240
617 3300002737 JGI25162J39368_1002085 JGI25162J39368_10020854 241
618 3300002771 JGI25163J39215_1001519 JGI25163J39215_10015191 241
619 3300002772 JGI25164J39214_1001023 JGI25164J39214_10010234 241
620 3300003214 JGI25165J46597_1001881 JGI25165J46597_10018816 241
621 3300009011 Ga0105251_10022468 Ga0105251_100224683 241
622 3300025207 Ga0209760_100133 Ga0209760_10013334 241
623 3300025231 Ga0207427_100004 Ga0207427_100004503 241
624 3300025233 Ga0209437_100028 Ga0209437_100028339 241
625 3300025261 Ga0209233_1000008 Ga0209233_10000081050 241
626 3300041411 Ga0439466_0091768 Ga0439466_0091768_75_803 241
627 3300042009 Ga0439451_003240 Ga0439451_003240_1416_2144 241
628 3300042016 Ga0439463_012183 Ga0439463_012183_1144_1872 241
629 3300042142 Ga0450905_007538 Ga0450905_007538_670_1398 241
630 3300046453 Ga0495627_002049 Ga0495627_002049_1801_2529 241
631 3300046458 Ga0495591_004779 Ga0495591_004779_5736_6464 241
632 3300046471 Ga0495650_0002071 Ga0495650_0002071_7807_8535 241
633 3300046474 Ga0495605_0000032 Ga0495605_0000032_23791_24519 241
634 3300046499 Ga0495594_0001546 Ga0495594_0001546_303_1031 241
635 3300046506 Ga0495583_0000052 Ga0495583_0000052_24519_25247 241
636 3300046512 Ga0495610_0007817 Ga0495610_0007817_778_1506 241
637 3300046513 Ga0495616_0041270 Ga0495616_0041270_1462_2190 241
638 3300046515 Ga0495620_0000019 Ga0495620_0000019_23841_24569 241
639 3300046518 Ga0495631_0001876 Ga0495631_0001876_11574_12302 241
640 3300046520 Ga0495637_0026832 Ga0495637_0026832_1730_2458 241
641 3300046524 Ga0495648_0000438 Ga0495648_0000438_34095_34823 241
642 3300046530 Ga0495654_0003101 Ga0495654_0003101_4638_5366 241
643 3300046538 Ga0495609_0000032 Ga0495609_0000032_186506_187234 241
644 3300046542 Ga0495597_0022290 Ga0495597_0022290_1628_2356 241
645 3300046558 Ga0495633_0000040 Ga0495633_0000040_152528_153256 241
646 3300046648 Ga0495611_0000703 Ga0495611_0000703_10244_10972 241
647 3300046665 Ga0495661_0000037 Ga0495661_0000037_22561_23289 241
648 3300046691 Ga0495670_0003137 Ga0495670_0003137_4915_5643 241
649 3300046692 Ga0495671_0014649 Ga0495671_0014649_2308_3036 241
650 3300046794 Ga0495589_0000394 Ga0495589_0000394_4851_5579 241
651 3300046810 Ga0495660_0002226 Ga0495660_0002226_7479_8207 241
652 3300047323 Ga0495683_0000011 Ga0495683_0000011_24643_25371 241
653 3300047446 Ga0495679_000192 Ga0495679_000192_19277_20005 241
654 3300047469 Ga0495673_0014480 Ga0495673_0014480_2272_3000 241
655 3300047470 Ga0495681_0002128 Ga0495681_0002128_1898_2626 241
656 3300048915 Ga0496112_0197990 Ga0496112_0197990_879_1607 241
657 3300048925 Ga0496122_0016760 Ga0496122_0016760_5411_6139 241
658 3300048926 Ga0496123_0006688 Ga0496123_0006688_6819_7547 241
659 3300049459 Ga0495678_000033 Ga0495678_000033_187236_187964 241
660 3300002737 JGI25162J39368_1001787 JGI25162J39368_10017876 242
661 3300002771 JGI25163J39215_1000708 JGI25163J39215_10007085 242
662 3300002772 JGI25164J39214_1000879 JGI25164J39214_10008796 242
663 3300003214 JGI25165J46597_1001661 JGI25165J46597_10016616 242
664 3300005288 Ga0065714_10072086 Ga0065714_100720862 242
665 3300005290 Ga0065712_10068510 Ga0065712_100685101 242
666 3300009011 Ga0105251_10000060 Ga0105251_1000006097 242
667 3300009036 Ga0105244_10000737 Ga0105244_100007377 242
668 3300009148 Ga0105243_10009919 Ga0105243_100099194 242
669 3300009148 Ga0105243_10010698 Ga0105243_100106983 242
670 3300009553 Ga0105249_10015623 Ga0105249_100156234 242
671 3300013102 Ga0157371_10002584 Ga0157371_100025845 242
672 3300014497 Ga0182008_10002235 Ga0182008_1000223510 242
673 3300014497 Ga0182008_10029811 Ga0182008_100298112 242
674 3300025207 Ga0209760_100170 Ga0209760_1001705 242
675 3300025231 Ga0207427_100001 Ga0207427_10000192 242
676 3300025233 Ga0209437_100003 Ga0209437_1000031280 242
677 3300025261 Ga0209233_1000007 Ga0209233_100000792 242
678 3300025728 Ga0207655_1004283 Ga0207655_10042833 242
679 3300025735 Ga0207713_1000150 Ga0207713_10001503 242
680 3300025935 Ga0207709_10005850 Ga0207709_100058505 242
681 3300025961 Ga0207712_10008162 Ga0207712_100081623 242
682 3300032002 Ga0307416_100252610 Ga0307416_1002526102 242
683 3300041404 Ga0439436_0000436 Ga0439436_0000436_3922_4650 242
684 3300041405 Ga0439438_002663 Ga0439438_002663_4158_4886 242
685 3300041405 Ga0439438_003373 Ga0439438_003373_3303_4031 242
686 3300041407 Ga0439447_001626 Ga0439447_001626_5069_5797 242
687 3300041407 Ga0439447_007036 Ga0439447_007036_2432_3160 242
688 3300041411 Ga0439466_0003558 Ga0439466_0003558_2963_3691 242
689 3300041411 Ga0439466_0006567 Ga0439466_0006567_879_1607 242
690 3300041411 Ga0439466_0011556 Ga0439466_0011556_1664_2395 242
691 3300041411 Ga0439466_0020995 Ga0439466_0020995_1455_2183 242
692 3300041413 Ga0439465_0012542 Ga0439465_0012542_1228_1956 242
693 3300042006 Ga0439432_000460 Ga0439432_000460_11702_12430 242
694 3300042006 Ga0439432_001259 Ga0439432_001259_4056_4784 242
695 3300042009 Ga0439451_001025 Ga0439451_001025_1397_2125 242
696 3300042009 Ga0439451_001338 Ga0439451_001338_1355_2086 242
697 3300042010 Ga0439452_003342 Ga0439452_003342_673_1401 242
698 3300042010 Ga0439452_007159 Ga0439452_007159_1419_2150 242
699 3300042013 Ga0439456_002492 Ga0439456_002492_2955_3683 242
700 3300042115 Ga0450911_002031 Ga0450911_002031_2376_3104 242
701 3300042121 Ga0450919_000651 Ga0450919_000651_804_1532 242
702 3300042121 Ga0450919_007847 Ga0450919_007847_26_754 242
703 3300042124 Ga0450922_004723 Ga0450922_004723_417_1145 242
704 3300042125 Ga0450923_003448 Ga0450923_003448_1163_1891 242
705 3300042138 Ga0450903_003992 Ga0450903_003992_1031_1759 242
706 3300042142 Ga0450905_013089 Ga0450905_013089_410_1138 242
707 3300042146 Ga0450907_001799 Ga0450907_001799_2269_2997 242
708 3300042147 Ga0450910_030529 Ga0450910_030529_83_811 242
709 3300042156 Ga0439446_0005245 Ga0439446_0005245_754_1482 242
710 3300042184 Ga0450908_004617 Ga0450908_004617_1630_2358 242
711 3300042185 Ga0450909_012163 Ga0450909_012163_91_819 242
712 3300042435 Ga0439434_0012889 Ga0439434_0012889_592_1320 242
713 3300042439 Ga0439464_0012800 Ga0439464_0012800_388_1116 242
714 3300042461 Ga0439460_0009408 Ga0439460_0009408_32_760 242
715 3300042531 Ga0450918_002190 Ga0450918_002190_2907_3635 242
716 3300042532 Ga0450893_0004524 Ga0450893_0004524_749_1477 242
717 3300042993 Ga0439440_0070175 Ga0439440_0070175_92_820 242
718 3300046474 Ga0495605_0000220 Ga0495605_0000220_44050_44778 242
719 3300046474 Ga0495605_0011164 Ga0495605_0011164_1623_2351 242
720 3300046520 Ga0495637_0008047 Ga0495637_0008047_3243_3974 242
721 3300046530 Ga0495654_0031674 Ga0495654_0031674_25_753 242
722 3300047320 Ga0495672_0026318 Ga0495672_0026318_2641_3369 242
723 3300048091 Ga0495626_0028345 Ga0495626_0028345_1885_2616 242
724 3300048919 Ga0496116_0002889 Ga0496116_0002889_11842_12570 242
725 3300048921 Ga0496118_0063638 Ga0496118_0063638_690_1418 242
726 3300048924 Ga0496121_0005129 Ga0496121_0005129_4490_5218 242
727 3300048925 Ga0496122_0019635 Ga0496122_0019635_1951_2679 242
728 3300048926 Ga0496123_0004084 Ga0496123_0004084_3885_4613 242
729 3300048929 Ga0496126_0249771 Ga0496126_0249771_462_1190 242
730 3300049459 Ga0495678_010166 Ga0495678_010166_3351_4082 242

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10670

DUF4198

Domain of unknown function (DUF4198)

21

216

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wgo-assembly1.cif.gz_A solution structure of the pkd domain from human vps10 domain-containing receptor sorcs2 0.6266 142 242
3pe9-assembly2.cif.gz_B structures of clostridium thermocellum cbha fibronectin(iii)-like modules 0.6034 144 238
3pe9-assembly4.cif.gz_D structures of clostridium thermocellum cbha fibronectin(iii)-like modules 0.5976 154 238
1b4r-assembly1.cif.gz_A pkd domain 1 from human polycystein-1 0.5945 142 236
3pe9-assembly2.cif.gz_B structures of clostridium thermocellum cbha fibronectin(iii)-like modules 0.5869 144 238
ID Description Score Start End Superfamily
af_A0A2R8RJ61_146_457_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6906 144 240 2.60.40.10
af_A0A140LGT8_462_545_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6869 144 238 2.60.40.10
af_Q4CXX5_327_625_3.40.850.10 Alpha Beta;3-Layer(aba) Sandwich;Kinesin;Kinesin motor domain 0.6659 207 238 3.40.850.10
3jquB00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6572 146 240 2.60.40.10
af_A0A140LGT8_462_545_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.654 144 238 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A2W5UZW9-F1-model_v4 deleted 0.987 45 242
AF-A0A3L8CN06-F1-model_v4 Nickel ABC transporter substrate-binding protein 0.9831 83 242
AF-A0A2W5UZW9-F1-model_v4 deleted 0.9821 45 242
AF-A0A3L8CN06-F1-model_v4 Nickel ABC transporter substrate-binding protein 0.9771 83 242
AF-A0A3L8CE14-F1-model_v4 Nickel ABC transporter substrate-binding protein 0.9652 113 242

Feature Viewer

pLDDT pTM Quality
89.59 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map