F477902
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 730 | 295 | 730 | 197 |
Family's Representative Sequence
| Representative Sequence | 3300001978|JGI24747J21853_1000701|JGI24747J21853_10007012 |
| Length | 227 |
| Sequence | MRLTEVRIAGFGGQGVILSAIVIGKAASIYQSAFATMTQNFGPEARGGACSAQLXLSXAPILYPYVTQPDIMIAMSQEAYGKFIHELKDGGVLIVEQDLVRVTDVPHEIRVYSVPATRLAEQLGKRMVLNIVMVGFFTAVTKLLDPDAMRNAVAESVPAHFRELNVKAFDVGYEYGLAAKPVASQNSEIEQEQVLYSQGVVRAIALQQAHSHSMFLLTVPLPPPTGQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 99 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 103 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 104 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 171 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 173 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 174 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 176 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 177 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 178 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 179 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 180 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 181 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 182 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 183 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 184 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 185 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 186 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 187 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 188 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 190 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 191 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 192 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 193 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 195 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 196 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 197 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 198 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 199 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 200 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 203 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 206 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 207 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 210 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 212 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 213 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 214 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 217 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 218 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 219 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 220 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 221 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 222 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 223 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 224 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 225 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 264 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 265 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 266 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 267 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 268 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 271 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 272 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 273 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 274 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 275 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 276 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 285 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.04 |
| Metatranscriptomes | 0.96 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.38 |
| Rhizosphere | 95.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_1198449 | 2162886012 | Bacteria | 1256 |
| 2 | MBSR1b_contig_8674379 | 2162886012 | Bacteria | 3447 |
| 3 | MBSR1b_contig_9766659 | 2162886012 | Bacteria | 1254 |
| 4 | JGI24752J21851_1006675 | 3300001976 | Unclassified | 1509 |
| 5 | JGI24747J21853_1000701 | 3300001978 | Bacteria | 2226 |
| 6 | JGI24743J22301_10005717 | 3300001991 | Bacteria | 2087 |
| 7 | JGI24749J21850_1007403 | 3300002076 | Bacteria | 1528 |
| 8 | JGI24034J26672_10001382 | 3300002239 | Bacteria | 3213 |
| 9 | JGI24034J26672_10001383 | 3300002239 | Bacteria | 3211 |
| 10 | JGI24751J29686_10000869 | 3300002459 | Bacteria | 6909 |
| 11 | Ga0065712_10075947 | 3300005290 | Bacteria | 3759 |
| 12 | Ga0065715_10003405 | 3300005293 | Bacteria | 5479 |
| 13 | Ga0070658_10061915 | 3300005327 | Bacteria | 3049 |
| 14 | Ga0070676_10004067 | 3300005328 | Bacteria | 7686 |
| 15 | Ga0070676_10064385 | 3300005328 | Archaea | 2186 |
| 16 | Ga0070683_100000026 | 3300005329 | Bacteria | 172308 |
| 17 | Ga0070683_100000533 | 3300005329 | Bacteria | 26823 |
| 18 | Ga0070683_100172155 | 3300005329 | Bacteria | 2055 |
| 19 | Ga0070683_100172502 | 3300005329 | Bacteria | 2053 |
| 20 | Ga0070670_100033379 | 3300005331 | Bacteria | 4432 |
| 21 | Ga0070670_100197815 | 3300005331 | Unclassified | 1746 |
| 22 | Ga0070677_10057274 | 3300005333 | Bacteria | 1596 |
| 23 | Ga0068869_100153510 | 3300005334 | Bacteria | 1787 |
| 24 | Ga0068869_100663966 | 3300005334 | Bacteria | 886 |
| 25 | Ga0070666_10043322 | 3300005335 | Bacteria | 3013 |
| 26 | Ga0070666_10187314 | 3300005335 | Unclassified | 1453 |
| 27 | Ga0070680_100044909 | 3300005336 | Bacteria | 3591 |
| 28 | Ga0070680_100279279 | 3300005336 | Unclassified | 1415 |
| 29 | Ga0070682_100021004 | 3300005337 | Bacteria | 3848 |
| 30 | Ga0070682_100393570 | 3300005337 | Unclassified | 1046 |
| 31 | Ga0068868_100006775 | 3300005338 | Bacteria | 8139 |
| 32 | Ga0068868_100066103 | 3300005338 | Unclassified | 2874 |
| 33 | Ga0068868_100524125 | 3300005338 | Bacteria | 1041 |
| 34 | Ga0070660_100001060 | 3300005339 | Bacteria | 18497 |
| 35 | Ga0070660_100039364 | 3300005339 | Bacteria | 3593 |
| 36 | Ga0070689_100012831 | 3300005340 | Bacteria | 6049 |
| 37 | Ga0070689_100273318 | 3300005340 | Bacteria | 1400 |
| 38 | Ga0070689_100706555 | 3300005340 | Bacteria | 881 |
| 39 | Ga0070687_100007584 | 3300005343 | Unclassified | 4535 |
| 40 | Ga0070661_100029564 | 3300005344 | Bacteria | 3956 |
| 41 | Ga0070661_100157898 | 3300005344 | Bacteria | 1716 |
| 42 | Ga0070661_100300620 | 3300005344 | Unclassified | 1249 |
| 43 | Ga0070668_100004691 | 3300005347 | Bacteria | 10129 |
| 44 | Ga0070669_100004930 | 3300005353 | Bacteria | 9641 |
| 45 | Ga0070675_100305514 | 3300005354 | Bacteria | 1402 |
| 46 | Ga0070671_100198234 | 3300005355 | Bacteria | 1702 |
| 47 | Ga0070671_100267480 | 3300005355 | Bacteria | 1453 |
| 48 | Ga0070671_100353968 | 3300005355 | Unclassified | 1253 |
| 49 | Ga0070671_100387295 | 3300005355 | Bacteria | 1195 |
| 50 | Ga0070674_100003936 | 3300005356 | Bacteria | 8415 |
| 51 | Ga0070673_100031611 | 3300005364 | Bacteria | 3975 |
| 52 | Ga0070688_100000378 | 3300005365 | Bacteria | 22545 |
| 53 | Ga0070688_100572401 | 3300005365 | Bacteria | 861 |
| 54 | Ga0070659_100004918 | 3300005366 | Bacteria | 9556 |
| 55 | Ga0070659_100359833 | 3300005366 | Unclassified | 1222 |
| 56 | Ga0070709_10002941 | 3300005434 | Bacteria | 9173 |
| 57 | Ga0070709_10029013 | 3300005434 | Bacteria | 3305 |
| 58 | Ga0070709_10417986 | 3300005434 | Bacteria | 1004 |
| 59 | Ga0070714_100015780 | 3300005435 | Bacteria | 6086 |
| 60 | Ga0070714_100031659 | 3300005435 | Bacteria | 4415 |
| 61 | Ga0070714_100133767 | 3300005435 | Bacteria | 2218 |
| 62 | Ga0070714_100153943 | 3300005435 | Bacteria | 2074 |
| 63 | Ga0070714_100446168 | 3300005435 | Bacteria | 1228 |
| 64 | Ga0070714_100752081 | 3300005435 | Unclassified | 942 |
| 65 | Ga0070713_100000134 | 3300005436 | Bacteria | 48639 |
| 66 | Ga0070713_100000441 | 3300005436 | Bacteria | 26508 |
| 67 | Ga0070713_100007620 | 3300005436 | Bacteria | 7618 |
| 68 | Ga0070713_100013545 | 3300005436 | Bacteria | 6027 |
| 69 | Ga0070713_100134367 | 3300005436 | Bacteria | 2184 |
| 70 | Ga0070713_100160653 | 3300005436 | Bacteria | 2005 |
| 71 | Ga0070713_100188999 | 3300005436 | Unclassified | 1855 |
| 72 | Ga0070713_100221470 | 3300005436 | Bacteria | 1717 |
| 73 | Ga0070713_100251471 | 3300005436 | Bacteria | 1612 |
| 74 | Ga0070713_100489836 | 3300005436 | Unclassified | 1159 |
| 75 | Ga0070713_100989354 | 3300005436 | Unclassified | 811 |
| 76 | Ga0070713_101342043 | 3300005436 | Unclassified | 693 |
| 77 | Ga0070710_10002183 | 3300005437 | Bacteria | 9242 |
| 78 | Ga0070710_10008950 | 3300005437 | Bacteria | 4891 |
| 79 | Ga0070710_10049876 | 3300005437 | Bacteria | 2343 |
| 80 | Ga0070710_10300764 | 3300005437 | Bacteria | 1047 |
| 81 | Ga0070710_10308230 | 3300005437 | Bacteria | 1035 |
| 82 | Ga0070701_10037568 | 3300005438 | Bacteria | 2446 |
| 83 | Ga0070711_100000271 | 3300005439 | Bacteria | 26787 |
| 84 | Ga0070711_100005922 | 3300005439 | Bacteria | 7340 |
| 85 | Ga0070711_100045473 | 3300005439 | Bacteria | 2987 |
| 86 | Ga0070711_100056293 | 3300005439 | Bacteria | 2719 |
| 87 | Ga0070711_100073773 | 3300005439 | Bacteria | 2412 |
| 88 | Ga0070711_100101616 | 3300005439 | Bacteria | 2093 |
| 89 | Ga0070711_100137176 | 3300005439 | Bacteria | 1830 |
| 90 | Ga0070700_100187937 | 3300005441 | Bacteria | 1442 |
| 91 | Ga0070663_100005199 | 3300005455 | Bacteria | 7706 |
| 92 | Ga0070663_100648986 | 3300005455 | Bacteria | 892 |
| 93 | Ga0070662_100265422 | 3300005457 | Bacteria | 1384 |
| 94 | Ga0070662_100282563 | 3300005457 | Bacteria | 1344 |
| 95 | Ga0070681_10003858 | 3300005458 | Bacteria | 14107 |
| 96 | Ga0070681_10018999 | 3300005458 | Bacteria | 6878 |
| 97 | Ga0070681_10120493 | 3300005458 | Bacteria | 2559 |
| 98 | Ga0070681_10191500 | 3300005458 | Bacteria | 1965 |
| 99 | Ga0070681_10831091 | 3300005458 | Bacteria | 841 |
| 100 | Ga0070707_100098525 | 3300005468 | Bacteria | 2832 |
| 101 | Ga0070698_101075734 | 3300005471 | Unclassified | 752 |
| 102 | Ga0070679_100006572 | 3300005530 | Bacteria | 10831 |
| 103 | Ga0070679_100250148 | 3300005530 | Unclassified | 1729 |
| 104 | Ga0070679_100865629 | 3300005530 | Unclassified | 847 |
| 105 | Ga0070684_100000012 | 3300005535 | Bacteria | 167850 |
| 106 | Ga0070684_100005118 | 3300005535 | Bacteria | 10018 |
| 107 | Ga0070684_100006986 | 3300005535 | Bacteria | 8769 |
| 108 | Ga0070684_100090646 | 3300005535 | Bacteria | 2719 |
| 109 | Ga0070684_100820268 | 3300005535 | Bacteria | 870 |
| 110 | Ga0068853_100062588 | 3300005539 | Bacteria | 3220 |
| 111 | Ga0070672_100003124 | 3300005543 | Bacteria | 10693 |
| 112 | Ga0070686_100350177 | 3300005544 | Unclassified | 1109 |
| 113 | Ga0070695_100150418 | 3300005545 | Archaea | 1624 |
| 114 | Ga0070696_100883854 | 3300005546 | Unclassified | 740 |
| 115 | Ga0070665_100515810 | 3300005548 | Bacteria | 1207 |
| 116 | Ga0070665_100889235 | 3300005548 | Unclassified | 903 |
| 117 | Ga0068855_100039804 | 3300005563 | Bacteria | 5579 |
| 118 | Ga0068855_100195131 | 3300005563 | Bacteria | 2281 |
| 119 | Ga0068855_100263335 | 3300005563 | Bacteria | 1920 |
| 120 | Ga0068855_100833125 | 3300005563 | Bacteria | 978 |
| 121 | Ga0070664_100043507 | 3300005564 | Bacteria | 3789 |
| 122 | Ga0070664_100104340 | 3300005564 | Bacteria | 2468 |
| 123 | Ga0068857_100002432 | 3300005577 | Bacteria | 15193 |
| 124 | Ga0068857_100008251 | 3300005577 | Bacteria | 8999 |
| 125 | Ga0068857_100091368 | 3300005577 | Unclassified | 2725 |
| 126 | Ga0068854_100022813 | 3300005578 | Bacteria | 4269 |
| 127 | Ga0068856_100010274 | 3300005614 | Bacteria | 9098 |
| 128 | Ga0068856_100097796 | 3300005614 | Bacteria | 2925 |
| 129 | Ga0068856_100120944 | 3300005614 | Bacteria | 2620 |
| 130 | Ga0068856_100134259 | 3300005614 | Bacteria | 2480 |
| 131 | Ga0068856_100278065 | 3300005614 | Bacteria | 1691 |
| 132 | Ga0068856_100469825 | 3300005614 | Bacteria | 1278 |
| 133 | Ga0068852_100118155 | 3300005616 | Bacteria | 2422 |
| 134 | Ga0068852_100176071 | 3300005616 | Unclassified | 2009 |
| 135 | Ga0068859_100011366 | 3300005617 | Bacteria | 8955 |
| 136 | Ga0068864_100002059 | 3300005618 | Bacteria | 16609 |
| 137 | Ga0068864_100061650 | 3300005618 | Bacteria | 3248 |
| 138 | Ga0068864_100417490 | 3300005618 | Unclassified | 1278 |
| 139 | Ga0068864_100775414 | 3300005618 | Bacteria | 941 |
| 140 | Ga0068866_10007446 | 3300005718 | Bacteria | 4583 |
| 141 | Ga0068861_100155144 | 3300005719 | Bacteria | 1882 |
| 142 | Ga0068851_10004133 | 3300005834 | Bacteria | 6532 |
| 143 | Ga0068851_10008504 | 3300005834 | Bacteria | 4747 |
| 144 | Ga0068863_100018704 | 3300005841 | Bacteria | 6630 |
| 145 | Ga0068863_100030784 | 3300005841 | Bacteria | 5125 |
| 146 | Ga0068863_100058413 | 3300005841 | Unclassified | 3650 |
| 147 | Ga0068863_100085129 | 3300005841 | Unclassified | 2996 |
| 148 | Ga0068863_100100958 | 3300005841 | Bacteria | 2742 |
| 149 | Ga0068863_100344085 | 3300005841 | Bacteria | 1451 |
| 150 | Ga0068858_100016136 | 3300005842 | Bacteria | 7017 |
| 151 | Ga0068858_101187163 | 3300005842 | Bacteria | 750 |
| 152 | Ga0068860_100293184 | 3300005843 | Bacteria | 1592 |
| 153 | Ga0068862_100084677 | 3300005844 | Unclassified | 2755 |
| 154 | Ga0068862_100123710 | 3300005844 | Bacteria | 2282 |
| 155 | Ga0070717_10001624 | 3300006028 | Bacteria | 15590 |
| 156 | Ga0070717_10015703 | 3300006028 | Bacteria | 5853 |
| 157 | Ga0070717_10120618 | 3300006028 | Bacteria | 2246 |
| 158 | Ga0070717_10187222 | 3300006028 | Unclassified | 1807 |
| 159 | Ga0070717_11346560 | 3300006028 | Bacteria | 649 |
| 160 | Ga0070715_10001203 | 3300006163 | Bacteria | 7448 |
| 161 | Ga0070715_10032767 | 3300006163 | Bacteria | 2119 |
| 162 | Ga0070716_100000113 | 3300006173 | Bacteria | 31778 |
| 163 | Ga0070716_100006183 | 3300006173 | Bacteria | 5846 |
| 164 | Ga0070716_100035194 | 3300006173 | Bacteria | 2752 |
| 165 | Ga0070716_100095885 | 3300006173 | Bacteria | 1807 |
| 166 | Ga0070716_100222453 | 3300006173 | Bacteria | 1269 |
| 167 | Ga0070712_100000262 | 3300006175 | Bacteria | 29465 |
| 168 | Ga0070712_100000618 | 3300006175 | Bacteria | 20900 |
| 169 | Ga0070712_100004634 | 3300006175 | Bacteria | 8499 |
| 170 | Ga0070712_100037406 | 3300006175 | Bacteria | 3308 |
| 171 | Ga0070712_100072370 | 3300006175 | Unclassified | 2469 |
| 172 | Ga0070712_100081286 | 3300006175 | Bacteria | 2347 |
| 173 | Ga0070712_100105021 | 3300006175 | Bacteria | 2097 |
| 174 | Ga0070712_100546753 | 3300006175 | Unclassified | 975 |
| 175 | Ga0070712_100578286 | 3300006175 | Bacteria | 949 |
| 176 | Ga0070712_100585364 | 3300006175 | Bacteria | 943 |
| 177 | Ga0097621_100100757 | 3300006237 | Bacteria | 2430 |
| 178 | Ga0097621_100554534 | 3300006237 | Unclassified | 1046 |
| 179 | Ga0068871_100027596 | 3300006358 | Bacteria | 4442 |
| 180 | Ga0068871_100242391 | 3300006358 | Bacteria | 1568 |
| 181 | Ga0075433_10110820 | 3300006852 | Bacteria | 2435 |
| 182 | Ga0075434_100004984 | 3300006871 | Bacteria | 12046 |
| 183 | Ga0068865_100036139 | 3300006881 | Unclassified | 3328 |
| 184 | Ga0097620_100011366 | 3300006931 | Bacteria | 8955 |
| 185 | Ga0075435_100187808 | 3300007076 | Bacteria | 1748 |
| 186 | Ga0075435_100191727 | 3300007076 | Bacteria | 1730 |
| 187 | Ga0105250_10010971 | 3300009092 | Bacteria | 3767 |
| 188 | Ga0105240_10001965 | 3300009093 | Bacteria | 33968 |
| 189 | Ga0105240_10026610 | 3300009093 | Bacteria | 7591 |
| 190 | Ga0105240_10102802 | 3300009093 | Unclassified | 3472 |
| 191 | Ga0105240_10120460 | 3300009093 | Bacteria | 3160 |
| 192 | Ga0105245_10005901 | 3300009098 | Bacteria | 10758 |
| 193 | Ga0105245_10012755 | 3300009098 | Bacteria | 7319 |
| 194 | Ga0105245_10331270 | 3300009098 | Bacteria | 1503 |
| 195 | Ga0105247_10008845 | 3300009101 | Bacteria | 6138 |
| 196 | Ga0105241_10006802 | 3300009174 | Bacteria | 8405 |
| 197 | Ga0105241_10007216 | 3300009174 | Bacteria | 8180 |
| 198 | Ga0105248_10064893 | 3300009177 | Bacteria | 4099 |
| 199 | Ga0105248_10141947 | 3300009177 | Bacteria | 2709 |
| 200 | Ga0105248_10148064 | 3300009177 | Bacteria | 2649 |
| 201 | Ga0105248_10261816 | 3300009177 | Bacteria | 1947 |
| 202 | Ga0105248_10310607 | 3300009177 | Bacteria | 1775 |
| 203 | Ga0105248_10335364 | 3300009177 | Bacteria | 1703 |
| 204 | Ga0105237_10015526 | 3300009545 | Bacteria | 7923 |
| 205 | Ga0105237_10079314 | 3300009545 | Bacteria | 3273 |
| 206 | Ga0105237_10098788 | 3300009545 | Bacteria | 2910 |
| 207 | Ga0105237_10891073 | 3300009545 | Bacteria | 897 |
| 208 | Ga0105238_10045706 | 3300009551 | Bacteria | 4423 |
| 209 | Ga0105238_10558339 | 3300009551 | Unclassified | 1150 |
| 210 | Ga0105238_11158071 | 3300009551 | Bacteria | 797 |
| 211 | Ga0105249_10028800 | 3300009553 | Bacteria | 5013 |
| 212 | Ga0105249_10041076 | 3300009553 | Unclassified | 4203 |
| 213 | Ga0105239_10005687 | 3300010375 | Bacteria | 14565 |
| 214 | Ga0105239_10044777 | 3300010375 | Bacteria | 4850 |
| 215 | Ga0105239_10051978 | 3300010375 | Bacteria | 4492 |
| 216 | Ga0105239_10131716 | 3300010375 | Bacteria | 2782 |
| 217 | Ga0105239_10258807 | 3300010375 | Unclassified | 1955 |
| 218 | Ga0105239_11271662 | 3300010375 | Bacteria | 849 |
| 219 | Ga0105246_10016424 | 3300011119 | Bacteria | 4689 |
| 220 | Ga0105246_10550236 | 3300011119 | Bacteria | 989 |
| 221 | Ga0105246_10640643 | 3300011119 | Bacteria | 924 |
| 222 | Ga0157370_10142125 | 3300013104 | Bacteria | 2236 |
| 223 | Ga0157370_10599761 | 3300013104 | Bacteria | 1008 |
| 224 | Ga0157369_10000299 | 3300013105 | Bacteria | 66242 |
| 225 | Ga0157369_10012638 | 3300013105 | Bacteria | 9574 |
| 226 | Ga0157369_10181551 | 3300013105 | Bacteria | 2214 |
| 227 | Ga0157369_10212334 | 3300013105 | Bacteria | 2028 |
| 228 | Ga0157369_10213168 | 3300013105 | Unclassified | 2024 |
| 229 | Ga0157369_10221743 | 3300013105 | Bacteria | 1979 |
| 230 | Ga0157369_10440596 | 3300013105 | Bacteria | 1349 |
| 231 | Ga0157374_10016590 | 3300013296 | Bacteria | 6478 |
| 232 | Ga0157374_10064262 | 3300013296 | Bacteria | 3444 |
| 233 | Ga0157374_10072789 | 3300013296 | Bacteria | 3243 |
| 234 | Ga0157378_10057220 | 3300013297 | Bacteria | 3474 |
| 235 | Ga0157378_10867282 | 3300013297 | Unclassified | 932 |
| 236 | Ga0163162_10022906 | 3300013306 | Bacteria | 6159 |
| 237 | Ga0163162_10547556 | 3300013306 | Unclassified | 1285 |
| 238 | Ga0163162_11870365 | 3300013306 | Bacteria | 687 |
| 239 | Ga0163162_11967925 | 3300013306 | Bacteria | 669 |
| 240 | Ga0157372_10001242 | 3300013307 | Bacteria | 27549 |
| 241 | Ga0157372_10042655 | 3300013307 | Bacteria | 5019 |
| 242 | Ga0157372_10160416 | 3300013307 | Bacteria | 2599 |
| 243 | Ga0157372_10304356 | 3300013307 | Bacteria | 1854 |
| 244 | Ga0157372_10426129 | 3300013307 | Bacteria | 1546 |
| 245 | Ga0157372_10552166 | 3300013307 | Bacteria | 1343 |
| 246 | Ga0157372_10644518 | 3300013307 | Unclassified | 1234 |
| 247 | Ga0157375_10087636 | 3300013308 | Unclassified | 3166 |
| 248 | Ga0157375_10939265 | 3300013308 | Unclassified | 1007 |
| 249 | Ga0163163_10002018 | 3300014325 | Bacteria | 17138 |
| 250 | Ga0163163_10009479 | 3300014325 | Bacteria | 8694 |
| 251 | Ga0163163_10009809 | 3300014325 | Bacteria | 8579 |
| 252 | Ga0163163_10010446 | 3300014325 | Bacteria | 8353 |
| 253 | Ga0163163_10031232 | 3300014325 | Bacteria | 5140 |
| 254 | Ga0163163_10051413 | 3300014325 | Bacteria | 4064 |
| 255 | Ga0163163_10117975 | 3300014325 | Bacteria | 2686 |
| 256 | Ga0163163_10211496 | 3300014325 | Bacteria | 1988 |
| 257 | Ga0163163_10420359 | 3300014325 | Unclassified | 1396 |
| 258 | Ga0163163_10712776 | 3300014325 | Bacteria | 1067 |
| 259 | Ga0157380_10031994 | 3300014326 | Bacteria | 4042 |
| 260 | Ga0182008_10021442 | 3300014497 | Bacteria | 3317 |
| 261 | Ga0182008_10022661 | 3300014497 | Bacteria | 3216 |
| 262 | Ga0157377_10000323 | 3300014745 | Bacteria | 21538 |
| 263 | Ga0157377_10140231 | 3300014745 | Unclassified | 1485 |
| 264 | Ga0157379_10003917 | 3300014968 | Bacteria | 12689 |
| 265 | Ga0157376_10005005 | 3300014969 | Bacteria | 9242 |
| 266 | Ga0157376_10178505 | 3300014969 | Bacteria | 1939 |
| 267 | Ga0157376_10241578 | 3300014969 | Unclassified | 1683 |
| 268 | Ga0157376_10515535 | 3300014969 | Unclassified | 1178 |
| 269 | Ga0157376_10620145 | 3300014969 | Bacteria | 1079 |
| 270 | Ga0182006_1008649 | 3300015261 | Bacteria | 4609 |
| 271 | Ga0182007_10003556 | 3300015262 | Bacteria | 7332 |
| 272 | Ga0182007_10019228 | 3300015262 | Bacteria | 2459 |
| 273 | Ga0182007_10035180 | 3300015262 | Bacteria | 1688 |
| 274 | Ga0182005_1015497 | 3300015265 | Bacteria | 2125 |
| 275 | Ga0163161_10002760 | 3300017792 | Bacteria | 12487 |
| 276 | Ga0163161_10183483 | 3300017792 | Bacteria | 1606 |
| 277 | Ga0207697_10002298 | 3300025315 | Bacteria | 9990 |
| 278 | Ga0207656_10009745 | 3300025321 | Bacteria | 3571 |
| 279 | Ga0207656_10101569 | 3300025321 | Bacteria | 1319 |
| 280 | Ga0207682_10053306 | 3300025893 | Bacteria | 1677 |
| 281 | Ga0207692_10001607 | 3300025898 | Bacteria | 8512 |
| 282 | Ga0207692_10003745 | 3300025898 | Bacteria | 5972 |
| 283 | Ga0207692_10099109 | 3300025898 | Bacteria | 1596 |
| 284 | Ga0207692_10259032 | 3300025898 | Bacteria | 1045 |
| 285 | Ga0207692_10288523 | 3300025898 | Bacteria | 995 |
| 286 | Ga0207692_10369624 | 3300025898 | Bacteria | 888 |
| 287 | Ga0207642_10031650 | 3300025899 | Bacteria | 2218 |
| 288 | Ga0207710_10041907 | 3300025900 | Bacteria | 2032 |
| 289 | Ga0207688_10005486 | 3300025901 | Bacteria | 6897 |
| 290 | Ga0207647_10000837 | 3300025904 | Bacteria | 23915 |
| 291 | Ga0207685_10000745 | 3300025905 | Bacteria | 5939 |
| 292 | Ga0207699_10000209 | 3300025906 | Bacteria | 34945 |
| 293 | Ga0207699_10006400 | 3300025906 | Bacteria | 5698 |
| 294 | Ga0207699_10042939 | 3300025906 | Bacteria | 2623 |
| 295 | Ga0207699_10047965 | 3300025906 | Bacteria | 2507 |
| 296 | Ga0207699_10080297 | 3300025906 | Bacteria | 2021 |
| 297 | Ga0207699_10259068 | 3300025906 | Bacteria | 1201 |
| 298 | Ga0207699_10481679 | 3300025906 | Bacteria | 894 |
| 299 | Ga0207699_10573046 | 3300025906 | Unclassified | 820 |
| 300 | Ga0207645_10000020 | 3300025907 | Bacteria | 106990 |
| 301 | Ga0207645_10488268 | 3300025907 | Unclassified | 833 |
| 302 | Ga0207643_10017059 | 3300025908 | Unclassified | 3965 |
| 303 | Ga0207705_10062814 | 3300025909 | Bacteria | 2683 |
| 304 | Ga0207684_10024360 | 3300025910 | Bacteria | 5161 |
| 305 | Ga0207684_10171974 | 3300025910 | Bacteria | 1867 |
| 306 | Ga0207654_10125613 | 3300025911 | Bacteria | 1617 |
| 307 | Ga0207707_10013290 | 3300025912 | Bacteria | 7175 |
| 308 | Ga0207707_10152524 | 3300025912 | Bacteria | 2020 |
| 309 | Ga0207707_10218470 | 3300025912 | Bacteria | 1659 |
| 310 | Ga0207707_10449172 | 3300025912 | Unclassified | 1103 |
| 311 | Ga0207707_10710463 | 3300025912 | Bacteria | 843 |
| 312 | Ga0207695_10004010 | 3300025913 | Bacteria | 20276 |
| 313 | Ga0207695_10098428 | 3300025913 | Bacteria | 2924 |
| 314 | Ga0207695_10162125 | 3300025913 | Bacteria | 2167 |
| 315 | Ga0207671_10044854 | 3300025914 | Bacteria | 3269 |
| 316 | Ga0207671_10123347 | 3300025914 | Bacteria | 1982 |
| 317 | Ga0207671_10313845 | 3300025914 | Bacteria | 1240 |
| 318 | Ga0207693_10000026 | 3300025915 | Bacteria | 122717 |
| 319 | Ga0207693_10000275 | 3300025915 | Bacteria | 47590 |
| 320 | Ga0207693_10006920 | 3300025915 | Bacteria | 9363 |
| 321 | Ga0207693_10007857 | 3300025915 | Bacteria | 8758 |
| 322 | Ga0207693_10026362 | 3300025915 | Bacteria | 4600 |
| 323 | Ga0207693_10084361 | 3300025915 | Unclassified | 2489 |
| 324 | Ga0207693_10171956 | 3300025915 | Unclassified | 1706 |
| 325 | Ga0207693_10527289 | 3300025915 | Bacteria | 921 |
| 326 | Ga0207693_10568332 | 3300025915 | Unclassified | 884 |
| 327 | Ga0207663_10015635 | 3300025916 | Bacteria | 4191 |
| 328 | Ga0207663_10040443 | 3300025916 | Bacteria | 2834 |
| 329 | Ga0207663_10079713 | 3300025916 | Bacteria | 2139 |
| 330 | Ga0207663_10370320 | 3300025916 | Bacteria | 1089 |
| 331 | Ga0207662_10000337 | 3300025918 | Bacteria | 21215 |
| 332 | Ga0207657_10000734 | 3300025919 | Bacteria | 34795 |
| 333 | Ga0207657_10005925 | 3300025919 | Bacteria | 12725 |
| 334 | Ga0207649_10000281 | 3300025920 | Bacteria | 40106 |
| 335 | Ga0207649_10596295 | 3300025920 | Unclassified | 849 |
| 336 | Ga0207652_10009354 | 3300025921 | Bacteria | 7880 |
| 337 | Ga0207652_10309404 | 3300025921 | Unclassified | 1426 |
| 338 | Ga0207652_10445028 | 3300025921 | Unclassified | 1168 |
| 339 | Ga0207652_10457705 | 3300025921 | Bacteria | 1150 |
| 340 | Ga0207646_10115834 | 3300025922 | Bacteria | 2407 |
| 341 | Ga0207646_10167696 | 3300025922 | Bacteria | 1982 |
| 342 | Ga0207694_10030154 | 3300025924 | Bacteria | 4141 |
| 343 | Ga0207694_10883105 | 3300025924 | Unclassified | 756 |
| 344 | Ga0207650_10000076 | 3300025925 | Bacteria | 132412 |
| 345 | Ga0207650_10042667 | 3300025925 | Bacteria | 3328 |
| 346 | Ga0207687_10008503 | 3300025927 | Bacteria | 6712 |
| 347 | Ga0207700_10000306 | 3300025928 | Bacteria | 28993 |
| 348 | Ga0207700_10033738 | 3300025928 | Bacteria | 3665 |
| 349 | Ga0207700_10070101 | 3300025928 | Bacteria | 2694 |
| 350 | Ga0207700_10125356 | 3300025928 | Bacteria | 2089 |
| 351 | Ga0207700_10134363 | 3300025928 | Bacteria | 2024 |
| 352 | Ga0207700_10147366 | 3300025928 | Bacteria | 1941 |
| 353 | Ga0207700_10187400 | 3300025928 | Bacteria | 1736 |
| 354 | Ga0207700_10242667 | 3300025928 | Bacteria | 1536 |
| 355 | Ga0207664_10000087 | 3300025929 | Bacteria | 88607 |
| 356 | Ga0207664_10012370 | 3300025929 | Bacteria | 6098 |
| 357 | Ga0207664_10019525 | 3300025929 | Bacteria | 5011 |
| 358 | Ga0207664_10036740 | 3300025929 | Bacteria | 3786 |
| 359 | Ga0207664_10251116 | 3300025929 | Unclassified | 1544 |
| 360 | Ga0207664_10355438 | 3300025929 | Unclassified | 1297 |
| 361 | Ga0207664_10944598 | 3300025929 | Bacteria | 773 |
| 362 | Ga0207644_10019111 | 3300025931 | Unclassified | 4645 |
| 363 | Ga0207644_10043093 | 3300025931 | Bacteria | 3202 |
| 364 | Ga0207644_10687880 | 3300025931 | Unclassified | 852 |
| 365 | Ga0207690_10084483 | 3300025932 | Bacteria | 2225 |
| 366 | Ga0207690_10380823 | 3300025932 | Bacteria | 1121 |
| 367 | Ga0207706_10000684 | 3300025933 | Bacteria | 35566 |
| 368 | Ga0207706_10002540 | 3300025933 | Bacteria | 17788 |
| 369 | Ga0207670_10023873 | 3300025936 | Unclassified | 3813 |
| 370 | Ga0207670_10269899 | 3300025936 | Bacteria | 1322 |
| 371 | Ga0207669_10413638 | 3300025937 | Unclassified | 1059 |
| 372 | Ga0207704_10197282 | 3300025938 | Unclassified | 1470 |
| 373 | Ga0207665_10000378 | 3300025939 | Bacteria | 30729 |
| 374 | Ga0207665_10041512 | 3300025939 | Unclassified | 3073 |
| 375 | Ga0207665_10116978 | 3300025939 | Bacteria | 1879 |
| 376 | Ga0207691_10000533 | 3300025940 | Bacteria | 38044 |
| 377 | Ga0207711_10016329 | 3300025941 | Bacteria | 6168 |
| 378 | Ga0207711_10066861 | 3300025941 | Bacteria | 3109 |
| 379 | Ga0207711_10070016 | 3300025941 | Unclassified | 3042 |
| 380 | Ga0207711_10095749 | 3300025941 | Unclassified | 2619 |
| 381 | Ga0207711_10345001 | 3300025941 | Bacteria | 1378 |
| 382 | Ga0207711_10712585 | 3300025941 | Unclassified | 936 |
| 383 | Ga0207689_10000097 | 3300025942 | Bacteria | 70239 |
| 384 | Ga0207689_10280422 | 3300025942 | Bacteria | 1380 |
| 385 | Ga0207661_10000003 | 3300025944 | Bacteria | 611941 |
| 386 | Ga0207661_10000329 | 3300025944 | Bacteria | 30164 |
| 387 | Ga0207661_10170580 | 3300025944 | Bacteria | 1894 |
| 388 | Ga0207661_10689291 | 3300025944 | Bacteria | 939 |
| 389 | Ga0207679_10000086 | 3300025945 | Bacteria | 81943 |
| 390 | Ga0207667_10066114 | 3300025949 | Bacteria | 3770 |
| 391 | Ga0207667_10085153 | 3300025949 | Bacteria | 3272 |
| 392 | Ga0207667_10424647 | 3300025949 | Bacteria | 1352 |
| 393 | Ga0207667_11470757 | 3300025949 | Bacteria | 653 |
| 394 | Ga0207651_10025675 | 3300025960 | Bacteria | 3666 |
| 395 | Ga0207712_10380382 | 3300025961 | Unclassified | 1181 |
| 396 | Ga0207640_10236209 | 3300025981 | Bacteria | 1409 |
| 397 | Ga0207658_10591554 | 3300025986 | Bacteria | 996 |
| 398 | Ga0207677_10011159 | 3300026023 | Bacteria | 5109 |
| 399 | Ga0207677_10062846 | 3300026023 | Unclassified | 2578 |
| 400 | Ga0207677_10177066 | 3300026023 | Bacteria | 1674 |
| 401 | Ga0207677_10644072 | 3300026023 | Bacteria | 935 |
| 402 | Ga0207703_10003138 | 3300026035 | Bacteria | 13948 |
| 403 | Ga0207703_10768259 | 3300026035 | Bacteria | 919 |
| 404 | Ga0207639_10292189 | 3300026041 | Bacteria | 1437 |
| 405 | Ga0207639_10304207 | 3300026041 | Bacteria | 1410 |
| 406 | Ga0207678_10000092 | 3300026067 | Bacteria | 75016 |
| 407 | Ga0207678_10584931 | 3300026067 | Bacteria | 978 |
| 408 | Ga0207702_10074218 | 3300026078 | Bacteria | 2935 |
| 409 | Ga0207702_10087077 | 3300026078 | Bacteria | 2725 |
| 410 | Ga0207702_10110295 | 3300026078 | Bacteria | 2445 |
| 411 | Ga0207641_10001986 | 3300026088 | Bacteria | 19528 |
| 412 | Ga0207641_10030963 | 3300026088 | Unclassified | 4435 |
| 413 | Ga0207641_10082261 | 3300026088 | Bacteria | 2797 |
| 414 | Ga0207641_10112273 | 3300026088 | Bacteria | 2418 |
| 415 | Ga0207641_11510486 | 3300026088 | Unclassified | 673 |
| 416 | Ga0207648_10000027 | 3300026089 | Bacteria | 130128 |
| 417 | Ga0207676_10000301 | 3300026095 | Bacteria | 42521 |
| 418 | Ga0207676_10642436 | 3300026095 | Bacteria | 1023 |
| 419 | Ga0207674_10002631 | 3300026116 | Bacteria | 22482 |
| 420 | Ga0207674_10010225 | 3300026116 | Bacteria | 10659 |
| 421 | Ga0207674_10026353 | 3300026116 | Bacteria | 6176 |
| 422 | Ga0207674_10108132 | 3300026116 | Unclassified | 2758 |
| 423 | Ga0207675_100207491 | 3300026118 | Bacteria | 1883 |
| 424 | Ga0207683_10001351 | 3300026121 | Bacteria | 22151 |
| 425 | Ga0207698_10512240 | 3300026142 | Unclassified | 1169 |
| 426 | Ga0265355_1000430 | 3300028036 | Bacteria | 2157 |
| 427 | Ga0268266_10001514 | 3300028379 | Bacteria | 27246 |
| 428 | Ga0268265_10081488 | 3300028380 | Bacteria | 2555 |
| 429 | Ga0268265_10093670 | 3300028380 | Bacteria | 2407 |
| 430 | Ga0268264_10023678 | 3300028381 | Bacteria | 5007 |
| 431 | Ga0268264_10062355 | 3300028381 | Bacteria | 3130 |
| 432 | Ga0265338_10003313 | 3300028800 | Bacteria | 22804 |
| 433 | Ga0265338_10011557 | 3300028800 | Bacteria | 10178 |
| 434 | Ga0265338_10015868 | 3300028800 | Bacteria | 8244 |
| 435 | Ga0265338_10084846 | 3300028800 | Bacteria | 2642 |
| 436 | Ga0265338_10200839 | 3300028800 | Bacteria | 1503 |
| 437 | Ga0265338_10219890 | 3300028800 | Unclassified | 1419 |
| 438 | Ga0265770_1010399 | 3300030878 | Unclassified | 1350 |
| 439 | Ga0265765_1002649 | 3300030879 | Unclassified | 1748 |
| 440 | Ga0265765_1016532 | 3300030879 | Unclassified | 865 |
| 441 | Ga0265760_10007781 | 3300031090 | Bacteria | 3061 |
| 442 | Ga0265760_10024863 | 3300031090 | Unclassified | 1747 |
| 443 | Ga0265760_10063354 | 3300031090 | Bacteria | 1126 |
| 444 | Ga0265330_10107147 | 3300031235 | Unclassified | 1195 |
| 445 | Ga0265332_10011313 | 3300031238 | Bacteria | 3968 |
| 446 | Ga0265332_10052063 | 3300031238 | Unclassified | 1758 |
| 447 | Ga0265328_10019249 | 3300031239 | Bacteria | 2624 |
| 448 | Ga0265328_10071933 | 3300031239 | Unclassified | 1271 |
| 449 | Ga0265325_10008405 | 3300031241 | Bacteria | 6094 |
| 450 | Ga0265325_10044574 | 3300031241 | Bacteria | 2309 |
| 451 | Ga0265325_10294621 | 3300031241 | Bacteria | 725 |
| 452 | Ga0265325_10337724 | 3300031241 | Bacteria | 667 |
| 453 | Ga0265340_10011576 | 3300031247 | Bacteria | 4685 |
| 454 | Ga0265340_10017709 | 3300031247 | Bacteria | 3685 |
| 455 | Ga0265340_10039410 | 3300031247 | Bacteria | 2331 |
| 456 | Ga0265340_10042480 | 3300031247 | Bacteria | 2232 |
| 457 | Ga0265340_10059053 | 3300031247 | Unclassified | 1840 |
| 458 | Ga0265340_10091526 | 3300031247 | Bacteria | 1421 |
| 459 | Ga0265339_10015513 | 3300031249 | Bacteria | 4563 |
| 460 | Ga0265339_10075737 | 3300031249 | Bacteria | 1786 |
| 461 | Ga0265339_10097025 | 3300031249 | Bacteria | 1538 |
| 462 | Ga0265339_10128431 | 3300031249 | Bacteria | 1298 |
| 463 | Ga0265331_10006314 | 3300031250 | Bacteria | 7017 |
| 464 | Ga0265331_10043370 | 3300031250 | Bacteria | 2179 |
| 465 | Ga0265331_10071947 | 3300031250 | Bacteria | 1616 |
| 466 | Ga0265331_10185008 | 3300031250 | Bacteria | 940 |
| 467 | Ga0265327_10029065 | 3300031251 | Bacteria | 3149 |
| 468 | Ga0265316_10001586 | 3300031344 | Bacteria | 24297 |
| 469 | Ga0265316_10003793 | 3300031344 | Bacteria | 15194 |
| 470 | Ga0265316_10011708 | 3300031344 | Bacteria | 7899 |
| 471 | Ga0265316_10013616 | 3300031344 | Bacteria | 7217 |
| 472 | Ga0265316_10034691 | 3300031344 | Bacteria | 4096 |
| 473 | Ga0265316_10045745 | 3300031344 | Bacteria | 3472 |
| 474 | Ga0265316_10091718 | 3300031344 | Bacteria | 2317 |
| 475 | Ga0265316_10096204 | 3300031344 | Unclassified | 2255 |
| 476 | Ga0265316_10109120 | 3300031344 | Bacteria | 2097 |
| 477 | Ga0265316_10140022 | 3300031344 | Unclassified | 1818 |
| 478 | Ga0265316_10144278 | 3300031344 | Unclassified | 1786 |
| 479 | Ga0265316_10192947 | 3300031344 | Bacteria | 1512 |
| 480 | Ga0265316_10249817 | 3300031344 | Bacteria | 1303 |
| 481 | Ga0307408_100152076 | 3300031548 | Bacteria | 1828 |
| 482 | Ga0265313_10029444 | 3300031595 | Bacteria | 2840 |
| 483 | Ga0307508_10187823 | 3300031616 | Bacteria | 1668 |
| 484 | Ga0265314_10005392 | 3300031711 | Bacteria | 11559 |
| 485 | Ga0265314_10039432 | 3300031711 | Unclassified | 3402 |
| 486 | Ga0265342_10062190 | 3300031712 | Bacteria | 2198 |
| 487 | Ga0265342_10130283 | 3300031712 | Bacteria | 1410 |
| 488 | Ga0265342_10186218 | 3300031712 | Bacteria | 1135 |
| 489 | Ga0265342_10255454 | 3300031712 | Bacteria | 934 |
| 490 | Ga0316576_10012436 | 3300031727 | Bacteria | 5621 |
| 491 | Ga0307405_10013056 | 3300031731 | Bacteria | 4421 |
| 492 | Ga0307413_10093964 | 3300031824 | Bacteria | 1962 |
| 493 | Ga0307410_10011350 | 3300031852 | Bacteria | 5092 |
| 494 | Ga0307410_10019394 | 3300031852 | Bacteria | 4137 |
| 495 | Ga0307406_10015404 | 3300031901 | Bacteria | 4424 |
| 496 | Ga0307407_10116037 | 3300031903 | Bacteria | 1689 |
| 497 | Ga0307407_10263805 | 3300031903 | Bacteria | 1186 |
| 498 | Ga0307412_10353244 | 3300031911 | Unclassified | 1181 |
| 499 | Ga0307409_100078288 | 3300031995 | Bacteria | 2659 |
| 500 | Ga0307409_100752564 | 3300031995 | Bacteria | 978 |
| 501 | Ga0307416_100060990 | 3300032002 | Bacteria | 3075 |
| 502 | Ga0307416_100122663 | 3300032002 | Bacteria | 2320 |
| 503 | Ga0307411_10047205 | 3300032005 | Bacteria | 2783 |
| 504 | Ga0307411_10152033 | 3300032005 | Bacteria | 1721 |
| 505 | Ga0307415_100029680 | 3300032126 | Bacteria | 3498 |
| 506 | Ga0316588_1129405 | 3300033528 | Unclassified | 641 |
| 507 | Ga0373926_0067130 | 3300035083 | Bacteria | 1314 |
| 508 | Ga0373934_0095718 | 3300035086 | Bacteria | 1199 |
| 509 | Ga0373934_0108509 | 3300035086 | Bacteria | 1125 |
| 510 | Ga0373923_0024164 | 3300035111 | Bacteria | 2397 |
| 511 | Ga0373936_0019394 | 3300035113 | Unclassified | 2635 |
| 512 | Ga0373936_0035469 | 3300035113 | Bacteria | 1986 |
| 513 | Ga0373945_0008745 | 3300035116 | Bacteria | 3305 |
| 514 | Ga0373945_0009368 | 3300035116 | Bacteria | 3208 |
| 515 | Ga0373953_0127369 | 3300035117 | Bacteria | 1084 |
| 516 | Ga0373957_0112755 | 3300035120 | Bacteria | 1096 |
| 517 | Ga0373943_0001626 | 3300035170 | Bacteria | 10190 |
| 518 | Ga0373946_0007422 | 3300035171 | Bacteria | 4009 |
| 519 | Ga0373955_0007025 | 3300035172 | Bacteria | 5155 |
| 520 | Ga0373924_0060056 | 3300035410 | Bacteria | 1589 |
| 521 | Ga0373935_0005817 | 3300035692 | Bacteria | 7302 |
| 522 | Ga0373935_0177769 | 3300035692 | Unclassified | 1460 |
| 523 | Ga0373935_0337797 | 3300035692 | Unclassified | 1072 |
| 524 | Ga0373927_0005658 | 3300035695 | Bacteria | 8590 |
| 525 | Ga0373927_0218593 | 3300035695 | Bacteria | 1252 |
| 526 | Ga0373927_0510111 | 3300035695 | Unclassified | 795 |
| 527 | Ga0373927_0562051 | 3300035695 | Bacteria | 754 |
| 528 | Ga0373933_0058022 | 3300035724 | Bacteria | 2327 |
| 529 | Ga0373933_0074113 | 3300035724 | Bacteria | 2075 |
| 530 | Ga0373933_0347727 | 3300035724 | Bacteria | 963 |
| 531 | Ga0373947_0005213 | 3300035725 | Bacteria | 7599 |
| 532 | Ga0373947_0033579 | 3300035725 | Bacteria | 3030 |
| 533 | Ga0373947_0091948 | 3300035725 | Bacteria | 1894 |
| 534 | Ga0373947_0612340 | 3300035725 | Unclassified | 742 |
| 535 | Ga0373937_0092088 | 3300036401 | Unclassified | 2810 |
| 536 | Ga0373937_0321289 | 3300036401 | Bacteria | 1465 |
| 537 | Ga0373937_0437845 | 3300036401 | Unclassified | 1241 |
| 538 | Ga0373937_0532452 | 3300036401 | Unclassified | 1116 |
| 539 | Ga0373937_0710918 | 3300036401 | Bacteria | 952 |
| 540 | Ga0373937_0891447 | 3300036401 | Bacteria | 838 |
| 541 | Ga0373925_0004658 | 3300037068 | Bacteria | 10348 |
| 542 | Ga0373925_0129617 | 3300037068 | Bacteria | 1965 |
| 543 | Ga0373925_0293846 | 3300037068 | Unclassified | 1311 |
| 544 | Ga0373925_0478959 | 3300037068 | Bacteria | 1021 |
| 545 | Ga0373925_0657610 | 3300037068 | Unclassified | 864 |
| 546 | Ga0395905_0996523 | 3300037471 | Bacteria | 741 |
| 547 | Ga0400487_48358 | 3300039110 | Bacteria | 1854 |
| 548 | Ga0436363_1670777 | 3300039450 | Bacteria | 2119 |
| 549 | Ga0436362_0417381 | 3300039453 | Unclassified | 786 |
| 550 | Ga0451577_0088068 | 3300042876 | Bacteria | 2770 |
| 551 | Ga0451577_0088529 | 3300042876 | Unclassified | 2762 |
| 552 | Ga0451577_0231907 | 3300042876 | Bacteria | 1670 |
| 553 | Ga0451577_0544815 | 3300042876 | Bacteria | 1053 |
| 554 | Ga0451577_0780444 | 3300042876 | Bacteria | 863 |
| 555 | Ga0453683_0020861 | 3300044673 | Bacteria | 4185 |
| 556 | Ga0453683_0068956 | 3300044673 | Bacteria | 2211 |
| 557 | Ga0453683_0167923 | 3300044673 | Bacteria | 1389 |
| 558 | Ga0453683_0479060 | 3300044673 | Bacteria | 806 |
| 559 | Ga0466963_0363900 | 3300044694 | Bacteria | 1019 |
| 560 | Ga0453684_0004808 | 3300044712 | Bacteria | 27796 |
| 561 | Ga0453684_0007794 | 3300044712 | Bacteria | 19533 |
| 562 | Ga0453684_0009271 | 3300044712 | Bacteria | 17276 |
| 563 | Ga0453684_0018536 | 3300044712 | Bacteria | 10671 |
| 564 | Ga0453684_0043198 | 3300044712 | Bacteria | 6062 |
| 565 | Ga0453684_0112396 | 3300044712 | Bacteria | 3306 |
| 566 | Ga0453684_0152673 | 3300044712 | Bacteria | 2742 |
| 567 | Ga0453684_0156208 | 3300044712 | Bacteria | 2704 |
| 568 | Ga0453684_0255348 | 3300044712 | Bacteria | 2011 |
| 569 | Ga0453684_0459160 | 3300044712 | Bacteria | 1417 |
| 570 | Ga0453684_1039479 | 3300044712 | Bacteria | 869 |
| 571 | Ga0453684_1352734 | 3300044712 | Bacteria | 741 |
| 572 | Ga0451576_0000508 | 3300045051 | Bacteria | 85239 |
| 573 | Ga0451576_0014682 | 3300045051 | Bacteria | 8707 |
| 574 | Ga0451576_0069480 | 3300045051 | Bacteria | 3665 |
| 575 | Ga0451576_0201696 | 3300045051 | Bacteria | 2077 |
| 576 | Ga0451576_0343409 | 3300045051 | Bacteria | 1563 |
| 577 | Ga0451576_0390582 | 3300045051 | Bacteria | 1459 |
| 578 | Ga0451576_0913402 | 3300045051 | Bacteria | 921 |
| 579 | Ga0451576_1207852 | 3300045051 | Bacteria | 789 |
| 580 | Ga0451576_1576639 | 3300045051 | Bacteria | 681 |
| 581 | Ga0495629_0530594 | 3300046459 | Unclassified | 791 |
| 582 | Ga0495580_0001289 | 3300046472 | Bacteria | 22103 |
| 583 | Ga0495580_0001629 | 3300046472 | Bacteria | 19732 |
| 584 | Ga0495580_0001942 | 3300046472 | Bacteria | 18151 |
| 585 | Ga0495580_0002140 | 3300046472 | Bacteria | 17326 |
| 586 | Ga0495580_0022575 | 3300046472 | Bacteria | 4630 |
| 587 | Ga0495580_0023319 | 3300046472 | Bacteria | 4547 |
| 588 | Ga0495580_0035448 | 3300046472 | Bacteria | 3588 |
| 589 | Ga0495580_0109097 | 3300046472 | Bacteria | 1922 |
| 590 | Ga0495580_0337045 | 3300046472 | Bacteria | 1023 |
| 591 | Ga0495582_0002195 | 3300046473 | Bacteria | 10922 |
| 592 | Ga0495662_0084799 | 3300046476 | Bacteria | 1542 |
| 593 | Ga0495664_0048528 | 3300046477 | Bacteria | 2520 |
| 594 | Ga0495664_0197227 | 3300046477 | Bacteria | 1220 |
| 595 | Ga0495664_0309766 | 3300046477 | Bacteria | 953 |
| 596 | Ga0495584_0359412 | 3300046491 | Unclassified | 739 |
| 597 | Ga0495608_0094355 | 3300046511 | Bacteria | 1933 |
| 598 | Ga0495608_0158548 | 3300046511 | Bacteria | 1440 |
| 599 | Ga0495628_0113195 | 3300046516 | Bacteria | 2085 |
| 600 | Ga0495628_0238957 | 3300046516 | Bacteria | 1359 |
| 601 | Ga0495628_0291006 | 3300046516 | Bacteria | 1211 |
| 602 | Ga0495628_0632093 | 3300046516 | Bacteria | 762 |
| 603 | Ga0495630_0159613 | 3300046517 | Bacteria | 1717 |
| 604 | Ga0495630_0351232 | 3300046517 | Bacteria | 1128 |
| 605 | Ga0495666_0296234 | 3300046526 | Bacteria | 732 |
| 606 | Ga0495652_0077795 | 3300046529 | Bacteria | 2748 |
| 607 | Ga0495652_0267677 | 3300046529 | Bacteria | 1258 |
| 608 | Ga0495665_0086863 | 3300046531 | Bacteria | 1644 |
| 609 | Ga0495665_0130241 | 3300046531 | Unclassified | 1317 |
| 610 | Ga0495640_0100943 | 3300046533 | Bacteria | 1894 |
| 611 | Ga0495640_0120533 | 3300046533 | Unclassified | 1706 |
| 612 | Ga0495586_0203297 | 3300046535 | Bacteria | 1123 |
| 613 | Ga0495586_0336996 | 3300046535 | Bacteria | 866 |
| 614 | Ga0495587_0133821 | 3300046536 | Bacteria | 1416 |
| 615 | Ga0495597_0129583 | 3300046542 | Bacteria | 1047 |
| 616 | Ga0495645_0048164 | 3300046543 | Bacteria | 3105 |
| 617 | Ga0495645_0066392 | 3300046543 | Bacteria | 2607 |
| 618 | Ga0495645_0217162 | 3300046543 | Bacteria | 1288 |
| 619 | Ga0495667_0021053 | 3300046559 | Bacteria | 4399 |
| 620 | Ga0495667_0037201 | 3300046559 | Bacteria | 3244 |
| 621 | Ga0495667_0504123 | 3300046559 | Unclassified | 758 |
| 622 | Ga0495634_0041533 | 3300046642 | Bacteria | 3123 |
| 623 | Ga0495635_0034978 | 3300046663 | Bacteria | 3484 |
| 624 | Ga0495635_0069154 | 3300046663 | Bacteria | 2421 |
| 625 | Ga0495635_0083069 | 3300046663 | Unclassified | 2192 |
| 626 | Ga0495657_0061077 | 3300046675 | Bacteria | 2494 |
| 627 | Ga0495599_0020419 | 3300046678 | Bacteria | 4125 |
| 628 | Ga0495599_0272622 | 3300046678 | Bacteria | 1026 |
| 629 | Ga0495599_0313790 | 3300046678 | Bacteria | 945 |
| 630 | Ga0495623_0057808 | 3300046679 | Bacteria | 2439 |
| 631 | Ga0495623_0070232 | 3300046679 | Bacteria | 2182 |
| 632 | Ga0495623_0209966 | 3300046679 | Unclassified | 1115 |
| 633 | Ga0495623_0224364 | 3300046679 | Bacteria | 1069 |
| 634 | Ga0495623_0225280 | 3300046679 | Unclassified | 1066 |
| 635 | Ga0495658_0020496 | 3300046683 | Bacteria | 3470 |
| 636 | Ga0495669_0071717 | 3300046684 | Unclassified | 1580 |
| 637 | Ga0495613_0034488 | 3300046689 | Bacteria | 3758 |
| 638 | Ga0495613_0091852 | 3300046689 | Bacteria | 2199 |
| 639 | Ga0495624_0317867 | 3300046690 | Unclassified | 938 |
| 640 | Ga0495600_0037589 | 3300046809 | Bacteria | 3148 |
| 641 | Ga0495604_0101045 | 3300047317 | Bacteria | 2119 |
| 642 | Ga0495604_0581456 | 3300047317 | Unclassified | 720 |
| 643 | Ga0495674_0009268 | 3300047319 | Bacteria | 9355 |
| 644 | Ga0495674_0041326 | 3300047319 | Bacteria | 4119 |
| 645 | Ga0495674_0053954 | 3300047319 | Bacteria | 3531 |
| 646 | Ga0495674_0077571 | 3300047319 | Bacteria | 2856 |
| 647 | Ga0495674_0491966 | 3300047319 | Unclassified | 982 |
| 648 | Ga0495676_0531589 | 3300047321 | Unclassified | 770 |
| 649 | Ga0495680_0157457 | 3300047322 | Bacteria | 1651 |
| 650 | Ga0495675_0062844 | 3300047444 | Bacteria | 2350 |
| 651 | Ga0495675_0290800 | 3300047444 | Bacteria | 972 |
| 652 | Ga0495675_0340738 | 3300047444 | Unclassified | 883 |
| 653 | Ga0495675_0356972 | 3300047444 | Bacteria | 859 |
| 654 | Ga0495684_0012376 | 3300047471 | Bacteria | 6579 |
| 655 | Ga0495684_0059394 | 3300047471 | Bacteria | 2912 |
| 656 | Ga0495684_0454842 | 3300047471 | Unclassified | 889 |
| 657 | Ga0495684_0518357 | 3300047471 | Bacteria | 817 |
| 658 | Ga0495593_0219838 | 3300047673 | Bacteria | 953 |
| 659 | Ga0495593_0260462 | 3300047673 | Bacteria | 868 |
| 660 | Ga0495602_0054542 | 3300048088 | Bacteria | 3528 |
| 661 | Ga0495602_0124558 | 3300048088 | Bacteria | 2067 |
| 662 | Ga0495602_0129153 | 3300048088 | Bacteria | 2019 |
| 663 | Ga0495602_0135022 | 3300048088 | Unclassified | 1962 |
| 664 | Ga0495602_0147010 | 3300048088 | Unclassified | 1858 |
| 665 | Ga0495602_0247501 | 3300048088 | Unclassified | 1330 |
| 666 | Ga0495602_0403179 | 3300048088 | Bacteria | 975 |
| 667 | Ga0496100_0095496 | 3300048903 | Bacteria | 2038 |
| 668 | Ga0496100_0201946 | 3300048903 | Unclassified | 1449 |
| 669 | Ga0496101_0134964 | 3300048904 | Bacteria | 1877 |
| 670 | Ga0496101_0174263 | 3300048904 | Bacteria | 1654 |
| 671 | Ga0496102_0043668 | 3300048905 | Bacteria | 4066 |
| 672 | Ga0496102_0062825 | 3300048905 | Bacteria | 3400 |
| 673 | Ga0496102_0070898 | 3300048905 | Bacteria | 3200 |
| 674 | Ga0496102_0877343 | 3300048905 | Bacteria | 819 |
| 675 | Ga0496103_0068956 | 3300048906 | Bacteria | 2210 |
| 676 | Ga0496103_0126989 | 3300048906 | Bacteria | 1627 |
| 677 | Ga0496104_0033407 | 3300048907 | Bacteria | 4792 |
| 678 | Ga0496104_0050964 | 3300048907 | Bacteria | 3906 |
| 679 | Ga0496104_0080794 | 3300048907 | Bacteria | 3100 |
| 680 | Ga0496105_0075007 | 3300048908 | Bacteria | 2794 |
| 681 | Ga0496105_0471417 | 3300048908 | Unclassified | 989 |
| 682 | Ga0496106_0405614 | 3300048909 | Bacteria | 1095 |
| 683 | Ga0496108_0000105 | 3300048911 | Bacteria | 87322 |
| 684 | Ga0496108_0810520 | 3300048911 | Bacteria | 807 |
| 685 | Ga0496109_0000008 | 3300048912 | Bacteria | 245809 |
| 686 | Ga0496109_0214432 | 3300048912 | Bacteria | 1810 |
| 687 | Ga0496110_0006952 | 3300048913 | Bacteria | 9000 |
| 688 | Ga0496110_0015129 | 3300048913 | Bacteria | 6414 |
| 689 | Ga0496110_0894563 | 3300048913 | Bacteria | 794 |
| 690 | Ga0496112_0006521 | 3300048915 | Bacteria | 10260 |
| 691 | Ga0496112_0074774 | 3300048915 | Bacteria | 3350 |
| 692 | Ga0496112_0177422 | 3300048915 | Unclassified | 2095 |
| 693 | Ga0496112_0487621 | 3300048915 | Bacteria | 1168 |
| 694 | Ga0496112_0487958 | 3300048915 | Unclassified | 1168 |
| 695 | Ga0496113_0000740 | 3300048916 | Bacteria | 16789 |
| 696 | Ga0496113_0188096 | 3300048916 | Bacteria | 1638 |
| 697 | Ga0496115_0003194 | 3300048918 | Bacteria | 11768 |
| 698 | Ga0496115_0669528 | 3300048918 | Bacteria | 819 |
| 699 | Ga0501296_009665 | 3300049519 | Unclassified | 1134 |
| 700 | Ga0501298_005780 | 3300049521 | Bacteria | 2000 |
| 701 | Ga0501032_0547919 | 3300049569 | Bacteria | 738 |
| 702 | Ga0501036_0958730 | 3300049572 | Bacteria | 701 |
| 703 | Ga0501040_0419561 | 3300049576 | Bacteria | 962 |
| 704 | Ga0501041_0350520 | 3300049577 | Bacteria | 933 |
| 705 | Ga0501042_0490213 | 3300049578 | Bacteria | 892 |
| 706 | Ga0501043_0667873 | 3300049579 | Bacteria | 762 |
| 707 | Ga0501069_0129243 | 3300049585 | Unclassified | 1446 |
| 708 | Ga0501069_0447831 | 3300049585 | Bacteria | 767 |
| 709 | Ga0501076_0244579 | 3300049592 | Bacteria | 1468 |
| 710 | Ga0501257_028974 | 3300049686 | Unclassified | 1330 |
| 711 | Ga0501079_0221444 | 3300049741 | Bacteria | 1478 |
| 712 | Ga0501045_0215151 | 3300049824 | Bacteria | 1431 |
| 713 | nmdc:mga0n895_1062062_c1 | 3300050512 | Unclassified | 788 |
| 714 | nmdc:mga0n895_3653_c1 | 3300050512 | Bacteria | 12440 |
| 715 | nmdc:mga0rr50_197673_c1 | 3300050513 | Bacteria | 1651 |
| 716 | nmdc:mga0rr50_529409_c1 | 3300050513 | Bacteria | 1003 |
| 717 | nmdc:mga08x19_113661_c1 | 3300050514 | Bacteria | 1808 |
| 718 | nmdc:mga08x19_298406_c1 | 3300050514 | Bacteria | 1119 |
| 719 | nmdc:mga08x19_347814_c1 | 3300050514 | Bacteria | 1035 |
| 720 | nmdc:mga08x19_9468_c1 | 3300050514 | Bacteria | 5836 |
| 721 | nmdc:mga0a205_56054_c1 | 3300050515 | Bacteria | 3806 |
| 722 | Ga0495601_0102137 | 3300053077 | Unclassified | 1853 |
| 723 | Ga0495601_0390222 | 3300053077 | Bacteria | 903 |
| 724 | Ga0495619_0395395 | 3300053085 | Bacteria | 955 |
| 725 | Ga0495619_0406392 | 3300053085 | Bacteria | 940 |
| 726 | Ga0501084_0673087 | 3300054114 | Bacteria | 873 |
| 727 | Ga0501082_0000500 | 3300060353 | Bacteria | 34726 |
| 728 | Ga0501082_0066339 | 3300060353 | Bacteria | 3109 |
| 729 | Ga0530510_0145906 | 3300061734 | Bacteria | 1745 |
| 730 | Ga0530510_0742440 | 3300061734 | Bacteria | 748 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031616 | Ga0307508_10187823 | Ga0307508_101878231 | 183 |
| 2 | 3300033528 | Ga0316588_1129405 | Ga0316588_11294051 | 183 |
| 3 | 3300039110 | Ga0400487_48358 | Ga0400487_48358_773_1330 | 183 |
| 4 | 3300042876 | Ga0451577_0088068 | Ga0451577_0088068_2000_2551 | 183 |
| 5 | 3300042876 | Ga0451577_0544815 | Ga0451577_0544815_384_935 | 183 |
| 6 | 3300042876 | Ga0451577_0780444 | Ga0451577_0780444_51_602 | 183 |
| 7 | 3300044673 | Ga0453683_0068956 | Ga0453683_0068956_1521_2090 | 183 |
| 8 | 3300044673 | Ga0453683_0479060 | Ga0453683_0479060_21_572 | 183 |
| 9 | 3300044712 | Ga0453684_0004808 | Ga0453684_0004808_10259_10810 | 183 |
| 10 | 3300044712 | Ga0453684_0007794 | Ga0453684_0007794_283_834 | 183 |
| 11 | 3300044712 | Ga0453684_0043198 | Ga0453684_0043198_3350_3901 | 183 |
| 12 | 3300044712 | Ga0453684_0152673 | Ga0453684_0152673_506_1057 | 183 |
| 13 | 3300044712 | Ga0453684_0255348 | Ga0453684_0255348_717_1268 | 183 |
| 14 | 3300044712 | Ga0453684_0459160 | Ga0453684_0459160_48_599 | 183 |
| 15 | 3300045051 | Ga0451576_0201696 | Ga0451576_0201696_1485_2036 | 183 |
| 16 | 3300046477 | Ga0495664_0309766 | Ga0495664_0309766_67_624 | 183 |
| 17 | 3300046516 | Ga0495628_0632093 | Ga0495628_0632093_23_607 | 183 |
| 18 | 3300046533 | Ga0495640_0100943 | Ga0495640_0100943_577_1170 | 183 |
| 19 | 3300046663 | Ga0495635_0069154 | Ga0495635_0069154_1470_2063 | 183 |
| 20 | 3300047319 | Ga0495674_0009268 | Ga0495674_0009268_4773_5366 | 183 |
| 21 | 3300047444 | Ga0495675_0356972 | Ga0495675_0356972_21_614 | 183 |
| 22 | 3300048088 | Ga0495602_0129153 | Ga0495602_0129153_428_1021 | 183 |
| 23 | 3300049572 | Ga0501036_0958730 | Ga0501036_0958730_82_633 | 183 |
| 24 | 3300049576 | Ga0501040_0419561 | Ga0501040_0419561_388_939 | 183 |
| 25 | 3300049577 | Ga0501041_0350520 | Ga0501041_0350520_245_799 | 183 |
| 26 | 3300049579 | Ga0501043_0667873 | Ga0501043_0667873_172_747 | 183 |
| 27 | 3300049592 | Ga0501076_0244579 | Ga0501076_0244579_10_561 | 183 |
| 28 | 3300061734 | Ga0530510_0145906 | Ga0530510_0145906_1156_1707 | 183 |
| 29 | 3300061734 | Ga0530510_0742440 | Ga0530510_0742440_155_706 | 183 |
| 30 | 3300031727 | Ga0316576_10012436 | Ga0316576_100124368 | 184 |
| 31 | 3300044673 | Ga0453683_0020861 | Ga0453683_0020861_536_1090 | 184 |
| 32 | 3300044673 | Ga0453683_0167923 | Ga0453683_0167923_662_1216 | 184 |
| 33 | 3300044712 | Ga0453684_0009271 | Ga0453684_0009271_14495_15070 | 184 |
| 34 | 3300044712 | Ga0453684_0018536 | Ga0453684_0018536_672_1226 | 184 |
| 35 | 3300044712 | Ga0453684_0112396 | Ga0453684_0112396_2711_3265 | 184 |
| 36 | 3300044712 | Ga0453684_0156208 | Ga0453684_0156208_1481_2035 | 184 |
| 37 | 3300045051 | Ga0451576_0000508 | Ga0451576_0000508_55048_55602 | 184 |
| 38 | 3300045051 | Ga0451576_0069480 | Ga0451576_0069480_2179_2733 | 184 |
| 39 | 3300045051 | Ga0451576_1207852 | Ga0451576_1207852_43_597 | 184 |
| 40 | 3300049578 | Ga0501042_0490213 | Ga0501042_0490213_28_582 | 184 |
| 41 | 3300049585 | Ga0501069_0447831 | Ga0501069_0447831_21_599 | 184 |
| 42 | 3300049741 | Ga0501079_0221444 | Ga0501079_0221444_72_650 | 184 |
| 43 | 3300054114 | Ga0501084_0673087 | Ga0501084_0673087_23_601 | 184 |
| 44 | 3300060353 | Ga0501082_0066339 | Ga0501082_0066339_853_1407 | 184 |
| 45 | 3300049569 | Ga0501032_0547919 | Ga0501032_0547919_66_626 | 186 |
| 46 | 3300028800 | Ga0265338_10015868 | Ga0265338_100158682 | 187 |
| 47 | 3300031241 | Ga0265325_10294621 | Ga0265325_102946212 | 187 |
| 48 | 3300031247 | Ga0265340_10017709 | Ga0265340_100177093 | 187 |
| 49 | 3300031250 | Ga0265331_10006314 | Ga0265331_100063143 | 187 |
| 50 | 3300031344 | Ga0265316_10001586 | Ga0265316_1000158620 | 187 |
| 51 | 3300031344 | Ga0265316_10034691 | Ga0265316_100346912 | 187 |
| 52 | 3300005355 | Ga0070671_100387295 | Ga0070671_1003872952 | 189 |
| 53 | 3300014325 | Ga0163163_10712776 | Ga0163163_107127761 | 189 |
| 54 | 3300036401 | Ga0373937_0092088 | Ga0373937_0092088_2031_2612 | 190 |
| 55 | 3300046476 | Ga0495662_0084799 | Ga0495662_0084799_168_749 | 190 |
| 56 | 3300046477 | Ga0495664_0048528 | Ga0495664_0048528_1333_1914 | 190 |
| 57 | 3300046511 | Ga0495608_0158548 | Ga0495608_0158548_158_739 | 190 |
| 58 | 3300046516 | Ga0495628_0113195 | Ga0495628_0113195_1047_1628 | 190 |
| 59 | 3300046517 | Ga0495630_0351232 | Ga0495630_0351232_330_911 | 190 |
| 60 | 3300046529 | Ga0495652_0077795 | Ga0495652_0077795_500_1081 | 190 |
| 61 | 3300046535 | Ga0495586_0203297 | Ga0495586_0203297_424_1005 | 190 |
| 62 | 3300046536 | Ga0495587_0133821 | Ga0495587_0133821_787_1368 | 190 |
| 63 | 3300046543 | Ga0495645_0066392 | Ga0495645_0066392_1435_2016 | 190 |
| 64 | 3300046559 | Ga0495667_0037201 | Ga0495667_0037201_1687_2268 | 190 |
| 65 | 3300046642 | Ga0495634_0041533 | Ga0495634_0041533_2292_2873 | 190 |
| 66 | 3300046663 | Ga0495635_0034978 | Ga0495635_0034978_113_694 | 190 |
| 67 | 3300046675 | Ga0495657_0061077 | Ga0495657_0061077_253_834 | 190 |
| 68 | 3300046678 | Ga0495599_0020419 | Ga0495599_0020419_2133_2714 | 190 |
| 69 | 3300046679 | Ga0495623_0057808 | Ga0495623_0057808_452_1033 | 190 |
| 70 | 3300046689 | Ga0495613_0034488 | Ga0495613_0034488_313_894 | 190 |
| 71 | 3300046809 | Ga0495600_0037589 | Ga0495600_0037589_779_1360 | 190 |
| 72 | 3300047317 | Ga0495604_0101045 | Ga0495604_0101045_1103_1684 | 190 |
| 73 | 3300047319 | Ga0495674_0041326 | Ga0495674_0041326_1502_2083 | 190 |
| 74 | 3300047322 | Ga0495680_0157457 | Ga0495680_0157457_926_1507 | 190 |
| 75 | 3300047444 | Ga0495675_0290800 | Ga0495675_0290800_118_699 | 190 |
| 76 | 3300047471 | Ga0495684_0059394 | Ga0495684_0059394_1245_1826 | 190 |
| 77 | 3300047673 | Ga0495593_0260462 | Ga0495593_0260462_100_681 | 190 |
| 78 | 3300048088 | Ga0495602_0247501 | Ga0495602_0247501_619_1200 | 190 |
| 79 | 3300050512 | nmdc:mga0n895_1062062_c1 | nmdc:mga0n895_1062062_c1_101_682 | 190 |
| 80 | 3300053077 | Ga0495601_0390222 | Ga0495601_0390222_241_822 | 190 |
| 81 | 3300053085 | Ga0495619_0406392 | Ga0495619_0406392_65_646 | 190 |
| 82 | 3300060353 | Ga0501082_0000500 | Ga0501082_0000500_3636_4217 | 190 |
| 83 | 3300005545 | Ga0070695_100150418 | Ga0070695_1001504182 | 191 |
| 84 | 3300025925 | Ga0207650_10042667 | Ga0207650_100426675 | 191 |
| 85 | 3300005365 | Ga0070688_100572401 | Ga0070688_1005724012 | 192 |
| 86 | 3300005434 | Ga0070709_10417986 | Ga0070709_104179861 | 192 |
| 87 | 3300005436 | Ga0070713_100221470 | Ga0070713_1002214702 | 192 |
| 88 | 3300005841 | Ga0068863_100344085 | Ga0068863_1003440852 | 192 |
| 89 | 3300006028 | Ga0070717_11346560 | Ga0070717_113465601 | 192 |
| 90 | 3300007076 | Ga0075435_100187808 | Ga0075435_1001878082 | 192 |
| 91 | 3300025906 | Ga0207699_10259068 | Ga0207699_102590682 | 192 |
| 92 | 3300036401 | Ga0373937_0710918 | Ga0373937_0710918_248_835 | 192 |
| 93 | 3300049824 | Ga0501045_0215151 | Ga0501045_0215151_620_1204 | 192 |
| 94 | 3300035695 | Ga0373927_0562051 | Ga0373927_0562051_146_733 | 193 |
| 95 | 3300005364 | Ga0070673_100031611 | Ga0070673_1000316111 | 194 |
| 96 | 3300005535 | Ga0070684_100820268 | Ga0070684_1008202682 | 194 |
| 97 | 3300006358 | Ga0068871_100242391 | Ga0068871_1002423912 | 194 |
| 98 | 3300009093 | Ga0105240_10001965 | Ga0105240_1000196512 | 194 |
| 99 | 3300013105 | Ga0157369_10212334 | Ga0157369_102123342 | 194 |
| 100 | 3300013307 | Ga0157372_10304356 | Ga0157372_103043562 | 194 |
| 101 | 3300014969 | Ga0157376_10620145 | Ga0157376_106201452 | 194 |
| 102 | 3300031344 | Ga0265316_10003793 | Ga0265316_100037935 | 194 |
| 103 | 3300048903 | Ga0496100_0095496 | Ga0496100_0095496_323_907 | 194 |
| 104 | 3300048904 | Ga0496101_0174263 | Ga0496101_0174263_127_711 | 194 |
| 105 | 3300048905 | Ga0496102_0070898 | Ga0496102_0070898_2238_2822 | 194 |
| 106 | 3300048906 | Ga0496103_0126989 | Ga0496103_0126989_575_1159 | 194 |
| 107 | 3300048907 | Ga0496104_0080794 | Ga0496104_0080794_519_1103 | 194 |
| 108 | 3300048911 | Ga0496108_0000105 | Ga0496108_0000105_61455_62039 | 194 |
| 109 | 3300048912 | Ga0496109_0000008 | Ga0496109_0000008_162163_162747 | 194 |
| 110 | 3300048913 | Ga0496110_0006952 | Ga0496110_0006952_4936_5520 | 194 |
| 111 | 3300048915 | Ga0496112_0006521 | Ga0496112_0006521_7829_8413 | 194 |
| 112 | 3300048916 | Ga0496113_0000740 | Ga0496113_0000740_10555_11139 | 194 |
| 113 | 3300005328 | Ga0070676_10064385 | Ga0070676_100643853 | 195 |
| 114 | 3300005329 | Ga0070683_100000026 | Ga0070683_10000002688 | 195 |
| 115 | 3300005335 | Ga0070666_10187314 | Ga0070666_101873142 | 195 |
| 116 | 3300005336 | Ga0070680_100279279 | Ga0070680_1002792792 | 195 |
| 117 | 3300005337 | Ga0070682_100393570 | Ga0070682_1003935702 | 195 |
| 118 | 3300005338 | Ga0068868_100524125 | Ga0068868_1005241252 | 195 |
| 119 | 3300005339 | Ga0070660_100039364 | Ga0070660_1000393644 | 195 |
| 120 | 3300005344 | Ga0070661_100157898 | Ga0070661_1001578982 | 195 |
| 121 | 3300005355 | Ga0070671_100267480 | Ga0070671_1002674802 | 195 |
| 122 | 3300005366 | Ga0070659_100359833 | Ga0070659_1003598332 | 195 |
| 123 | 3300005435 | Ga0070714_100031659 | Ga0070714_1000316595 | 195 |
| 124 | 3300005435 | Ga0070714_100133767 | Ga0070714_1001337672 | 195 |
| 125 | 3300005435 | Ga0070714_100446168 | Ga0070714_1004461682 | 195 |
| 126 | 3300005435 | Ga0070714_100752081 | Ga0070714_1007520811 | 195 |
| 127 | 3300005436 | Ga0070713_100000441 | Ga0070713_10000044125 | 195 |
| 128 | 3300005436 | Ga0070713_100007620 | Ga0070713_1000076206 | 195 |
| 129 | 3300005436 | Ga0070713_100013545 | Ga0070713_1000135454 | 195 |
| 130 | 3300005436 | Ga0070713_100134367 | Ga0070713_1001343671 | 195 |
| 131 | 3300005439 | Ga0070711_100005922 | Ga0070711_1000059223 | 195 |
| 132 | 3300005439 | Ga0070711_100137176 | Ga0070711_1001371762 | 195 |
| 133 | 3300005457 | Ga0070662_100282563 | Ga0070662_1002825632 | 195 |
| 134 | 3300005458 | Ga0070681_10018999 | Ga0070681_100189992 | 195 |
| 135 | 3300005458 | Ga0070681_10191500 | Ga0070681_101915002 | 195 |
| 136 | 3300005530 | Ga0070679_100250148 | Ga0070679_1002501482 | 195 |
| 137 | 3300005535 | Ga0070684_100000012 | Ga0070684_100000012136 | 195 |
| 138 | 3300005546 | Ga0070696_100883854 | Ga0070696_1008838542 | 195 |
| 139 | 3300005563 | Ga0068855_100263335 | Ga0068855_1002633352 | 195 |
| 140 | 3300005563 | Ga0068855_100833125 | Ga0068855_1008331252 | 195 |
| 141 | 3300005564 | Ga0070664_100043507 | Ga0070664_1000435073 | 195 |
| 142 | 3300005577 | Ga0068857_100091368 | Ga0068857_1000913682 | 195 |
| 143 | 3300005578 | Ga0068854_100022813 | Ga0068854_1000228132 | 195 |
| 144 | 3300005614 | Ga0068856_100010274 | Ga0068856_1000102746 | 195 |
| 145 | 3300005614 | Ga0068856_100097796 | Ga0068856_1000977963 | 195 |
| 146 | 3300005614 | Ga0068856_100134259 | Ga0068856_1001342593 | 195 |
| 147 | 3300005616 | Ga0068852_100118155 | Ga0068852_1001181554 | 195 |
| 148 | 3300005618 | Ga0068864_100417490 | Ga0068864_1004174902 | 195 |
| 149 | 3300005834 | Ga0068851_10004133 | Ga0068851_100041332 | 195 |
| 150 | 3300005841 | Ga0068863_100030784 | Ga0068863_1000307845 | 195 |
| 151 | 3300006163 | Ga0070715_10032767 | Ga0070715_100327672 | 195 |
| 152 | 3300006175 | Ga0070712_100000618 | Ga0070712_1000006186 | 195 |
| 153 | 3300006175 | Ga0070712_100072370 | Ga0070712_1000723703 | 195 |
| 154 | 3300006175 | Ga0070712_100105021 | Ga0070712_1001050213 | 195 |
| 155 | 3300006175 | Ga0070712_100585364 | Ga0070712_1005853641 | 195 |
| 156 | 3300006237 | Ga0097621_100100757 | Ga0097621_1001007572 | 195 |
| 157 | 3300006237 | Ga0097621_100554534 | Ga0097621_1005545342 | 195 |
| 158 | 3300009093 | Ga0105240_10102802 | Ga0105240_101028025 | 195 |
| 159 | 3300009093 | Ga0105240_10120460 | Ga0105240_101204602 | 195 |
| 160 | 3300009174 | Ga0105241_10006802 | Ga0105241_100068026 | 195 |
| 161 | 3300009177 | Ga0105248_10064893 | Ga0105248_100648932 | 195 |
| 162 | 3300009545 | Ga0105237_10098788 | Ga0105237_100987882 | 195 |
| 163 | 3300009551 | Ga0105238_10045706 | Ga0105238_100457065 | 195 |
| 164 | 3300010375 | Ga0105239_10131716 | Ga0105239_101317162 | 195 |
| 165 | 3300010375 | Ga0105239_11271662 | Ga0105239_112716622 | 195 |
| 166 | 3300013104 | Ga0157370_10142125 | Ga0157370_101421253 | 195 |
| 167 | 3300013105 | Ga0157369_10181551 | Ga0157369_101815513 | 195 |
| 168 | 3300013105 | Ga0157369_10221743 | Ga0157369_102217432 | 195 |
| 169 | 3300013105 | Ga0157369_10440596 | Ga0157369_104405961 | 195 |
| 170 | 3300013296 | Ga0157374_10016590 | Ga0157374_100165904 | 195 |
| 171 | 3300013297 | Ga0157378_10057220 | Ga0157378_100572202 | 195 |
| 172 | 3300013307 | Ga0157372_10042655 | Ga0157372_100426552 | 195 |
| 173 | 3300013307 | Ga0157372_10160416 | Ga0157372_101604163 | 195 |
| 174 | 3300013307 | Ga0157372_10552166 | Ga0157372_105521662 | 195 |
| 175 | 3300013307 | Ga0157372_10644518 | Ga0157372_106445181 | 195 |
| 176 | 3300014497 | Ga0182008_10021442 | Ga0182008_100214422 | 195 |
| 177 | 3300014745 | Ga0157377_10140231 | Ga0157377_101402312 | 195 |
| 178 | 3300015262 | Ga0182007_10003556 | Ga0182007_100035563 | 195 |
| 179 | 3300015262 | Ga0182007_10035180 | Ga0182007_100351801 | 195 |
| 180 | 3300015265 | Ga0182005_1015497 | Ga0182005_10154972 | 195 |
| 181 | 3300025321 | Ga0207656_10101569 | Ga0207656_101015692 | 195 |
| 182 | 3300025906 | Ga0207699_10000209 | Ga0207699_1000020921 | 195 |
| 183 | 3300025907 | Ga0207645_10488268 | Ga0207645_104882682 | 195 |
| 184 | 3300025911 | Ga0207654_10125613 | Ga0207654_101256132 | 195 |
| 185 | 3300025912 | Ga0207707_10152524 | Ga0207707_101525242 | 195 |
| 186 | 3300025912 | Ga0207707_10218470 | Ga0207707_102184701 | 195 |
| 187 | 3300025913 | Ga0207695_10098428 | Ga0207695_100984283 | 195 |
| 188 | 3300025914 | Ga0207671_10123347 | Ga0207671_101233473 | 195 |
| 189 | 3300025915 | Ga0207693_10000026 | Ga0207693_1000002648 | 195 |
| 190 | 3300025915 | Ga0207693_10084361 | Ga0207693_100843613 | 195 |
| 191 | 3300025915 | Ga0207693_10171956 | Ga0207693_101719562 | 195 |
| 192 | 3300025915 | Ga0207693_10568332 | Ga0207693_105683322 | 195 |
| 193 | 3300025916 | Ga0207663_10079713 | Ga0207663_100797132 | 195 |
| 194 | 3300025919 | Ga0207657_10000734 | Ga0207657_1000073425 | 195 |
| 195 | 3300025920 | Ga0207649_10596295 | Ga0207649_105962951 | 195 |
| 196 | 3300025921 | Ga0207652_10309404 | Ga0207652_103094042 | 195 |
| 197 | 3300025921 | Ga0207652_10445028 | Ga0207652_104450281 | 195 |
| 198 | 3300025924 | Ga0207694_10030154 | Ga0207694_100301542 | 195 |
| 199 | 3300025928 | Ga0207700_10000306 | Ga0207700_1000030619 | 195 |
| 200 | 3300025928 | Ga0207700_10033738 | Ga0207700_100337383 | 195 |
| 201 | 3300025928 | Ga0207700_10070101 | Ga0207700_100701012 | 195 |
| 202 | 3300025928 | Ga0207700_10134363 | Ga0207700_101343631 | 195 |
| 203 | 3300025928 | Ga0207700_10242667 | Ga0207700_102426672 | 195 |
| 204 | 3300025929 | Ga0207664_10036740 | Ga0207664_100367402 | 195 |
| 205 | 3300025929 | Ga0207664_10355438 | Ga0207664_103554382 | 195 |
| 206 | 3300025931 | Ga0207644_10043093 | Ga0207644_100430932 | 195 |
| 207 | 3300025932 | Ga0207690_10380823 | Ga0207690_103808232 | 195 |
| 208 | 3300025933 | Ga0207706_10002540 | Ga0207706_100025407 | 195 |
| 209 | 3300025939 | Ga0207665_10041512 | Ga0207665_100415122 | 195 |
| 210 | 3300025941 | Ga0207711_10070016 | Ga0207711_100700163 | 195 |
| 211 | 3300025944 | Ga0207661_10000003 | Ga0207661_10000003474 | 195 |
| 212 | 3300025949 | Ga0207667_10085153 | Ga0207667_100851533 | 195 |
| 213 | 3300025949 | Ga0207667_11470757 | Ga0207667_114707571 | 195 |
| 214 | 3300025981 | Ga0207640_10236209 | Ga0207640_102362092 | 195 |
| 215 | 3300026023 | Ga0207677_10644072 | Ga0207677_106440722 | 195 |
| 216 | 3300026041 | Ga0207639_10304207 | Ga0207639_103042072 | 195 |
| 217 | 3300026078 | Ga0207702_10087077 | Ga0207702_100870772 | 195 |
| 218 | 3300026078 | Ga0207702_10110295 | Ga0207702_101102952 | 195 |
| 219 | 3300026088 | Ga0207641_11510486 | Ga0207641_115104861 | 195 |
| 220 | 3300026116 | Ga0207674_10108132 | Ga0207674_101081323 | 195 |
| 221 | 3300026142 | Ga0207698_10512240 | Ga0207698_105122401 | 195 |
| 222 | 3300031249 | Ga0265339_10097025 | Ga0265339_100970252 | 195 |
| 223 | 3300031250 | Ga0265331_10071947 | Ga0265331_100719472 | 195 |
| 224 | 3300031344 | Ga0265316_10192947 | Ga0265316_101929472 | 195 |
| 225 | 3300031712 | Ga0265342_10255454 | Ga0265342_102554541 | 195 |
| 226 | 3300035086 | Ga0373934_0095718 | Ga0373934_0095718_24_611 | 195 |
| 227 | 3300035692 | Ga0373935_0337797 | Ga0373935_0337797_375_962 | 195 |
| 228 | 3300036401 | Ga0373937_0437845 | Ga0373937_0437845_287_874 | 195 |
| 229 | 3300036401 | Ga0373937_0532452 | Ga0373937_0532452_165_779 | 195 |
| 230 | 3300044712 | Ga0453684_1039479 | Ga0453684_1039479_103_699 | 195 |
| 231 | 3300046472 | Ga0495580_0023319 | Ga0495580_0023319_1358_1945 | 195 |
| 232 | 3300046472 | Ga0495580_0035448 | Ga0495580_0035448_2479_3093 | 195 |
| 233 | 3300046511 | Ga0495608_0094355 | Ga0495608_0094355_270_884 | 195 |
| 234 | 3300046529 | Ga0495652_0267677 | Ga0495652_0267677_158_781 | 195 |
| 235 | 3300046542 | Ga0495597_0129583 | Ga0495597_0129583_345_932 | 195 |
| 236 | 3300046559 | Ga0495667_0021053 | Ga0495667_0021053_2798_3412 | 195 |
| 237 | 3300046679 | Ga0495623_0070232 | Ga0495623_0070232_1101_1715 | 195 |
| 238 | 3300047319 | Ga0495674_0491966 | Ga0495674_0491966_133_747 | 195 |
| 239 | 3300047444 | Ga0495675_0062844 | Ga0495675_0062844_1272_1886 | 195 |
| 240 | 3300047471 | Ga0495684_0012376 | Ga0495684_0012376_697_1311 | 195 |
| 241 | 3300048088 | Ga0495602_0124558 | Ga0495602_0124558_1374_1988 | 195 |
| 242 | 3300048903 | Ga0496100_0201946 | Ga0496100_0201946_196_783 | 195 |
| 243 | 3300048904 | Ga0496101_0134964 | Ga0496101_0134964_935_1522 | 195 |
| 244 | 3300048905 | Ga0496102_0062825 | Ga0496102_0062825_1042_1629 | 195 |
| 245 | 3300048906 | Ga0496103_0068956 | Ga0496103_0068956_461_1048 | 195 |
| 246 | 3300048907 | Ga0496104_0033407 | Ga0496104_0033407_2376_2963 | 195 |
| 247 | 3300048908 | Ga0496105_0075007 | Ga0496105_0075007_484_1071 | 195 |
| 248 | 3300048909 | Ga0496106_0405614 | Ga0496106_0405614_157_744 | 195 |
| 249 | 3300048912 | Ga0496109_0214432 | Ga0496109_0214432_596_1183 | 195 |
| 250 | 3300048913 | Ga0496110_0015129 | Ga0496110_0015129_3104_3691 | 195 |
| 251 | 3300048915 | Ga0496112_0487621 | Ga0496112_0487621_268_855 | 195 |
| 252 | 3300048916 | Ga0496113_0188096 | Ga0496113_0188096_467_1054 | 195 |
| 253 | 3300005329 | Ga0070683_100172155 | Ga0070683_1001721551 | 196 |
| 254 | 3300005334 | Ga0068869_100663966 | Ga0068869_1006639662 | 196 |
| 255 | 3300005340 | Ga0070689_100273318 | Ga0070689_1002733182 | 196 |
| 256 | 3300005340 | Ga0070689_100706555 | Ga0070689_1007065552 | 196 |
| 257 | 3300005434 | Ga0070709_10029013 | Ga0070709_100290132 | 196 |
| 258 | 3300005436 | Ga0070713_100188999 | Ga0070713_1001889992 | 196 |
| 259 | 3300005436 | Ga0070713_101342043 | Ga0070713_1013420431 | 196 |
| 260 | 3300005437 | Ga0070710_10308230 | Ga0070710_103082302 | 196 |
| 261 | 3300005439 | Ga0070711_100073773 | Ga0070711_1000737732 | 196 |
| 262 | 3300005535 | Ga0070684_100006986 | Ga0070684_1000069863 | 196 |
| 263 | 3300005548 | Ga0070665_100515810 | Ga0070665_1005158102 | 196 |
| 264 | 3300005618 | Ga0068864_100775414 | Ga0068864_1007754141 | 196 |
| 265 | 3300005841 | Ga0068863_100100958 | Ga0068863_1001009583 | 196 |
| 266 | 3300005842 | Ga0068858_101187163 | Ga0068858_1011871631 | 196 |
| 267 | 3300006173 | Ga0070716_100035194 | Ga0070716_1000351943 | 196 |
| 268 | 3300006173 | Ga0070716_100222453 | Ga0070716_1002224532 | 196 |
| 269 | 3300006175 | Ga0070712_100081286 | Ga0070712_1000812863 | 196 |
| 270 | 3300006175 | Ga0070712_100546753 | Ga0070712_1005467531 | 196 |
| 271 | 3300009098 | Ga0105245_10331270 | Ga0105245_103312702 | 196 |
| 272 | 3300009177 | Ga0105248_10148064 | Ga0105248_101480643 | 196 |
| 273 | 3300009177 | Ga0105248_10310607 | Ga0105248_103106071 | 196 |
| 274 | 3300009177 | Ga0105248_10335364 | Ga0105248_103353643 | 196 |
| 275 | 3300009545 | Ga0105237_10015526 | Ga0105237_100155264 | 196 |
| 276 | 3300009545 | Ga0105237_10891073 | Ga0105237_108910731 | 196 |
| 277 | 3300009551 | Ga0105238_10558339 | Ga0105238_105583392 | 196 |
| 278 | 3300010375 | Ga0105239_10044777 | Ga0105239_100447773 | 196 |
| 279 | 3300011119 | Ga0105246_10550236 | Ga0105246_105502362 | 196 |
| 280 | 3300013296 | Ga0157374_10072789 | Ga0157374_100727894 | 196 |
| 281 | 3300013306 | Ga0163162_10547556 | Ga0163162_105475563 | 196 |
| 282 | 3300013306 | Ga0163162_11967925 | Ga0163162_119679251 | 196 |
| 283 | 3300013308 | Ga0157375_10939265 | Ga0157375_109392651 | 196 |
| 284 | 3300014325 | Ga0163163_10009479 | Ga0163163_100094796 | 196 |
| 285 | 3300014325 | Ga0163163_10009809 | Ga0163163_100098092 | 196 |
| 286 | 3300014325 | Ga0163163_10117975 | Ga0163163_101179752 | 196 |
| 287 | 3300014325 | Ga0163163_10420359 | Ga0163163_104203592 | 196 |
| 288 | 3300014969 | Ga0157376_10005005 | Ga0157376_100050052 | 196 |
| 289 | 3300017792 | Ga0163161_10183483 | Ga0163161_101834833 | 196 |
| 290 | 3300025898 | Ga0207692_10369624 | Ga0207692_103696242 | 196 |
| 291 | 3300025913 | Ga0207695_10004010 | Ga0207695_1000401014 | 196 |
| 292 | 3300025914 | Ga0207671_10044854 | Ga0207671_100448541 | 196 |
| 293 | 3300025915 | Ga0207693_10026362 | Ga0207693_100263624 | 196 |
| 294 | 3300025916 | Ga0207663_10370320 | Ga0207663_103703201 | 196 |
| 295 | 3300025924 | Ga0207694_10883105 | Ga0207694_108831051 | 196 |
| 296 | 3300025936 | Ga0207670_10269899 | Ga0207670_102698991 | 196 |
| 297 | 3300025941 | Ga0207711_10066861 | Ga0207711_100668612 | 196 |
| 298 | 3300025941 | Ga0207711_10095749 | Ga0207711_100957493 | 196 |
| 299 | 3300025941 | Ga0207711_10345001 | Ga0207711_103450012 | 196 |
| 300 | 3300025941 | Ga0207711_10712585 | Ga0207711_107125852 | 196 |
| 301 | 3300025942 | Ga0207689_10280422 | Ga0207689_102804222 | 196 |
| 302 | 3300025944 | Ga0207661_10689291 | Ga0207661_106892912 | 196 |
| 303 | 3300025986 | Ga0207658_10591554 | Ga0207658_105915542 | 196 |
| 304 | 3300026023 | Ga0207677_10177066 | Ga0207677_101770662 | 196 |
| 305 | 3300026035 | Ga0207703_10768259 | Ga0207703_107682592 | 196 |
| 306 | 3300026088 | Ga0207641_10082261 | Ga0207641_100822613 | 196 |
| 307 | 3300031344 | Ga0265316_10140022 | Ga0265316_101400221 | 196 |
| 308 | 3300031344 | Ga0265316_10249817 | Ga0265316_102498172 | 196 |
| 309 | 3300031548 | Ga0307408_100152076 | Ga0307408_1001520762 | 196 |
| 310 | 3300031731 | Ga0307405_10013056 | Ga0307405_100130563 | 196 |
| 311 | 3300031824 | Ga0307413_10093964 | Ga0307413_100939642 | 196 |
| 312 | 3300031852 | Ga0307410_10011350 | Ga0307410_100113503 | 196 |
| 313 | 3300031852 | Ga0307410_10019394 | Ga0307410_100193942 | 196 |
| 314 | 3300031901 | Ga0307406_10015404 | Ga0307406_100154043 | 196 |
| 315 | 3300031903 | Ga0307407_10116037 | Ga0307407_101160373 | 196 |
| 316 | 3300031903 | Ga0307407_10263805 | Ga0307407_102638051 | 196 |
| 317 | 3300031911 | Ga0307412_10353244 | Ga0307412_103532442 | 196 |
| 318 | 3300031995 | Ga0307409_100078288 | Ga0307409_1000782883 | 196 |
| 319 | 3300031995 | Ga0307409_100752564 | Ga0307409_1007525642 | 196 |
| 320 | 3300032002 | Ga0307416_100060990 | Ga0307416_1000609903 | 196 |
| 321 | 3300032002 | Ga0307416_100122663 | Ga0307416_1001226633 | 196 |
| 322 | 3300032005 | Ga0307411_10047205 | Ga0307411_100472052 | 196 |
| 323 | 3300032005 | Ga0307411_10152033 | Ga0307411_101520333 | 196 |
| 324 | 3300032126 | Ga0307415_100029680 | Ga0307415_1000296803 | 196 |
| 325 | 3300035695 | Ga0373927_0218593 | Ga0373927_0218593_477_1067 | 196 |
| 326 | 3300036401 | Ga0373937_0321289 | Ga0373937_0321289_25_615 | 196 |
| 327 | 3300037068 | Ga0373925_0293846 | Ga0373925_0293846_628_1218 | 196 |
| 328 | 3300037471 | Ga0395905_0996523 | Ga0395905_0996523_49_642 | 196 |
| 329 | 3300039453 | Ga0436362_0417381 | Ga0436362_0417381_23_616 | 196 |
| 330 | 3300045051 | Ga0451576_0390582 | Ga0451576_0390582_644_1243 | 196 |
| 331 | 3300046472 | Ga0495580_0109097 | Ga0495580_0109097_1076_1666 | 196 |
| 332 | 3300046472 | Ga0495580_0337045 | Ga0495580_0337045_102_719 | 196 |
| 333 | 3300046516 | Ga0495628_0238957 | Ga0495628_0238957_234_851 | 196 |
| 334 | 3300046543 | Ga0495645_0048164 | Ga0495645_0048164_81_698 | 196 |
| 335 | 3300046543 | Ga0495645_0217162 | Ga0495645_0217162_226_822 | 196 |
| 336 | 3300046559 | Ga0495667_0504123 | Ga0495667_0504123_114_710 | 196 |
| 337 | 3300046663 | Ga0495635_0083069 | Ga0495635_0083069_1356_1952 | 196 |
| 338 | 3300046679 | Ga0495623_0209966 | Ga0495623_0209966_21_617 | 196 |
| 339 | 3300047444 | Ga0495675_0340738 | Ga0495675_0340738_183_779 | 196 |
| 340 | 3300048088 | Ga0495602_0135022 | Ga0495602_0135022_622_1218 | 196 |
| 341 | 3300048905 | Ga0496102_0043668 | Ga0496102_0043668_1218_1808 | 196 |
| 342 | 3300048918 | Ga0496115_0669528 | Ga0496115_0669528_70_666 | 196 |
| 343 | 3300049519 | Ga0501296_009665 | Ga0501296_009665_81_680 | 196 |
| 344 | 3300049521 | Ga0501298_005780 | Ga0501298_005780_112_711 | 196 |
| 345 | 3300049585 | Ga0501069_0129243 | Ga0501069_0129243_685_1275 | 196 |
| 346 | 3300049686 | Ga0501257_028974 | Ga0501257_028974_178_777 | 196 |
| 347 | 3300005329 | Ga0070683_100172502 | Ga0070683_1001725022 | 197 |
| 348 | 3300005336 | Ga0070680_100044909 | Ga0070680_1000449093 | 197 |
| 349 | 3300005344 | Ga0070661_100300620 | Ga0070661_1003006201 | 197 |
| 350 | 3300005434 | Ga0070709_10002941 | Ga0070709_100029418 | 197 |
| 351 | 3300005435 | Ga0070714_100015780 | Ga0070714_1000157807 | 197 |
| 352 | 3300005435 | Ga0070714_100153943 | Ga0070714_1001539432 | 197 |
| 353 | 3300005436 | Ga0070713_100000134 | Ga0070713_10000013416 | 197 |
| 354 | 3300005436 | Ga0070713_100160653 | Ga0070713_1001606532 | 197 |
| 355 | 3300005436 | Ga0070713_100251471 | Ga0070713_1002514712 | 197 |
| 356 | 3300005436 | Ga0070713_100489836 | Ga0070713_1004898361 | 197 |
| 357 | 3300005437 | Ga0070710_10008950 | Ga0070710_100089504 | 197 |
| 358 | 3300005437 | Ga0070710_10049876 | Ga0070710_100498763 | 197 |
| 359 | 3300005437 | Ga0070710_10300764 | Ga0070710_103007642 | 197 |
| 360 | 3300005439 | Ga0070711_100000271 | Ga0070711_1000002717 | 197 |
| 361 | 3300005439 | Ga0070711_100045473 | Ga0070711_1000454734 | 197 |
| 362 | 3300005439 | Ga0070711_100056293 | Ga0070711_1000562933 | 197 |
| 363 | 3300005439 | Ga0070711_100101616 | Ga0070711_1001016162 | 197 |
| 364 | 3300005457 | Ga0070662_100265422 | Ga0070662_1002654224 | 197 |
| 365 | 3300005458 | Ga0070681_10003858 | Ga0070681_100038587 | 197 |
| 366 | 3300005458 | Ga0070681_10120493 | Ga0070681_101204934 | 197 |
| 367 | 3300005468 | Ga0070707_100098525 | Ga0070707_1000985252 | 197 |
| 368 | 3300005471 | Ga0070698_101075734 | Ga0070698_1010757341 | 197 |
| 369 | 3300005530 | Ga0070679_100006572 | Ga0070679_1000065724 | 197 |
| 370 | 3300005530 | Ga0070679_100865629 | Ga0070679_1008656292 | 197 |
| 371 | 3300005535 | Ga0070684_100090646 | Ga0070684_1000906462 | 197 |
| 372 | 3300005563 | Ga0068855_100039804 | Ga0068855_1000398044 | 197 |
| 373 | 3300005577 | Ga0068857_100008251 | Ga0068857_1000082513 | 197 |
| 374 | 3300005614 | Ga0068856_100278065 | Ga0068856_1002780652 | 197 |
| 375 | 3300005614 | Ga0068856_100469825 | Ga0068856_1004698251 | 197 |
| 376 | 3300005616 | Ga0068852_100176071 | Ga0068852_1001760712 | 197 |
| 377 | 3300005618 | Ga0068864_100061650 | Ga0068864_1000616503 | 197 |
| 378 | 3300005841 | Ga0068863_100018704 | Ga0068863_1000187045 | 197 |
| 379 | 3300006028 | Ga0070717_10001624 | Ga0070717_1000162410 | 197 |
| 380 | 3300006028 | Ga0070717_10015703 | Ga0070717_100157035 | 197 |
| 381 | 3300006028 | Ga0070717_10120618 | Ga0070717_101206183 | 197 |
| 382 | 3300006028 | Ga0070717_10187222 | Ga0070717_101872221 | 197 |
| 383 | 3300006163 | Ga0070715_10001203 | Ga0070715_100012038 | 197 |
| 384 | 3300006173 | Ga0070716_100000113 | Ga0070716_1000001135 | 197 |
| 385 | 3300006173 | Ga0070716_100006183 | Ga0070716_1000061837 | 197 |
| 386 | 3300006173 | Ga0070716_100095885 | Ga0070716_1000958852 | 197 |
| 387 | 3300006175 | Ga0070712_100000262 | Ga0070712_1000002628 | 197 |
| 388 | 3300006175 | Ga0070712_100004634 | Ga0070712_1000046346 | 197 |
| 389 | 3300006175 | Ga0070712_100037406 | Ga0070712_1000374064 | 197 |
| 390 | 3300006175 | Ga0070712_100578286 | Ga0070712_1005782861 | 197 |
| 391 | 3300006852 | Ga0075433_10110820 | Ga0075433_101108202 | 197 |
| 392 | 3300006871 | Ga0075434_100004984 | Ga0075434_10000498411 | 197 |
| 393 | 3300007076 | Ga0075435_100191727 | Ga0075435_1001917271 | 197 |
| 394 | 3300009177 | Ga0105248_10261816 | Ga0105248_102618163 | 197 |
| 395 | 3300009551 | Ga0105238_11158071 | Ga0105238_111580711 | 197 |
| 396 | 3300010375 | Ga0105239_10051978 | Ga0105239_100519782 | 197 |
| 397 | 3300011119 | Ga0105246_10640643 | Ga0105246_106406431 | 197 |
| 398 | 3300013105 | Ga0157369_10000299 | Ga0157369_1000029964 | 197 |
| 399 | 3300013105 | Ga0157369_10213168 | Ga0157369_102131682 | 197 |
| 400 | 3300013296 | Ga0157374_10064262 | Ga0157374_100642623 | 197 |
| 401 | 3300013306 | Ga0163162_11870365 | Ga0163162_118703651 | 197 |
| 402 | 3300014325 | Ga0163163_10002018 | Ga0163163_100020188 | 197 |
| 403 | 3300014325 | Ga0163163_10051413 | Ga0163163_100514132 | 197 |
| 404 | 3300014325 | Ga0163163_10211496 | Ga0163163_102114962 | 197 |
| 405 | 3300014969 | Ga0157376_10178505 | Ga0157376_101785053 | 197 |
| 406 | 3300014969 | Ga0157376_10515535 | Ga0157376_105155351 | 197 |
| 407 | 3300025898 | Ga0207692_10003745 | Ga0207692_100037455 | 197 |
| 408 | 3300025898 | Ga0207692_10099109 | Ga0207692_100991093 | 197 |
| 409 | 3300025898 | Ga0207692_10259032 | Ga0207692_102590322 | 197 |
| 410 | 3300025898 | Ga0207692_10288523 | Ga0207692_102885231 | 197 |
| 411 | 3300025905 | Ga0207685_10000745 | Ga0207685_100007457 | 197 |
| 412 | 3300025906 | Ga0207699_10006400 | Ga0207699_100064005 | 197 |
| 413 | 3300025906 | Ga0207699_10042939 | Ga0207699_100429391 | 197 |
| 414 | 3300025906 | Ga0207699_10047965 | Ga0207699_100479652 | 197 |
| 415 | 3300025906 | Ga0207699_10080297 | Ga0207699_100802972 | 197 |
| 416 | 3300025906 | Ga0207699_10481679 | Ga0207699_104816791 | 197 |
| 417 | 3300025906 | Ga0207699_10573046 | Ga0207699_105730461 | 197 |
| 418 | 3300025910 | Ga0207684_10024360 | Ga0207684_100243601 | 197 |
| 419 | 3300025912 | Ga0207707_10013290 | Ga0207707_100132904 | 197 |
| 420 | 3300025912 | Ga0207707_10449172 | Ga0207707_104491722 | 197 |
| 421 | 3300025915 | Ga0207693_10000275 | Ga0207693_1000027536 | 197 |
| 422 | 3300025915 | Ga0207693_10006920 | Ga0207693_100069206 | 197 |
| 423 | 3300025915 | Ga0207693_10007857 | Ga0207693_100078574 | 197 |
| 424 | 3300025915 | Ga0207693_10527289 | Ga0207693_105272891 | 197 |
| 425 | 3300025916 | Ga0207663_10015635 | Ga0207663_100156352 | 197 |
| 426 | 3300025916 | Ga0207663_10040443 | Ga0207663_100404433 | 197 |
| 427 | 3300025921 | Ga0207652_10009354 | Ga0207652_100093544 | 197 |
| 428 | 3300025922 | Ga0207646_10167696 | Ga0207646_101676962 | 197 |
| 429 | 3300025928 | Ga0207700_10125356 | Ga0207700_101253563 | 197 |
| 430 | 3300025928 | Ga0207700_10147366 | Ga0207700_101473662 | 197 |
| 431 | 3300025928 | Ga0207700_10187400 | Ga0207700_101874002 | 197 |
| 432 | 3300025929 | Ga0207664_10000087 | Ga0207664_1000008745 | 197 |
| 433 | 3300025929 | Ga0207664_10012370 | Ga0207664_100123703 | 197 |
| 434 | 3300025929 | Ga0207664_10019525 | Ga0207664_100195255 | 197 |
| 435 | 3300025929 | Ga0207664_10251116 | Ga0207664_102511161 | 197 |
| 436 | 3300025939 | Ga0207665_10000378 | Ga0207665_100003785 | 197 |
| 437 | 3300025939 | Ga0207665_10116978 | Ga0207665_101169782 | 197 |
| 438 | 3300025944 | Ga0207661_10170580 | Ga0207661_101705802 | 197 |
| 439 | 3300025949 | Ga0207667_10066114 | Ga0207667_100661143 | 197 |
| 440 | 3300026088 | Ga0207641_10112273 | Ga0207641_101122733 | 197 |
| 441 | 3300026095 | Ga0207676_10642436 | Ga0207676_106424362 | 197 |
| 442 | 3300026116 | Ga0207674_10010225 | Ga0207674_100102254 | 197 |
| 443 | 3300026116 | Ga0207674_10026353 | Ga0207674_100263533 | 197 |
| 444 | 3300028800 | Ga0265338_10003313 | Ga0265338_100033139 | 197 |
| 445 | 3300028800 | Ga0265338_10011557 | Ga0265338_100115573 | 197 |
| 446 | 3300028800 | Ga0265338_10084846 | Ga0265338_100848462 | 197 |
| 447 | 3300028800 | Ga0265338_10200839 | Ga0265338_102008392 | 197 |
| 448 | 3300028800 | Ga0265338_10219890 | Ga0265338_102198903 | 197 |
| 449 | 3300031090 | Ga0265760_10063354 | Ga0265760_100633542 | 197 |
| 450 | 3300031235 | Ga0265330_10107147 | Ga0265330_101071472 | 197 |
| 451 | 3300031238 | Ga0265332_10011313 | Ga0265332_100113132 | 197 |
| 452 | 3300031238 | Ga0265332_10052063 | Ga0265332_100520632 | 197 |
| 453 | 3300031239 | Ga0265328_10019249 | Ga0265328_100192493 | 197 |
| 454 | 3300031239 | Ga0265328_10071933 | Ga0265328_100719332 | 197 |
| 455 | 3300031241 | Ga0265325_10008405 | Ga0265325_100084052 | 197 |
| 456 | 3300031241 | Ga0265325_10044574 | Ga0265325_100445742 | 197 |
| 457 | 3300031241 | Ga0265325_10337724 | Ga0265325_103377241 | 197 |
| 458 | 3300031247 | Ga0265340_10011576 | Ga0265340_100115764 | 197 |
| 459 | 3300031247 | Ga0265340_10039410 | Ga0265340_100394103 | 197 |
| 460 | 3300031247 | Ga0265340_10042480 | Ga0265340_100424802 | 197 |
| 461 | 3300031247 | Ga0265340_10091526 | Ga0265340_100915262 | 197 |
| 462 | 3300031249 | Ga0265339_10015513 | Ga0265339_100155132 | 197 |
| 463 | 3300031249 | Ga0265339_10075737 | Ga0265339_100757372 | 197 |
| 464 | 3300031249 | Ga0265339_10128431 | Ga0265339_101284312 | 197 |
| 465 | 3300031250 | Ga0265331_10043370 | Ga0265331_100433703 | 197 |
| 466 | 3300031250 | Ga0265331_10185008 | Ga0265331_101850082 | 197 |
| 467 | 3300031251 | Ga0265327_10029065 | Ga0265327_100290653 | 197 |
| 468 | 3300031344 | Ga0265316_10011708 | Ga0265316_100117086 | 197 |
| 469 | 3300031344 | Ga0265316_10013616 | Ga0265316_100136168 | 197 |
| 470 | 3300031344 | Ga0265316_10045745 | Ga0265316_100457452 | 197 |
| 471 | 3300031344 | Ga0265316_10091718 | Ga0265316_100917182 | 197 |
| 472 | 3300031344 | Ga0265316_10096204 | Ga0265316_100962042 | 197 |
| 473 | 3300031344 | Ga0265316_10109120 | Ga0265316_101091203 | 197 |
| 474 | 3300031344 | Ga0265316_10144278 | Ga0265316_101442781 | 197 |
| 475 | 3300031595 | Ga0265313_10029444 | Ga0265313_100294441 | 197 |
| 476 | 3300031712 | Ga0265342_10062190 | Ga0265342_100621902 | 197 |
| 477 | 3300031712 | Ga0265342_10130283 | Ga0265342_101302832 | 197 |
| 478 | 3300031712 | Ga0265342_10186218 | Ga0265342_101862182 | 197 |
| 479 | 3300035083 | Ga0373926_0067130 | Ga0373926_0067130_341_934 | 197 |
| 480 | 3300035086 | Ga0373934_0108509 | Ga0373934_0108509_302_895 | 197 |
| 481 | 3300035111 | Ga0373923_0024164 | Ga0373923_0024164_244_837 | 197 |
| 482 | 3300035113 | Ga0373936_0019394 | Ga0373936_0019394_1076_1669 | 197 |
| 483 | 3300035113 | Ga0373936_0035469 | Ga0373936_0035469_1258_1851 | 197 |
| 484 | 3300035116 | Ga0373945_0008745 | Ga0373945_0008745_41_634 | 197 |
| 485 | 3300035116 | Ga0373945_0009368 | Ga0373945_0009368_1011_1604 | 197 |
| 486 | 3300035117 | Ga0373953_0127369 | Ga0373953_0127369_10_603 | 197 |
| 487 | 3300035120 | Ga0373957_0112755 | Ga0373957_0112755_163_756 | 197 |
| 488 | 3300035170 | Ga0373943_0001626 | Ga0373943_0001626_7252_7845 | 197 |
| 489 | 3300035171 | Ga0373946_0007422 | Ga0373946_0007422_2862_3455 | 197 |
| 490 | 3300035172 | Ga0373955_0007025 | Ga0373955_0007025_3837_4430 | 197 |
| 491 | 3300035410 | Ga0373924_0060056 | Ga0373924_0060056_939_1532 | 197 |
| 492 | 3300035692 | Ga0373935_0005817 | Ga0373935_0005817_5049_5642 | 197 |
| 493 | 3300035692 | Ga0373935_0177769 | Ga0373935_0177769_337_957 | 197 |
| 494 | 3300035695 | Ga0373927_0005658 | Ga0373927_0005658_4203_4796 | 197 |
| 495 | 3300035695 | Ga0373927_0510111 | Ga0373927_0510111_24_617 | 197 |
| 496 | 3300035724 | Ga0373933_0058022 | Ga0373933_0058022_586_1179 | 197 |
| 497 | 3300035724 | Ga0373933_0074113 | Ga0373933_0074113_276_869 | 197 |
| 498 | 3300035724 | Ga0373933_0347727 | Ga0373933_0347727_74_667 | 197 |
| 499 | 3300035725 | Ga0373947_0005213 | Ga0373947_0005213_2048_2641 | 197 |
| 500 | 3300035725 | Ga0373947_0033579 | Ga0373947_0033579_478_1071 | 197 |
| 501 | 3300035725 | Ga0373947_0091948 | Ga0373947_0091948_634_1254 | 197 |
| 502 | 3300035725 | Ga0373947_0612340 | Ga0373947_0612340_32_631 | 197 |
| 503 | 3300036401 | Ga0373937_0891447 | Ga0373937_0891447_115_708 | 197 |
| 504 | 3300037068 | Ga0373925_0004658 | Ga0373925_0004658_2346_2939 | 197 |
| 505 | 3300037068 | Ga0373925_0129617 | Ga0373925_0129617_791_1384 | 197 |
| 506 | 3300037068 | Ga0373925_0478959 | Ga0373925_0478959_171_791 | 197 |
| 507 | 3300037068 | Ga0373925_0657610 | Ga0373925_0657610_229_822 | 197 |
| 508 | 3300039450 | Ga0436363_1670777 | Ga0436363_1670777_396_989 | 197 |
| 509 | 3300042876 | Ga0451577_0088529 | Ga0451577_0088529_2120_2719 | 197 |
| 510 | 3300042876 | Ga0451577_0231907 | Ga0451577_0231907_154_753 | 197 |
| 511 | 3300044694 | Ga0466963_0363900 | Ga0466963_0363900_242_838 | 197 |
| 512 | 3300044712 | Ga0453684_1352734 | Ga0453684_1352734_103_711 | 197 |
| 513 | 3300045051 | Ga0451576_0014682 | Ga0451576_0014682_2470_3069 | 197 |
| 514 | 3300045051 | Ga0451576_0913402 | Ga0451576_0913402_216_815 | 197 |
| 515 | 3300045051 | Ga0451576_1576639 | Ga0451576_1576639_64_660 | 197 |
| 516 | 3300046459 | Ga0495629_0530594 | Ga0495629_0530594_122_715 | 197 |
| 517 | 3300046472 | Ga0495580_0001289 | Ga0495580_0001289_17336_17929 | 197 |
| 518 | 3300046472 | Ga0495580_0001629 | Ga0495580_0001629_7487_8086 | 197 |
| 519 | 3300046472 | Ga0495580_0001942 | Ga0495580_0001942_3027_3626 | 197 |
| 520 | 3300046472 | Ga0495580_0002140 | Ga0495580_0002140_2825_3418 | 197 |
| 521 | 3300046472 | Ga0495580_0022575 | Ga0495580_0022575_2182_2784 | 197 |
| 522 | 3300046473 | Ga0495582_0002195 | Ga0495582_0002195_10252_10845 | 197 |
| 523 | 3300046477 | Ga0495664_0197227 | Ga0495664_0197227_240_860 | 197 |
| 524 | 3300046491 | Ga0495584_0359412 | Ga0495584_0359412_118_717 | 197 |
| 525 | 3300046516 | Ga0495628_0291006 | Ga0495628_0291006_401_1021 | 197 |
| 526 | 3300046517 | Ga0495630_0159613 | Ga0495630_0159613_334_927 | 197 |
| 527 | 3300046526 | Ga0495666_0296234 | Ga0495666_0296234_125_718 | 197 |
| 528 | 3300046531 | Ga0495665_0086863 | Ga0495665_0086863_889_1482 | 197 |
| 529 | 3300046531 | Ga0495665_0130241 | Ga0495665_0130241_459_1067 | 197 |
| 530 | 3300046533 | Ga0495640_0120533 | Ga0495640_0120533_968_1588 | 197 |
| 531 | 3300046535 | Ga0495586_0336996 | Ga0495586_0336996_19_639 | 197 |
| 532 | 3300046678 | Ga0495599_0313790 | Ga0495599_0313790_292_912 | 197 |
| 533 | 3300046679 | Ga0495623_0225280 | Ga0495623_0225280_139_759 | 197 |
| 534 | 3300046683 | Ga0495658_0020496 | Ga0495658_0020496_760_1353 | 197 |
| 535 | 3300046684 | Ga0495669_0071717 | Ga0495669_0071717_638_1231 | 197 |
| 536 | 3300046689 | Ga0495613_0091852 | Ga0495613_0091852_1449_2042 | 197 |
| 537 | 3300046690 | Ga0495624_0317867 | Ga0495624_0317867_177_770 | 197 |
| 538 | 3300047317 | Ga0495604_0581456 | Ga0495604_0581456_88_681 | 197 |
| 539 | 3300047319 | Ga0495674_0053954 | Ga0495674_0053954_1572_2165 | 197 |
| 540 | 3300047319 | Ga0495674_0077571 | Ga0495674_0077571_863_1456 | 197 |
| 541 | 3300047321 | Ga0495676_0531589 | Ga0495676_0531589_94_687 | 197 |
| 542 | 3300047471 | Ga0495684_0454842 | Ga0495684_0454842_195_815 | 197 |
| 543 | 3300047471 | Ga0495684_0518357 | Ga0495684_0518357_175_768 | 197 |
| 544 | 3300047673 | Ga0495593_0219838 | Ga0495593_0219838_230_823 | 197 |
| 545 | 3300048088 | Ga0495602_0054542 | Ga0495602_0054542_245_865 | 197 |
| 546 | 3300048907 | Ga0496104_0050964 | Ga0496104_0050964_2445_3038 | 197 |
| 547 | 3300048908 | Ga0496105_0471417 | Ga0496105_0471417_282_875 | 197 |
| 548 | 3300048911 | Ga0496108_0810520 | Ga0496108_0810520_60_668 | 197 |
| 549 | 3300048913 | Ga0496110_0894563 | Ga0496110_0894563_64_672 | 197 |
| 550 | 3300048915 | Ga0496112_0074774 | Ga0496112_0074774_244_852 | 197 |
| 551 | 3300048915 | Ga0496112_0487958 | Ga0496112_0487958_508_1104 | 197 |
| 552 | 3300048918 | Ga0496115_0003194 | Ga0496115_0003194_9923_10516 | 197 |
| 553 | 3300050512 | nmdc:mga0n895_3653_c1 | nmdc:mga0n895_3653_c1_2845_3444 | 197 |
| 554 | 3300050513 | nmdc:mga0rr50_197673_c1 | nmdc:mga0rr50_197673_c1_975_1574 | 197 |
| 555 | 3300050514 | nmdc:mga08x19_9468_c1 | nmdc:mga08x19_9468_c1_782_1381 | 197 |
| 556 | 3300050515 | nmdc:mga0a205_56054_c1 | nmdc:mga0a205_56054_c1_2864_3463 | 197 |
| 557 | 3300053077 | Ga0495601_0102137 | Ga0495601_0102137_1114_1707 | 197 |
| 558 | 3300053085 | Ga0495619_0395395 | Ga0495619_0395395_286_894 | 197 |
| 559 | 3300005436 | Ga0070713_100989354 | Ga0070713_1009893541 | 198 |
| 560 | 3300005437 | Ga0070710_10002183 | Ga0070710_100021835 | 198 |
| 561 | 3300025898 | Ga0207692_10001607 | Ga0207692_100016075 | 198 |
| 562 | 3300025910 | Ga0207684_10171974 | Ga0207684_101719742 | 198 |
| 563 | 3300025922 | Ga0207646_10115834 | Ga0207646_101158342 | 198 |
| 564 | 3300028036 | Ga0265355_1000430 | Ga0265355_10004302 | 198 |
| 565 | 3300030878 | Ga0265770_1010399 | Ga0265770_10103992 | 198 |
| 566 | 3300030879 | Ga0265765_1002649 | Ga0265765_10026492 | 198 |
| 567 | 3300030879 | Ga0265765_1016532 | Ga0265765_10165322 | 198 |
| 568 | 3300031090 | Ga0265760_10007781 | Ga0265760_100077812 | 198 |
| 569 | 3300031090 | Ga0265760_10024863 | Ga0265760_100248632 | 198 |
| 570 | 3300031247 | Ga0265340_10059053 | Ga0265340_100590532 | 198 |
| 571 | 3300031711 | Ga0265314_10005392 | Ga0265314_100053926 | 198 |
| 572 | 3300031711 | Ga0265314_10039432 | Ga0265314_100394322 | 198 |
| 573 | 3300045051 | Ga0451576_0343409 | Ga0451576_0343409_586_1188 | 198 |
| 574 | 3300046678 | Ga0495599_0272622 | Ga0495599_0272622_382_987 | 198 |
| 575 | 3300046679 | Ga0495623_0224364 | Ga0495623_0224364_186_791 | 198 |
| 576 | 3300048088 | Ga0495602_0147010 | Ga0495602_0147010_131_736 | 198 |
| 577 | 3300048088 | Ga0495602_0403179 | Ga0495602_0403179_358_954 | 198 |
| 578 | 2162886012 | MBSR1b_contig_1198449 | MBSR1b_0011.00005160 | 199 |
| 579 | 2162886012 | MBSR1b_contig_8674379 | MBSR1b_0863.00007130 | 199 |
| 580 | 2162886012 | MBSR1b_contig_9766659 | MBSR1b_0152.00000170 | 199 |
| 581 | 3300001976 | JGI24752J21851_1006675 | JGI24752J21851_10066752 | 199 |
| 582 | 3300001978 | JGI24747J21853_1000701 | JGI24747J21853_10007012 | 199 |
| 583 | 3300001991 | JGI24743J22301_10005717 | JGI24743J22301_100057172 | 199 |
| 584 | 3300002076 | JGI24749J21850_1007403 | JGI24749J21850_10074031 | 199 |
| 585 | 3300002239 | JGI24034J26672_10001382 | JGI24034J26672_100013824 | 199 |
| 586 | 3300002239 | JGI24034J26672_10001383 | JGI24034J26672_100013833 | 199 |
| 587 | 3300002459 | JGI24751J29686_10000869 | JGI24751J29686_100008696 | 199 |
| 588 | 3300005290 | Ga0065712_10075947 | Ga0065712_100759474 | 199 |
| 589 | 3300005293 | Ga0065715_10003405 | Ga0065715_100034054 | 199 |
| 590 | 3300005327 | Ga0070658_10061915 | Ga0070658_100619153 | 199 |
| 591 | 3300005328 | Ga0070676_10004067 | Ga0070676_100040672 | 199 |
| 592 | 3300005329 | Ga0070683_100000533 | Ga0070683_10000053311 | 199 |
| 593 | 3300005331 | Ga0070670_100033379 | Ga0070670_1000333792 | 199 |
| 594 | 3300005331 | Ga0070670_100197815 | Ga0070670_1001978152 | 199 |
| 595 | 3300005333 | Ga0070677_10057274 | Ga0070677_100572742 | 199 |
| 596 | 3300005334 | Ga0068869_100153510 | Ga0068869_1001535102 | 199 |
| 597 | 3300005335 | Ga0070666_10043322 | Ga0070666_100433223 | 199 |
| 598 | 3300005337 | Ga0070682_100021004 | Ga0070682_1000210044 | 199 |
| 599 | 3300005338 | Ga0068868_100006775 | Ga0068868_1000067753 | 199 |
| 600 | 3300005338 | Ga0068868_100066103 | Ga0068868_1000661032 | 199 |
| 601 | 3300005339 | Ga0070660_100001060 | Ga0070660_1000010609 | 199 |
| 602 | 3300005340 | Ga0070689_100012831 | Ga0070689_1000128313 | 199 |
| 603 | 3300005343 | Ga0070687_100007584 | Ga0070687_1000075843 | 199 |
| 604 | 3300005344 | Ga0070661_100029564 | Ga0070661_1000295642 | 199 |
| 605 | 3300005347 | Ga0070668_100004691 | Ga0070668_10000469110 | 199 |
| 606 | 3300005353 | Ga0070669_100004930 | Ga0070669_1000049302 | 199 |
| 607 | 3300005354 | Ga0070675_100305514 | Ga0070675_1003055141 | 199 |
| 608 | 3300005355 | Ga0070671_100198234 | Ga0070671_1001982342 | 199 |
| 609 | 3300005355 | Ga0070671_100353968 | Ga0070671_1003539682 | 199 |
| 610 | 3300005356 | Ga0070674_100003936 | Ga0070674_1000039363 | 199 |
| 611 | 3300005365 | Ga0070688_100000378 | Ga0070688_1000003787 | 199 |
| 612 | 3300005366 | Ga0070659_100004918 | Ga0070659_1000049188 | 199 |
| 613 | 3300005438 | Ga0070701_10037568 | Ga0070701_100375682 | 199 |
| 614 | 3300005441 | Ga0070700_100187937 | Ga0070700_1001879371 | 199 |
| 615 | 3300005455 | Ga0070663_100005199 | Ga0070663_1000051996 | 199 |
| 616 | 3300005455 | Ga0070663_100648986 | Ga0070663_1006489862 | 199 |
| 617 | 3300005458 | Ga0070681_10831091 | Ga0070681_108310912 | 199 |
| 618 | 3300005535 | Ga0070684_100005118 | Ga0070684_1000051185 | 199 |
| 619 | 3300005539 | Ga0068853_100062588 | Ga0068853_1000625882 | 199 |
| 620 | 3300005543 | Ga0070672_100003124 | Ga0070672_1000031249 | 199 |
| 621 | 3300005544 | Ga0070686_100350177 | Ga0070686_1003501772 | 199 |
| 622 | 3300005548 | Ga0070665_100889235 | Ga0070665_1008892352 | 199 |
| 623 | 3300005563 | Ga0068855_100195131 | Ga0068855_1001951313 | 199 |
| 624 | 3300005564 | Ga0070664_100104340 | Ga0070664_1001043402 | 199 |
| 625 | 3300005577 | Ga0068857_100002432 | Ga0068857_10000243212 | 199 |
| 626 | 3300005614 | Ga0068856_100120944 | Ga0068856_1001209443 | 199 |
| 627 | 3300005617 | Ga0068859_100011366 | Ga0068859_1000113662 | 199 |
| 628 | 3300005618 | Ga0068864_100002059 | Ga0068864_1000020597 | 199 |
| 629 | 3300005718 | Ga0068866_10007446 | Ga0068866_100074463 | 199 |
| 630 | 3300005719 | Ga0068861_100155144 | Ga0068861_1001551442 | 199 |
| 631 | 3300005834 | Ga0068851_10008504 | Ga0068851_100085045 | 199 |
| 632 | 3300005841 | Ga0068863_100058413 | Ga0068863_1000584132 | 199 |
| 633 | 3300005841 | Ga0068863_100085129 | Ga0068863_1000851292 | 199 |
| 634 | 3300005842 | Ga0068858_100016136 | Ga0068858_1000161367 | 199 |
| 635 | 3300005843 | Ga0068860_100293184 | Ga0068860_1002931842 | 199 |
| 636 | 3300005844 | Ga0068862_100084677 | Ga0068862_1000846772 | 199 |
| 637 | 3300005844 | Ga0068862_100123710 | Ga0068862_1001237102 | 199 |
| 638 | 3300006358 | Ga0068871_100027596 | Ga0068871_1000275962 | 199 |
| 639 | 3300006881 | Ga0068865_100036139 | Ga0068865_1000361392 | 199 |
| 640 | 3300006931 | Ga0097620_100011366 | Ga0097620_1000113662 | 199 |
| 641 | 3300009092 | Ga0105250_10010971 | Ga0105250_100109715 | 199 |
| 642 | 3300009093 | Ga0105240_10026610 | Ga0105240_100266105 | 199 |
| 643 | 3300009098 | Ga0105245_10005901 | Ga0105245_100059013 | 199 |
| 644 | 3300009098 | Ga0105245_10012755 | Ga0105245_100127554 | 199 |
| 645 | 3300009101 | Ga0105247_10008845 | Ga0105247_100088455 | 199 |
| 646 | 3300009174 | Ga0105241_10007216 | Ga0105241_100072163 | 199 |
| 647 | 3300009177 | Ga0105248_10141947 | Ga0105248_101419473 | 199 |
| 648 | 3300009545 | Ga0105237_10079314 | Ga0105237_100793144 | 199 |
| 649 | 3300009553 | Ga0105249_10028800 | Ga0105249_100288004 | 199 |
| 650 | 3300009553 | Ga0105249_10041076 | Ga0105249_100410763 | 199 |
| 651 | 3300010375 | Ga0105239_10005687 | Ga0105239_1000568712 | 199 |
| 652 | 3300010375 | Ga0105239_10258807 | Ga0105239_102588073 | 199 |
| 653 | 3300011119 | Ga0105246_10016424 | Ga0105246_100164243 | 199 |
| 654 | 3300013104 | Ga0157370_10599761 | Ga0157370_105997612 | 199 |
| 655 | 3300013105 | Ga0157369_10012638 | Ga0157369_100126385 | 199 |
| 656 | 3300013297 | Ga0157378_10867282 | Ga0157378_108672822 | 199 |
| 657 | 3300013306 | Ga0163162_10022906 | Ga0163162_100229063 | 199 |
| 658 | 3300013307 | Ga0157372_10001242 | Ga0157372_1000124219 | 199 |
| 659 | 3300013307 | Ga0157372_10426129 | Ga0157372_104261292 | 199 |
| 660 | 3300013308 | Ga0157375_10087636 | Ga0157375_100876363 | 199 |
| 661 | 3300014325 | Ga0163163_10010446 | Ga0163163_100104462 | 199 |
| 662 | 3300014325 | Ga0163163_10031232 | Ga0163163_100312324 | 199 |
| 663 | 3300014326 | Ga0157380_10031994 | Ga0157380_100319943 | 199 |
| 664 | 3300014497 | Ga0182008_10022661 | Ga0182008_100226613 | 199 |
| 665 | 3300014745 | Ga0157377_10000323 | Ga0157377_100003235 | 199 |
| 666 | 3300014968 | Ga0157379_10003917 | Ga0157379_1000391711 | 199 |
| 667 | 3300014969 | Ga0157376_10241578 | Ga0157376_102415782 | 199 |
| 668 | 3300015261 | Ga0182006_1008649 | Ga0182006_10086493 | 199 |
| 669 | 3300015262 | Ga0182007_10019228 | Ga0182007_100192283 | 199 |
| 670 | 3300017792 | Ga0163161_10002760 | Ga0163161_100027603 | 199 |
| 671 | 3300025315 | Ga0207697_10002298 | Ga0207697_100022989 | 199 |
| 672 | 3300025321 | Ga0207656_10009745 | Ga0207656_100097452 | 199 |
| 673 | 3300025893 | Ga0207682_10053306 | Ga0207682_100533062 | 199 |
| 674 | 3300025899 | Ga0207642_10031650 | Ga0207642_100316502 | 199 |
| 675 | 3300025900 | Ga0207710_10041907 | Ga0207710_100419072 | 199 |
| 676 | 3300025901 | Ga0207688_10005486 | Ga0207688_100054865 | 199 |
| 677 | 3300025904 | Ga0207647_10000837 | Ga0207647_100008372 | 199 |
| 678 | 3300025907 | Ga0207645_10000020 | Ga0207645_1000002068 | 199 |
| 679 | 3300025908 | Ga0207643_10017059 | Ga0207643_100170594 | 199 |
| 680 | 3300025909 | Ga0207705_10062814 | Ga0207705_100628143 | 199 |
| 681 | 3300025912 | Ga0207707_10710463 | Ga0207707_107104632 | 199 |
| 682 | 3300025913 | Ga0207695_10162125 | Ga0207695_101621252 | 199 |
| 683 | 3300025914 | Ga0207671_10313845 | Ga0207671_103138452 | 199 |
| 684 | 3300025918 | Ga0207662_10000337 | Ga0207662_100003372 | 199 |
| 685 | 3300025919 | Ga0207657_10005925 | Ga0207657_100059254 | 199 |
| 686 | 3300025920 | Ga0207649_10000281 | Ga0207649_100002814 | 199 |
| 687 | 3300025921 | Ga0207652_10457705 | Ga0207652_104577051 | 199 |
| 688 | 3300025925 | Ga0207650_10000076 | Ga0207650_1000007697 | 199 |
| 689 | 3300025927 | Ga0207687_10008503 | Ga0207687_100085034 | 199 |
| 690 | 3300025929 | Ga0207664_10944598 | Ga0207664_109445981 | 199 |
| 691 | 3300025931 | Ga0207644_10019111 | Ga0207644_100191114 | 199 |
| 692 | 3300025931 | Ga0207644_10687880 | Ga0207644_106878802 | 199 |
| 693 | 3300025932 | Ga0207690_10084483 | Ga0207690_100844832 | 199 |
| 694 | 3300025933 | Ga0207706_10000684 | Ga0207706_100006849 | 199 |
| 695 | 3300025936 | Ga0207670_10023873 | Ga0207670_100238735 | 199 |
| 696 | 3300025937 | Ga0207669_10413638 | Ga0207669_104136382 | 199 |
| 697 | 3300025938 | Ga0207704_10197282 | Ga0207704_101972822 | 199 |
| 698 | 3300025940 | Ga0207691_10000533 | Ga0207691_1000053325 | 199 |
| 699 | 3300025941 | Ga0207711_10016329 | Ga0207711_100163295 | 199 |
| 700 | 3300025942 | Ga0207689_10000097 | Ga0207689_1000009764 | 199 |
| 701 | 3300025944 | Ga0207661_10000329 | Ga0207661_1000032916 | 199 |
| 702 | 3300025945 | Ga0207679_10000086 | Ga0207679_1000008667 | 199 |
| 703 | 3300025949 | Ga0207667_10424647 | Ga0207667_104246472 | 199 |
| 704 | 3300025960 | Ga0207651_10025675 | Ga0207651_100256752 | 199 |
| 705 | 3300025961 | Ga0207712_10380382 | Ga0207712_103803821 | 199 |
| 706 | 3300026023 | Ga0207677_10011159 | Ga0207677_100111596 | 199 |
| 707 | 3300026023 | Ga0207677_10062846 | Ga0207677_100628462 | 199 |
| 708 | 3300026035 | Ga0207703_10003138 | Ga0207703_100031389 | 199 |
| 709 | 3300026041 | Ga0207639_10292189 | Ga0207639_102921892 | 199 |
| 710 | 3300026067 | Ga0207678_10000092 | Ga0207678_1000009259 | 199 |
| 711 | 3300026067 | Ga0207678_10584931 | Ga0207678_105849312 | 199 |
| 712 | 3300026078 | Ga0207702_10074218 | Ga0207702_100742183 | 199 |
| 713 | 3300026088 | Ga0207641_10001986 | Ga0207641_100019864 | 199 |
| 714 | 3300026088 | Ga0207641_10030963 | Ga0207641_100309633 | 199 |
| 715 | 3300026089 | Ga0207648_10000027 | Ga0207648_1000002721 | 199 |
| 716 | 3300026095 | Ga0207676_10000301 | Ga0207676_100003018 | 199 |
| 717 | 3300026116 | Ga0207674_10002631 | Ga0207674_1000263112 | 199 |
| 718 | 3300026118 | Ga0207675_100207491 | Ga0207675_1002074912 | 199 |
| 719 | 3300026121 | Ga0207683_10001351 | Ga0207683_100013515 | 199 |
| 720 | 3300028379 | Ga0268266_10001514 | Ga0268266_100015145 | 199 |
| 721 | 3300028380 | Ga0268265_10081488 | Ga0268265_100814882 | 199 |
| 722 | 3300028380 | Ga0268265_10093670 | Ga0268265_100936702 | 199 |
| 723 | 3300028381 | Ga0268264_10023678 | Ga0268264_100236782 | 199 |
| 724 | 3300028381 | Ga0268264_10062355 | Ga0268264_100623552 | 199 |
| 725 | 3300048905 | Ga0496102_0877343 | Ga0496102_0877343_49_654 | 199 |
| 726 | 3300048915 | Ga0496112_0177422 | Ga0496112_0177422_824_1423 | 199 |
| 727 | 3300050513 | nmdc:mga0rr50_529409_c1 | nmdc:mga0rr50_529409_c1_153_758 | 199 |
| 728 | 3300050514 | nmdc:mga08x19_113661_c1 | nmdc:mga08x19_113661_c1_671_1276 | 199 |
| 729 | 3300050514 | nmdc:mga08x19_298406_c1 | nmdc:mga08x19_298406_c1_76_681 | 199 |
| 730 | 3300050514 | nmdc:mga08x19_347814_c1 | nmdc:mga08x19_347814_c1_235_840 | 199 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3on3-assembly2.cif.gz_A | the crystal structure of keto/oxoacid ferredoxin oxidoreductase, gamma subunit from geobacter sulfurreducens pca | 0.923 | 4 | 178 |
| 3on3-assembly3.cif.gz_B | the crystal structure of keto/oxoacid ferredoxin oxidoreductase, gamma subunit from geobacter sulfurreducens pca | 0.9159 | 1 | 180 |
| 3on3-assembly3.cif.gz_B | the crystal structure of keto/oxoacid ferredoxin oxidoreductase, gamma subunit from geobacter sulfurreducens pca | 0.9109 | 1 | 180 |
| 3on3-assembly2.cif.gz_A | the crystal structure of keto/oxoacid ferredoxin oxidoreductase, gamma subunit from geobacter sulfurreducens pca | 0.9072 | 4 | 178 |
| 3g2e-assembly1.cif.gz_D | structure of putative oorc subunit of 2-oxoglutarate:acceptor oxidoreductase from campylobacter jejuni | 0.9042 | 1 | 182 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3on3A00 | Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III | 0.9149 | 4 | 178 | 3.40.920.10 |
| 3on3A00 | Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III | 0.8992 | 4 | 178 | 3.40.920.10 |
| 3g2eC00 | Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III | 0.8964 | 3 | 182 | 3.40.920.10 |
| 3g2eC00 | Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III | 0.8872 | 3 | 182 | 3.40.920.10 |
| af_Q2FZ05_1_182_3.40.920.10 | Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III | 0.875 | 1 | 177 | 3.40.920.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C5HJL1-F1-model_v4 | Pyruvate ferredoxin oxidoreductase | 0.981 | 4 | 175 |
GO:0016903
|
| AF-A0A7V1ZHL4-F1-model_v4 | Pyruvate ferredoxin oxidoreductase | 0.9768 | 27 | 177 |
GO:0016903
|
| AF-A0A7C7R8G7-F1-model_v4 | deleted | 0.9756 | 4 | 177 |
|
| AF-A0A812ACJ7-F1-model_v4 | deleted | 0.9748 | 72 | 176 |
|
| AF-A0A7C0Y387-F1-model_v4 | Pyruvate ferredoxin oxidoreductase | 0.9736 | 1 | 177 |
GO:0016020
GO:0016903 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar