F477902

General Info

Members Datasets Scaffolds Average Seq Length
730 295 730 197

Family's Representative Sequence

Representative Sequence 3300001978|JGI24747J21853_1000701|JGI24747J21853_10007012
Length 227
Sequence MRLTEVRIAGFGGQGVILSAIVIGKAASIYQSAFATMTQNFGPEARGGACSAQLXLSXAPILYPYVTQPDIMIAMSQEAYGKFIHELKDGGVLIVEQDLVRVTDVPHEIRVYSVPATRLAEQLGKRMVLNIVMVGFFTAVTKLLDPDAMRNAVAESVPAHFRELNVKAFDVGYEYGLAAKPVASQNSEIEQEQVLYSQGVVRAIALQQAHSHSMFLLTVPLPPPTGQ

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
103 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
104 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
170 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
174 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
175 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
176 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
177 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
178 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
179 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
180 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
181 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
184 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
185 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
186 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
187 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
200 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
201 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
204 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
205 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
206 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
207 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
208 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
209 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
212 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
213 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
218 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
219 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
220 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
221 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
224 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
225 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
226 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
227 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
228 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
229 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
230 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
231 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
232 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
233 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
234 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
235 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
236 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
237 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
238 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
239 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
240 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
241 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
242 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
243 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
244 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
245 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
246 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
247 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
248 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
249 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
250 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
251 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
252 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
253 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
254 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
255 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
256 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
257 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
258 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
259 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
260 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
269 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
270 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
274 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
275 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
276 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
283 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
284 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
285 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
286 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
287 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
288 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
289 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
290 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
291 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
292 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
293 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
294 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
295 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.04
Metatranscriptomes 0.96
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.38
Rhizosphere 95.21
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_1198449 2162886012 Bacteria 1256
2 MBSR1b_contig_8674379 2162886012 Bacteria 3447
3 MBSR1b_contig_9766659 2162886012 Bacteria 1254
4 JGI24752J21851_1006675 3300001976 Unclassified 1509
5 JGI24747J21853_1000701 3300001978 Bacteria 2226
6 JGI24743J22301_10005717 3300001991 Bacteria 2087
7 JGI24749J21850_1007403 3300002076 Bacteria 1528
8 JGI24034J26672_10001382 3300002239 Bacteria 3213
9 JGI24034J26672_10001383 3300002239 Bacteria 3211
10 JGI24751J29686_10000869 3300002459 Bacteria 6909
11 Ga0065712_10075947 3300005290 Bacteria 3759
12 Ga0065715_10003405 3300005293 Bacteria 5479
13 Ga0070658_10061915 3300005327 Bacteria 3049
14 Ga0070676_10004067 3300005328 Bacteria 7686
15 Ga0070676_10064385 3300005328 Archaea 2186
16 Ga0070683_100000026 3300005329 Bacteria 172308
17 Ga0070683_100000533 3300005329 Bacteria 26823
18 Ga0070683_100172155 3300005329 Bacteria 2055
19 Ga0070683_100172502 3300005329 Bacteria 2053
20 Ga0070670_100033379 3300005331 Bacteria 4432
21 Ga0070670_100197815 3300005331 Unclassified 1746
22 Ga0070677_10057274 3300005333 Bacteria 1596
23 Ga0068869_100153510 3300005334 Bacteria 1787
24 Ga0068869_100663966 3300005334 Bacteria 886
25 Ga0070666_10043322 3300005335 Bacteria 3013
26 Ga0070666_10187314 3300005335 Unclassified 1453
27 Ga0070680_100044909 3300005336 Bacteria 3591
28 Ga0070680_100279279 3300005336 Unclassified 1415
29 Ga0070682_100021004 3300005337 Bacteria 3848
30 Ga0070682_100393570 3300005337 Unclassified 1046
31 Ga0068868_100006775 3300005338 Bacteria 8139
32 Ga0068868_100066103 3300005338 Unclassified 2874
33 Ga0068868_100524125 3300005338 Bacteria 1041
34 Ga0070660_100001060 3300005339 Bacteria 18497
35 Ga0070660_100039364 3300005339 Bacteria 3593
36 Ga0070689_100012831 3300005340 Bacteria 6049
37 Ga0070689_100273318 3300005340 Bacteria 1400
38 Ga0070689_100706555 3300005340 Bacteria 881
39 Ga0070687_100007584 3300005343 Unclassified 4535
40 Ga0070661_100029564 3300005344 Bacteria 3956
41 Ga0070661_100157898 3300005344 Bacteria 1716
42 Ga0070661_100300620 3300005344 Unclassified 1249
43 Ga0070668_100004691 3300005347 Bacteria 10129
44 Ga0070669_100004930 3300005353 Bacteria 9641
45 Ga0070675_100305514 3300005354 Bacteria 1402
46 Ga0070671_100198234 3300005355 Bacteria 1702
47 Ga0070671_100267480 3300005355 Bacteria 1453
48 Ga0070671_100353968 3300005355 Unclassified 1253
49 Ga0070671_100387295 3300005355 Bacteria 1195
50 Ga0070674_100003936 3300005356 Bacteria 8415
51 Ga0070673_100031611 3300005364 Bacteria 3975
52 Ga0070688_100000378 3300005365 Bacteria 22545
53 Ga0070688_100572401 3300005365 Bacteria 861
54 Ga0070659_100004918 3300005366 Bacteria 9556
55 Ga0070659_100359833 3300005366 Unclassified 1222
56 Ga0070709_10002941 3300005434 Bacteria 9173
57 Ga0070709_10029013 3300005434 Bacteria 3305
58 Ga0070709_10417986 3300005434 Bacteria 1004
59 Ga0070714_100015780 3300005435 Bacteria 6086
60 Ga0070714_100031659 3300005435 Bacteria 4415
61 Ga0070714_100133767 3300005435 Bacteria 2218
62 Ga0070714_100153943 3300005435 Bacteria 2074
63 Ga0070714_100446168 3300005435 Bacteria 1228
64 Ga0070714_100752081 3300005435 Unclassified 942
65 Ga0070713_100000134 3300005436 Bacteria 48639
66 Ga0070713_100000441 3300005436 Bacteria 26508
67 Ga0070713_100007620 3300005436 Bacteria 7618
68 Ga0070713_100013545 3300005436 Bacteria 6027
69 Ga0070713_100134367 3300005436 Bacteria 2184
70 Ga0070713_100160653 3300005436 Bacteria 2005
71 Ga0070713_100188999 3300005436 Unclassified 1855
72 Ga0070713_100221470 3300005436 Bacteria 1717
73 Ga0070713_100251471 3300005436 Bacteria 1612
74 Ga0070713_100489836 3300005436 Unclassified 1159
75 Ga0070713_100989354 3300005436 Unclassified 811
76 Ga0070713_101342043 3300005436 Unclassified 693
77 Ga0070710_10002183 3300005437 Bacteria 9242
78 Ga0070710_10008950 3300005437 Bacteria 4891
79 Ga0070710_10049876 3300005437 Bacteria 2343
80 Ga0070710_10300764 3300005437 Bacteria 1047
81 Ga0070710_10308230 3300005437 Bacteria 1035
82 Ga0070701_10037568 3300005438 Bacteria 2446
83 Ga0070711_100000271 3300005439 Bacteria 26787
84 Ga0070711_100005922 3300005439 Bacteria 7340
85 Ga0070711_100045473 3300005439 Bacteria 2987
86 Ga0070711_100056293 3300005439 Bacteria 2719
87 Ga0070711_100073773 3300005439 Bacteria 2412
88 Ga0070711_100101616 3300005439 Bacteria 2093
89 Ga0070711_100137176 3300005439 Bacteria 1830
90 Ga0070700_100187937 3300005441 Bacteria 1442
91 Ga0070663_100005199 3300005455 Bacteria 7706
92 Ga0070663_100648986 3300005455 Bacteria 892
93 Ga0070662_100265422 3300005457 Bacteria 1384
94 Ga0070662_100282563 3300005457 Bacteria 1344
95 Ga0070681_10003858 3300005458 Bacteria 14107
96 Ga0070681_10018999 3300005458 Bacteria 6878
97 Ga0070681_10120493 3300005458 Bacteria 2559
98 Ga0070681_10191500 3300005458 Bacteria 1965
99 Ga0070681_10831091 3300005458 Bacteria 841
100 Ga0070707_100098525 3300005468 Bacteria 2832
101 Ga0070698_101075734 3300005471 Unclassified 752
102 Ga0070679_100006572 3300005530 Bacteria 10831
103 Ga0070679_100250148 3300005530 Unclassified 1729
104 Ga0070679_100865629 3300005530 Unclassified 847
105 Ga0070684_100000012 3300005535 Bacteria 167850
106 Ga0070684_100005118 3300005535 Bacteria 10018
107 Ga0070684_100006986 3300005535 Bacteria 8769
108 Ga0070684_100090646 3300005535 Bacteria 2719
109 Ga0070684_100820268 3300005535 Bacteria 870
110 Ga0068853_100062588 3300005539 Bacteria 3220
111 Ga0070672_100003124 3300005543 Bacteria 10693
112 Ga0070686_100350177 3300005544 Unclassified 1109
113 Ga0070695_100150418 3300005545 Archaea 1624
114 Ga0070696_100883854 3300005546 Unclassified 740
115 Ga0070665_100515810 3300005548 Bacteria 1207
116 Ga0070665_100889235 3300005548 Unclassified 903
117 Ga0068855_100039804 3300005563 Bacteria 5579
118 Ga0068855_100195131 3300005563 Bacteria 2281
119 Ga0068855_100263335 3300005563 Bacteria 1920
120 Ga0068855_100833125 3300005563 Bacteria 978
121 Ga0070664_100043507 3300005564 Bacteria 3789
122 Ga0070664_100104340 3300005564 Bacteria 2468
123 Ga0068857_100002432 3300005577 Bacteria 15193
124 Ga0068857_100008251 3300005577 Bacteria 8999
125 Ga0068857_100091368 3300005577 Unclassified 2725
126 Ga0068854_100022813 3300005578 Bacteria 4269
127 Ga0068856_100010274 3300005614 Bacteria 9098
128 Ga0068856_100097796 3300005614 Bacteria 2925
129 Ga0068856_100120944 3300005614 Bacteria 2620
130 Ga0068856_100134259 3300005614 Bacteria 2480
131 Ga0068856_100278065 3300005614 Bacteria 1691
132 Ga0068856_100469825 3300005614 Bacteria 1278
133 Ga0068852_100118155 3300005616 Bacteria 2422
134 Ga0068852_100176071 3300005616 Unclassified 2009
135 Ga0068859_100011366 3300005617 Bacteria 8955
136 Ga0068864_100002059 3300005618 Bacteria 16609
137 Ga0068864_100061650 3300005618 Bacteria 3248
138 Ga0068864_100417490 3300005618 Unclassified 1278
139 Ga0068864_100775414 3300005618 Bacteria 941
140 Ga0068866_10007446 3300005718 Bacteria 4583
141 Ga0068861_100155144 3300005719 Bacteria 1882
142 Ga0068851_10004133 3300005834 Bacteria 6532
143 Ga0068851_10008504 3300005834 Bacteria 4747
144 Ga0068863_100018704 3300005841 Bacteria 6630
145 Ga0068863_100030784 3300005841 Bacteria 5125
146 Ga0068863_100058413 3300005841 Unclassified 3650
147 Ga0068863_100085129 3300005841 Unclassified 2996
148 Ga0068863_100100958 3300005841 Bacteria 2742
149 Ga0068863_100344085 3300005841 Bacteria 1451
150 Ga0068858_100016136 3300005842 Bacteria 7017
151 Ga0068858_101187163 3300005842 Bacteria 750
152 Ga0068860_100293184 3300005843 Bacteria 1592
153 Ga0068862_100084677 3300005844 Unclassified 2755
154 Ga0068862_100123710 3300005844 Bacteria 2282
155 Ga0070717_10001624 3300006028 Bacteria 15590
156 Ga0070717_10015703 3300006028 Bacteria 5853
157 Ga0070717_10120618 3300006028 Bacteria 2246
158 Ga0070717_10187222 3300006028 Unclassified 1807
159 Ga0070717_11346560 3300006028 Bacteria 649
160 Ga0070715_10001203 3300006163 Bacteria 7448
161 Ga0070715_10032767 3300006163 Bacteria 2119
162 Ga0070716_100000113 3300006173 Bacteria 31778
163 Ga0070716_100006183 3300006173 Bacteria 5846
164 Ga0070716_100035194 3300006173 Bacteria 2752
165 Ga0070716_100095885 3300006173 Bacteria 1807
166 Ga0070716_100222453 3300006173 Bacteria 1269
167 Ga0070712_100000262 3300006175 Bacteria 29465
168 Ga0070712_100000618 3300006175 Bacteria 20900
169 Ga0070712_100004634 3300006175 Bacteria 8499
170 Ga0070712_100037406 3300006175 Bacteria 3308
171 Ga0070712_100072370 3300006175 Unclassified 2469
172 Ga0070712_100081286 3300006175 Bacteria 2347
173 Ga0070712_100105021 3300006175 Bacteria 2097
174 Ga0070712_100546753 3300006175 Unclassified 975
175 Ga0070712_100578286 3300006175 Bacteria 949
176 Ga0070712_100585364 3300006175 Bacteria 943
177 Ga0097621_100100757 3300006237 Bacteria 2430
178 Ga0097621_100554534 3300006237 Unclassified 1046
179 Ga0068871_100027596 3300006358 Bacteria 4442
180 Ga0068871_100242391 3300006358 Bacteria 1568
181 Ga0075433_10110820 3300006852 Bacteria 2435
182 Ga0075434_100004984 3300006871 Bacteria 12046
183 Ga0068865_100036139 3300006881 Unclassified 3328
184 Ga0097620_100011366 3300006931 Bacteria 8955
185 Ga0075435_100187808 3300007076 Bacteria 1748
186 Ga0075435_100191727 3300007076 Bacteria 1730
187 Ga0105250_10010971 3300009092 Bacteria 3767
188 Ga0105240_10001965 3300009093 Bacteria 33968
189 Ga0105240_10026610 3300009093 Bacteria 7591
190 Ga0105240_10102802 3300009093 Unclassified 3472
191 Ga0105240_10120460 3300009093 Bacteria 3160
192 Ga0105245_10005901 3300009098 Bacteria 10758
193 Ga0105245_10012755 3300009098 Bacteria 7319
194 Ga0105245_10331270 3300009098 Bacteria 1503
195 Ga0105247_10008845 3300009101 Bacteria 6138
196 Ga0105241_10006802 3300009174 Bacteria 8405
197 Ga0105241_10007216 3300009174 Bacteria 8180
198 Ga0105248_10064893 3300009177 Bacteria 4099
199 Ga0105248_10141947 3300009177 Bacteria 2709
200 Ga0105248_10148064 3300009177 Bacteria 2649
201 Ga0105248_10261816 3300009177 Bacteria 1947
202 Ga0105248_10310607 3300009177 Bacteria 1775
203 Ga0105248_10335364 3300009177 Bacteria 1703
204 Ga0105237_10015526 3300009545 Bacteria 7923
205 Ga0105237_10079314 3300009545 Bacteria 3273
206 Ga0105237_10098788 3300009545 Bacteria 2910
207 Ga0105237_10891073 3300009545 Bacteria 897
208 Ga0105238_10045706 3300009551 Bacteria 4423
209 Ga0105238_10558339 3300009551 Unclassified 1150
210 Ga0105238_11158071 3300009551 Bacteria 797
211 Ga0105249_10028800 3300009553 Bacteria 5013
212 Ga0105249_10041076 3300009553 Unclassified 4203
213 Ga0105239_10005687 3300010375 Bacteria 14565
214 Ga0105239_10044777 3300010375 Bacteria 4850
215 Ga0105239_10051978 3300010375 Bacteria 4492
216 Ga0105239_10131716 3300010375 Bacteria 2782
217 Ga0105239_10258807 3300010375 Unclassified 1955
218 Ga0105239_11271662 3300010375 Bacteria 849
219 Ga0105246_10016424 3300011119 Bacteria 4689
220 Ga0105246_10550236 3300011119 Bacteria 989
221 Ga0105246_10640643 3300011119 Bacteria 924
222 Ga0157370_10142125 3300013104 Bacteria 2236
223 Ga0157370_10599761 3300013104 Bacteria 1008
224 Ga0157369_10000299 3300013105 Bacteria 66242
225 Ga0157369_10012638 3300013105 Bacteria 9574
226 Ga0157369_10181551 3300013105 Bacteria 2214
227 Ga0157369_10212334 3300013105 Bacteria 2028
228 Ga0157369_10213168 3300013105 Unclassified 2024
229 Ga0157369_10221743 3300013105 Bacteria 1979
230 Ga0157369_10440596 3300013105 Bacteria 1349
231 Ga0157374_10016590 3300013296 Bacteria 6478
232 Ga0157374_10064262 3300013296 Bacteria 3444
233 Ga0157374_10072789 3300013296 Bacteria 3243
234 Ga0157378_10057220 3300013297 Bacteria 3474
235 Ga0157378_10867282 3300013297 Unclassified 932
236 Ga0163162_10022906 3300013306 Bacteria 6159
237 Ga0163162_10547556 3300013306 Unclassified 1285
238 Ga0163162_11870365 3300013306 Bacteria 687
239 Ga0163162_11967925 3300013306 Bacteria 669
240 Ga0157372_10001242 3300013307 Bacteria 27549
241 Ga0157372_10042655 3300013307 Bacteria 5019
242 Ga0157372_10160416 3300013307 Bacteria 2599
243 Ga0157372_10304356 3300013307 Bacteria 1854
244 Ga0157372_10426129 3300013307 Bacteria 1546
245 Ga0157372_10552166 3300013307 Bacteria 1343
246 Ga0157372_10644518 3300013307 Unclassified 1234
247 Ga0157375_10087636 3300013308 Unclassified 3166
248 Ga0157375_10939265 3300013308 Unclassified 1007
249 Ga0163163_10002018 3300014325 Bacteria 17138
250 Ga0163163_10009479 3300014325 Bacteria 8694
251 Ga0163163_10009809 3300014325 Bacteria 8579
252 Ga0163163_10010446 3300014325 Bacteria 8353
253 Ga0163163_10031232 3300014325 Bacteria 5140
254 Ga0163163_10051413 3300014325 Bacteria 4064
255 Ga0163163_10117975 3300014325 Bacteria 2686
256 Ga0163163_10211496 3300014325 Bacteria 1988
257 Ga0163163_10420359 3300014325 Unclassified 1396
258 Ga0163163_10712776 3300014325 Bacteria 1067
259 Ga0157380_10031994 3300014326 Bacteria 4042
260 Ga0182008_10021442 3300014497 Bacteria 3317
261 Ga0182008_10022661 3300014497 Bacteria 3216
262 Ga0157377_10000323 3300014745 Bacteria 21538
263 Ga0157377_10140231 3300014745 Unclassified 1485
264 Ga0157379_10003917 3300014968 Bacteria 12689
265 Ga0157376_10005005 3300014969 Bacteria 9242
266 Ga0157376_10178505 3300014969 Bacteria 1939
267 Ga0157376_10241578 3300014969 Unclassified 1683
268 Ga0157376_10515535 3300014969 Unclassified 1178
269 Ga0157376_10620145 3300014969 Bacteria 1079
270 Ga0182006_1008649 3300015261 Bacteria 4609
271 Ga0182007_10003556 3300015262 Bacteria 7332
272 Ga0182007_10019228 3300015262 Bacteria 2459
273 Ga0182007_10035180 3300015262 Bacteria 1688
274 Ga0182005_1015497 3300015265 Bacteria 2125
275 Ga0163161_10002760 3300017792 Bacteria 12487
276 Ga0163161_10183483 3300017792 Bacteria 1606
277 Ga0207697_10002298 3300025315 Bacteria 9990
278 Ga0207656_10009745 3300025321 Bacteria 3571
279 Ga0207656_10101569 3300025321 Bacteria 1319
280 Ga0207682_10053306 3300025893 Bacteria 1677
281 Ga0207692_10001607 3300025898 Bacteria 8512
282 Ga0207692_10003745 3300025898 Bacteria 5972
283 Ga0207692_10099109 3300025898 Bacteria 1596
284 Ga0207692_10259032 3300025898 Bacteria 1045
285 Ga0207692_10288523 3300025898 Bacteria 995
286 Ga0207692_10369624 3300025898 Bacteria 888
287 Ga0207642_10031650 3300025899 Bacteria 2218
288 Ga0207710_10041907 3300025900 Bacteria 2032
289 Ga0207688_10005486 3300025901 Bacteria 6897
290 Ga0207647_10000837 3300025904 Bacteria 23915
291 Ga0207685_10000745 3300025905 Bacteria 5939
292 Ga0207699_10000209 3300025906 Bacteria 34945
293 Ga0207699_10006400 3300025906 Bacteria 5698
294 Ga0207699_10042939 3300025906 Bacteria 2623
295 Ga0207699_10047965 3300025906 Bacteria 2507
296 Ga0207699_10080297 3300025906 Bacteria 2021
297 Ga0207699_10259068 3300025906 Bacteria 1201
298 Ga0207699_10481679 3300025906 Bacteria 894
299 Ga0207699_10573046 3300025906 Unclassified 820
300 Ga0207645_10000020 3300025907 Bacteria 106990
301 Ga0207645_10488268 3300025907 Unclassified 833
302 Ga0207643_10017059 3300025908 Unclassified 3965
303 Ga0207705_10062814 3300025909 Bacteria 2683
304 Ga0207684_10024360 3300025910 Bacteria 5161
305 Ga0207684_10171974 3300025910 Bacteria 1867
306 Ga0207654_10125613 3300025911 Bacteria 1617
307 Ga0207707_10013290 3300025912 Bacteria 7175
308 Ga0207707_10152524 3300025912 Bacteria 2020
309 Ga0207707_10218470 3300025912 Bacteria 1659
310 Ga0207707_10449172 3300025912 Unclassified 1103
311 Ga0207707_10710463 3300025912 Bacteria 843
312 Ga0207695_10004010 3300025913 Bacteria 20276
313 Ga0207695_10098428 3300025913 Bacteria 2924
314 Ga0207695_10162125 3300025913 Bacteria 2167
315 Ga0207671_10044854 3300025914 Bacteria 3269
316 Ga0207671_10123347 3300025914 Bacteria 1982
317 Ga0207671_10313845 3300025914 Bacteria 1240
318 Ga0207693_10000026 3300025915 Bacteria 122717
319 Ga0207693_10000275 3300025915 Bacteria 47590
320 Ga0207693_10006920 3300025915 Bacteria 9363
321 Ga0207693_10007857 3300025915 Bacteria 8758
322 Ga0207693_10026362 3300025915 Bacteria 4600
323 Ga0207693_10084361 3300025915 Unclassified 2489
324 Ga0207693_10171956 3300025915 Unclassified 1706
325 Ga0207693_10527289 3300025915 Bacteria 921
326 Ga0207693_10568332 3300025915 Unclassified 884
327 Ga0207663_10015635 3300025916 Bacteria 4191
328 Ga0207663_10040443 3300025916 Bacteria 2834
329 Ga0207663_10079713 3300025916 Bacteria 2139
330 Ga0207663_10370320 3300025916 Bacteria 1089
331 Ga0207662_10000337 3300025918 Bacteria 21215
332 Ga0207657_10000734 3300025919 Bacteria 34795
333 Ga0207657_10005925 3300025919 Bacteria 12725
334 Ga0207649_10000281 3300025920 Bacteria 40106
335 Ga0207649_10596295 3300025920 Unclassified 849
336 Ga0207652_10009354 3300025921 Bacteria 7880
337 Ga0207652_10309404 3300025921 Unclassified 1426
338 Ga0207652_10445028 3300025921 Unclassified 1168
339 Ga0207652_10457705 3300025921 Bacteria 1150
340 Ga0207646_10115834 3300025922 Bacteria 2407
341 Ga0207646_10167696 3300025922 Bacteria 1982
342 Ga0207694_10030154 3300025924 Bacteria 4141
343 Ga0207694_10883105 3300025924 Unclassified 756
344 Ga0207650_10000076 3300025925 Bacteria 132412
345 Ga0207650_10042667 3300025925 Bacteria 3328
346 Ga0207687_10008503 3300025927 Bacteria 6712
347 Ga0207700_10000306 3300025928 Bacteria 28993
348 Ga0207700_10033738 3300025928 Bacteria 3665
349 Ga0207700_10070101 3300025928 Bacteria 2694
350 Ga0207700_10125356 3300025928 Bacteria 2089
351 Ga0207700_10134363 3300025928 Bacteria 2024
352 Ga0207700_10147366 3300025928 Bacteria 1941
353 Ga0207700_10187400 3300025928 Bacteria 1736
354 Ga0207700_10242667 3300025928 Bacteria 1536
355 Ga0207664_10000087 3300025929 Bacteria 88607
356 Ga0207664_10012370 3300025929 Bacteria 6098
357 Ga0207664_10019525 3300025929 Bacteria 5011
358 Ga0207664_10036740 3300025929 Bacteria 3786
359 Ga0207664_10251116 3300025929 Unclassified 1544
360 Ga0207664_10355438 3300025929 Unclassified 1297
361 Ga0207664_10944598 3300025929 Bacteria 773
362 Ga0207644_10019111 3300025931 Unclassified 4645
363 Ga0207644_10043093 3300025931 Bacteria 3202
364 Ga0207644_10687880 3300025931 Unclassified 852
365 Ga0207690_10084483 3300025932 Bacteria 2225
366 Ga0207690_10380823 3300025932 Bacteria 1121
367 Ga0207706_10000684 3300025933 Bacteria 35566
368 Ga0207706_10002540 3300025933 Bacteria 17788
369 Ga0207670_10023873 3300025936 Unclassified 3813
370 Ga0207670_10269899 3300025936 Bacteria 1322
371 Ga0207669_10413638 3300025937 Unclassified 1059
372 Ga0207704_10197282 3300025938 Unclassified 1470
373 Ga0207665_10000378 3300025939 Bacteria 30729
374 Ga0207665_10041512 3300025939 Unclassified 3073
375 Ga0207665_10116978 3300025939 Bacteria 1879
376 Ga0207691_10000533 3300025940 Bacteria 38044
377 Ga0207711_10016329 3300025941 Bacteria 6168
378 Ga0207711_10066861 3300025941 Bacteria 3109
379 Ga0207711_10070016 3300025941 Unclassified 3042
380 Ga0207711_10095749 3300025941 Unclassified 2619
381 Ga0207711_10345001 3300025941 Bacteria 1378
382 Ga0207711_10712585 3300025941 Unclassified 936
383 Ga0207689_10000097 3300025942 Bacteria 70239
384 Ga0207689_10280422 3300025942 Bacteria 1380
385 Ga0207661_10000003 3300025944 Bacteria 611941
386 Ga0207661_10000329 3300025944 Bacteria 30164
387 Ga0207661_10170580 3300025944 Bacteria 1894
388 Ga0207661_10689291 3300025944 Bacteria 939
389 Ga0207679_10000086 3300025945 Bacteria 81943
390 Ga0207667_10066114 3300025949 Bacteria 3770
391 Ga0207667_10085153 3300025949 Bacteria 3272
392 Ga0207667_10424647 3300025949 Bacteria 1352
393 Ga0207667_11470757 3300025949 Bacteria 653
394 Ga0207651_10025675 3300025960 Bacteria 3666
395 Ga0207712_10380382 3300025961 Unclassified 1181
396 Ga0207640_10236209 3300025981 Bacteria 1409
397 Ga0207658_10591554 3300025986 Bacteria 996
398 Ga0207677_10011159 3300026023 Bacteria 5109
399 Ga0207677_10062846 3300026023 Unclassified 2578
400 Ga0207677_10177066 3300026023 Bacteria 1674
401 Ga0207677_10644072 3300026023 Bacteria 935
402 Ga0207703_10003138 3300026035 Bacteria 13948
403 Ga0207703_10768259 3300026035 Bacteria 919
404 Ga0207639_10292189 3300026041 Bacteria 1437
405 Ga0207639_10304207 3300026041 Bacteria 1410
406 Ga0207678_10000092 3300026067 Bacteria 75016
407 Ga0207678_10584931 3300026067 Bacteria 978
408 Ga0207702_10074218 3300026078 Bacteria 2935
409 Ga0207702_10087077 3300026078 Bacteria 2725
410 Ga0207702_10110295 3300026078 Bacteria 2445
411 Ga0207641_10001986 3300026088 Bacteria 19528
412 Ga0207641_10030963 3300026088 Unclassified 4435
413 Ga0207641_10082261 3300026088 Bacteria 2797
414 Ga0207641_10112273 3300026088 Bacteria 2418
415 Ga0207641_11510486 3300026088 Unclassified 673
416 Ga0207648_10000027 3300026089 Bacteria 130128
417 Ga0207676_10000301 3300026095 Bacteria 42521
418 Ga0207676_10642436 3300026095 Bacteria 1023
419 Ga0207674_10002631 3300026116 Bacteria 22482
420 Ga0207674_10010225 3300026116 Bacteria 10659
421 Ga0207674_10026353 3300026116 Bacteria 6176
422 Ga0207674_10108132 3300026116 Unclassified 2758
423 Ga0207675_100207491 3300026118 Bacteria 1883
424 Ga0207683_10001351 3300026121 Bacteria 22151
425 Ga0207698_10512240 3300026142 Unclassified 1169
426 Ga0265355_1000430 3300028036 Bacteria 2157
427 Ga0268266_10001514 3300028379 Bacteria 27246
428 Ga0268265_10081488 3300028380 Bacteria 2555
429 Ga0268265_10093670 3300028380 Bacteria 2407
430 Ga0268264_10023678 3300028381 Bacteria 5007
431 Ga0268264_10062355 3300028381 Bacteria 3130
432 Ga0265338_10003313 3300028800 Bacteria 22804
433 Ga0265338_10011557 3300028800 Bacteria 10178
434 Ga0265338_10015868 3300028800 Bacteria 8244
435 Ga0265338_10084846 3300028800 Bacteria 2642
436 Ga0265338_10200839 3300028800 Bacteria 1503
437 Ga0265338_10219890 3300028800 Unclassified 1419
438 Ga0265770_1010399 3300030878 Unclassified 1350
439 Ga0265765_1002649 3300030879 Unclassified 1748
440 Ga0265765_1016532 3300030879 Unclassified 865
441 Ga0265760_10007781 3300031090 Bacteria 3061
442 Ga0265760_10024863 3300031090 Unclassified 1747
443 Ga0265760_10063354 3300031090 Bacteria 1126
444 Ga0265330_10107147 3300031235 Unclassified 1195
445 Ga0265332_10011313 3300031238 Bacteria 3968
446 Ga0265332_10052063 3300031238 Unclassified 1758
447 Ga0265328_10019249 3300031239 Bacteria 2624
448 Ga0265328_10071933 3300031239 Unclassified 1271
449 Ga0265325_10008405 3300031241 Bacteria 6094
450 Ga0265325_10044574 3300031241 Bacteria 2309
451 Ga0265325_10294621 3300031241 Bacteria 725
452 Ga0265325_10337724 3300031241 Bacteria 667
453 Ga0265340_10011576 3300031247 Bacteria 4685
454 Ga0265340_10017709 3300031247 Bacteria 3685
455 Ga0265340_10039410 3300031247 Bacteria 2331
456 Ga0265340_10042480 3300031247 Bacteria 2232
457 Ga0265340_10059053 3300031247 Unclassified 1840
458 Ga0265340_10091526 3300031247 Bacteria 1421
459 Ga0265339_10015513 3300031249 Bacteria 4563
460 Ga0265339_10075737 3300031249 Bacteria 1786
461 Ga0265339_10097025 3300031249 Bacteria 1538
462 Ga0265339_10128431 3300031249 Bacteria 1298
463 Ga0265331_10006314 3300031250 Bacteria 7017
464 Ga0265331_10043370 3300031250 Bacteria 2179
465 Ga0265331_10071947 3300031250 Bacteria 1616
466 Ga0265331_10185008 3300031250 Bacteria 940
467 Ga0265327_10029065 3300031251 Bacteria 3149
468 Ga0265316_10001586 3300031344 Bacteria 24297
469 Ga0265316_10003793 3300031344 Bacteria 15194
470 Ga0265316_10011708 3300031344 Bacteria 7899
471 Ga0265316_10013616 3300031344 Bacteria 7217
472 Ga0265316_10034691 3300031344 Bacteria 4096
473 Ga0265316_10045745 3300031344 Bacteria 3472
474 Ga0265316_10091718 3300031344 Bacteria 2317
475 Ga0265316_10096204 3300031344 Unclassified 2255
476 Ga0265316_10109120 3300031344 Bacteria 2097
477 Ga0265316_10140022 3300031344 Unclassified 1818
478 Ga0265316_10144278 3300031344 Unclassified 1786
479 Ga0265316_10192947 3300031344 Bacteria 1512
480 Ga0265316_10249817 3300031344 Bacteria 1303
481 Ga0307408_100152076 3300031548 Bacteria 1828
482 Ga0265313_10029444 3300031595 Bacteria 2840
483 Ga0307508_10187823 3300031616 Bacteria 1668
484 Ga0265314_10005392 3300031711 Bacteria 11559
485 Ga0265314_10039432 3300031711 Unclassified 3402
486 Ga0265342_10062190 3300031712 Bacteria 2198
487 Ga0265342_10130283 3300031712 Bacteria 1410
488 Ga0265342_10186218 3300031712 Bacteria 1135
489 Ga0265342_10255454 3300031712 Bacteria 934
490 Ga0316576_10012436 3300031727 Bacteria 5621
491 Ga0307405_10013056 3300031731 Bacteria 4421
492 Ga0307413_10093964 3300031824 Bacteria 1962
493 Ga0307410_10011350 3300031852 Bacteria 5092
494 Ga0307410_10019394 3300031852 Bacteria 4137
495 Ga0307406_10015404 3300031901 Bacteria 4424
496 Ga0307407_10116037 3300031903 Bacteria 1689
497 Ga0307407_10263805 3300031903 Bacteria 1186
498 Ga0307412_10353244 3300031911 Unclassified 1181
499 Ga0307409_100078288 3300031995 Bacteria 2659
500 Ga0307409_100752564 3300031995 Bacteria 978
501 Ga0307416_100060990 3300032002 Bacteria 3075
502 Ga0307416_100122663 3300032002 Bacteria 2320
503 Ga0307411_10047205 3300032005 Bacteria 2783
504 Ga0307411_10152033 3300032005 Bacteria 1721
505 Ga0307415_100029680 3300032126 Bacteria 3498
506 Ga0316588_1129405 3300033528 Unclassified 641
507 Ga0373926_0067130 3300035083 Bacteria 1314
508 Ga0373934_0095718 3300035086 Bacteria 1199
509 Ga0373934_0108509 3300035086 Bacteria 1125
510 Ga0373923_0024164 3300035111 Bacteria 2397
511 Ga0373936_0019394 3300035113 Unclassified 2635
512 Ga0373936_0035469 3300035113 Bacteria 1986
513 Ga0373945_0008745 3300035116 Bacteria 3305
514 Ga0373945_0009368 3300035116 Bacteria 3208
515 Ga0373953_0127369 3300035117 Bacteria 1084
516 Ga0373957_0112755 3300035120 Bacteria 1096
517 Ga0373943_0001626 3300035170 Bacteria 10190
518 Ga0373946_0007422 3300035171 Bacteria 4009
519 Ga0373955_0007025 3300035172 Bacteria 5155
520 Ga0373924_0060056 3300035410 Bacteria 1589
521 Ga0373935_0005817 3300035692 Bacteria 7302
522 Ga0373935_0177769 3300035692 Unclassified 1460
523 Ga0373935_0337797 3300035692 Unclassified 1072
524 Ga0373927_0005658 3300035695 Bacteria 8590
525 Ga0373927_0218593 3300035695 Bacteria 1252
526 Ga0373927_0510111 3300035695 Unclassified 795
527 Ga0373927_0562051 3300035695 Bacteria 754
528 Ga0373933_0058022 3300035724 Bacteria 2327
529 Ga0373933_0074113 3300035724 Bacteria 2075
530 Ga0373933_0347727 3300035724 Bacteria 963
531 Ga0373947_0005213 3300035725 Bacteria 7599
532 Ga0373947_0033579 3300035725 Bacteria 3030
533 Ga0373947_0091948 3300035725 Bacteria 1894
534 Ga0373947_0612340 3300035725 Unclassified 742
535 Ga0373937_0092088 3300036401 Unclassified 2810
536 Ga0373937_0321289 3300036401 Bacteria 1465
537 Ga0373937_0437845 3300036401 Unclassified 1241
538 Ga0373937_0532452 3300036401 Unclassified 1116
539 Ga0373937_0710918 3300036401 Bacteria 952
540 Ga0373937_0891447 3300036401 Bacteria 838
541 Ga0373925_0004658 3300037068 Bacteria 10348
542 Ga0373925_0129617 3300037068 Bacteria 1965
543 Ga0373925_0293846 3300037068 Unclassified 1311
544 Ga0373925_0478959 3300037068 Bacteria 1021
545 Ga0373925_0657610 3300037068 Unclassified 864
546 Ga0395905_0996523 3300037471 Bacteria 741
547 Ga0400487_48358 3300039110 Bacteria 1854
548 Ga0436363_1670777 3300039450 Bacteria 2119
549 Ga0436362_0417381 3300039453 Unclassified 786
550 Ga0451577_0088068 3300042876 Bacteria 2770
551 Ga0451577_0088529 3300042876 Unclassified 2762
552 Ga0451577_0231907 3300042876 Bacteria 1670
553 Ga0451577_0544815 3300042876 Bacteria 1053
554 Ga0451577_0780444 3300042876 Bacteria 863
555 Ga0453683_0020861 3300044673 Bacteria 4185
556 Ga0453683_0068956 3300044673 Bacteria 2211
557 Ga0453683_0167923 3300044673 Bacteria 1389
558 Ga0453683_0479060 3300044673 Bacteria 806
559 Ga0466963_0363900 3300044694 Bacteria 1019
560 Ga0453684_0004808 3300044712 Bacteria 27796
561 Ga0453684_0007794 3300044712 Bacteria 19533
562 Ga0453684_0009271 3300044712 Bacteria 17276
563 Ga0453684_0018536 3300044712 Bacteria 10671
564 Ga0453684_0043198 3300044712 Bacteria 6062
565 Ga0453684_0112396 3300044712 Bacteria 3306
566 Ga0453684_0152673 3300044712 Bacteria 2742
567 Ga0453684_0156208 3300044712 Bacteria 2704
568 Ga0453684_0255348 3300044712 Bacteria 2011
569 Ga0453684_0459160 3300044712 Bacteria 1417
570 Ga0453684_1039479 3300044712 Bacteria 869
571 Ga0453684_1352734 3300044712 Bacteria 741
572 Ga0451576_0000508 3300045051 Bacteria 85239
573 Ga0451576_0014682 3300045051 Bacteria 8707
574 Ga0451576_0069480 3300045051 Bacteria 3665
575 Ga0451576_0201696 3300045051 Bacteria 2077
576 Ga0451576_0343409 3300045051 Bacteria 1563
577 Ga0451576_0390582 3300045051 Bacteria 1459
578 Ga0451576_0913402 3300045051 Bacteria 921
579 Ga0451576_1207852 3300045051 Bacteria 789
580 Ga0451576_1576639 3300045051 Bacteria 681
581 Ga0495629_0530594 3300046459 Unclassified 791
582 Ga0495580_0001289 3300046472 Bacteria 22103
583 Ga0495580_0001629 3300046472 Bacteria 19732
584 Ga0495580_0001942 3300046472 Bacteria 18151
585 Ga0495580_0002140 3300046472 Bacteria 17326
586 Ga0495580_0022575 3300046472 Bacteria 4630
587 Ga0495580_0023319 3300046472 Bacteria 4547
588 Ga0495580_0035448 3300046472 Bacteria 3588
589 Ga0495580_0109097 3300046472 Bacteria 1922
590 Ga0495580_0337045 3300046472 Bacteria 1023
591 Ga0495582_0002195 3300046473 Bacteria 10922
592 Ga0495662_0084799 3300046476 Bacteria 1542
593 Ga0495664_0048528 3300046477 Bacteria 2520
594 Ga0495664_0197227 3300046477 Bacteria 1220
595 Ga0495664_0309766 3300046477 Bacteria 953
596 Ga0495584_0359412 3300046491 Unclassified 739
597 Ga0495608_0094355 3300046511 Bacteria 1933
598 Ga0495608_0158548 3300046511 Bacteria 1440
599 Ga0495628_0113195 3300046516 Bacteria 2085
600 Ga0495628_0238957 3300046516 Bacteria 1359
601 Ga0495628_0291006 3300046516 Bacteria 1211
602 Ga0495628_0632093 3300046516 Bacteria 762
603 Ga0495630_0159613 3300046517 Bacteria 1717
604 Ga0495630_0351232 3300046517 Bacteria 1128
605 Ga0495666_0296234 3300046526 Bacteria 732
606 Ga0495652_0077795 3300046529 Bacteria 2748
607 Ga0495652_0267677 3300046529 Bacteria 1258
608 Ga0495665_0086863 3300046531 Bacteria 1644
609 Ga0495665_0130241 3300046531 Unclassified 1317
610 Ga0495640_0100943 3300046533 Bacteria 1894
611 Ga0495640_0120533 3300046533 Unclassified 1706
612 Ga0495586_0203297 3300046535 Bacteria 1123
613 Ga0495586_0336996 3300046535 Bacteria 866
614 Ga0495587_0133821 3300046536 Bacteria 1416
615 Ga0495597_0129583 3300046542 Bacteria 1047
616 Ga0495645_0048164 3300046543 Bacteria 3105
617 Ga0495645_0066392 3300046543 Bacteria 2607
618 Ga0495645_0217162 3300046543 Bacteria 1288
619 Ga0495667_0021053 3300046559 Bacteria 4399
620 Ga0495667_0037201 3300046559 Bacteria 3244
621 Ga0495667_0504123 3300046559 Unclassified 758
622 Ga0495634_0041533 3300046642 Bacteria 3123
623 Ga0495635_0034978 3300046663 Bacteria 3484
624 Ga0495635_0069154 3300046663 Bacteria 2421
625 Ga0495635_0083069 3300046663 Unclassified 2192
626 Ga0495657_0061077 3300046675 Bacteria 2494
627 Ga0495599_0020419 3300046678 Bacteria 4125
628 Ga0495599_0272622 3300046678 Bacteria 1026
629 Ga0495599_0313790 3300046678 Bacteria 945
630 Ga0495623_0057808 3300046679 Bacteria 2439
631 Ga0495623_0070232 3300046679 Bacteria 2182
632 Ga0495623_0209966 3300046679 Unclassified 1115
633 Ga0495623_0224364 3300046679 Bacteria 1069
634 Ga0495623_0225280 3300046679 Unclassified 1066
635 Ga0495658_0020496 3300046683 Bacteria 3470
636 Ga0495669_0071717 3300046684 Unclassified 1580
637 Ga0495613_0034488 3300046689 Bacteria 3758
638 Ga0495613_0091852 3300046689 Bacteria 2199
639 Ga0495624_0317867 3300046690 Unclassified 938
640 Ga0495600_0037589 3300046809 Bacteria 3148
641 Ga0495604_0101045 3300047317 Bacteria 2119
642 Ga0495604_0581456 3300047317 Unclassified 720
643 Ga0495674_0009268 3300047319 Bacteria 9355
644 Ga0495674_0041326 3300047319 Bacteria 4119
645 Ga0495674_0053954 3300047319 Bacteria 3531
646 Ga0495674_0077571 3300047319 Bacteria 2856
647 Ga0495674_0491966 3300047319 Unclassified 982
648 Ga0495676_0531589 3300047321 Unclassified 770
649 Ga0495680_0157457 3300047322 Bacteria 1651
650 Ga0495675_0062844 3300047444 Bacteria 2350
651 Ga0495675_0290800 3300047444 Bacteria 972
652 Ga0495675_0340738 3300047444 Unclassified 883
653 Ga0495675_0356972 3300047444 Bacteria 859
654 Ga0495684_0012376 3300047471 Bacteria 6579
655 Ga0495684_0059394 3300047471 Bacteria 2912
656 Ga0495684_0454842 3300047471 Unclassified 889
657 Ga0495684_0518357 3300047471 Bacteria 817
658 Ga0495593_0219838 3300047673 Bacteria 953
659 Ga0495593_0260462 3300047673 Bacteria 868
660 Ga0495602_0054542 3300048088 Bacteria 3528
661 Ga0495602_0124558 3300048088 Bacteria 2067
662 Ga0495602_0129153 3300048088 Bacteria 2019
663 Ga0495602_0135022 3300048088 Unclassified 1962
664 Ga0495602_0147010 3300048088 Unclassified 1858
665 Ga0495602_0247501 3300048088 Unclassified 1330
666 Ga0495602_0403179 3300048088 Bacteria 975
667 Ga0496100_0095496 3300048903 Bacteria 2038
668 Ga0496100_0201946 3300048903 Unclassified 1449
669 Ga0496101_0134964 3300048904 Bacteria 1877
670 Ga0496101_0174263 3300048904 Bacteria 1654
671 Ga0496102_0043668 3300048905 Bacteria 4066
672 Ga0496102_0062825 3300048905 Bacteria 3400
673 Ga0496102_0070898 3300048905 Bacteria 3200
674 Ga0496102_0877343 3300048905 Bacteria 819
675 Ga0496103_0068956 3300048906 Bacteria 2210
676 Ga0496103_0126989 3300048906 Bacteria 1627
677 Ga0496104_0033407 3300048907 Bacteria 4792
678 Ga0496104_0050964 3300048907 Bacteria 3906
679 Ga0496104_0080794 3300048907 Bacteria 3100
680 Ga0496105_0075007 3300048908 Bacteria 2794
681 Ga0496105_0471417 3300048908 Unclassified 989
682 Ga0496106_0405614 3300048909 Bacteria 1095
683 Ga0496108_0000105 3300048911 Bacteria 87322
684 Ga0496108_0810520 3300048911 Bacteria 807
685 Ga0496109_0000008 3300048912 Bacteria 245809
686 Ga0496109_0214432 3300048912 Bacteria 1810
687 Ga0496110_0006952 3300048913 Bacteria 9000
688 Ga0496110_0015129 3300048913 Bacteria 6414
689 Ga0496110_0894563 3300048913 Bacteria 794
690 Ga0496112_0006521 3300048915 Bacteria 10260
691 Ga0496112_0074774 3300048915 Bacteria 3350
692 Ga0496112_0177422 3300048915 Unclassified 2095
693 Ga0496112_0487621 3300048915 Bacteria 1168
694 Ga0496112_0487958 3300048915 Unclassified 1168
695 Ga0496113_0000740 3300048916 Bacteria 16789
696 Ga0496113_0188096 3300048916 Bacteria 1638
697 Ga0496115_0003194 3300048918 Bacteria 11768
698 Ga0496115_0669528 3300048918 Bacteria 819
699 Ga0501296_009665 3300049519 Unclassified 1134
700 Ga0501298_005780 3300049521 Bacteria 2000
701 Ga0501032_0547919 3300049569 Bacteria 738
702 Ga0501036_0958730 3300049572 Bacteria 701
703 Ga0501040_0419561 3300049576 Bacteria 962
704 Ga0501041_0350520 3300049577 Bacteria 933
705 Ga0501042_0490213 3300049578 Bacteria 892
706 Ga0501043_0667873 3300049579 Bacteria 762
707 Ga0501069_0129243 3300049585 Unclassified 1446
708 Ga0501069_0447831 3300049585 Bacteria 767
709 Ga0501076_0244579 3300049592 Bacteria 1468
710 Ga0501257_028974 3300049686 Unclassified 1330
711 Ga0501079_0221444 3300049741 Bacteria 1478
712 Ga0501045_0215151 3300049824 Bacteria 1431
713 nmdc:mga0n895_1062062_c1 3300050512 Unclassified 788
714 nmdc:mga0n895_3653_c1 3300050512 Bacteria 12440
715 nmdc:mga0rr50_197673_c1 3300050513 Bacteria 1651
716 nmdc:mga0rr50_529409_c1 3300050513 Bacteria 1003
717 nmdc:mga08x19_113661_c1 3300050514 Bacteria 1808
718 nmdc:mga08x19_298406_c1 3300050514 Bacteria 1119
719 nmdc:mga08x19_347814_c1 3300050514 Bacteria 1035
720 nmdc:mga08x19_9468_c1 3300050514 Bacteria 5836
721 nmdc:mga0a205_56054_c1 3300050515 Bacteria 3806
722 Ga0495601_0102137 3300053077 Unclassified 1853
723 Ga0495601_0390222 3300053077 Bacteria 903
724 Ga0495619_0395395 3300053085 Bacteria 955
725 Ga0495619_0406392 3300053085 Bacteria 940
726 Ga0501084_0673087 3300054114 Bacteria 873
727 Ga0501082_0000500 3300060353 Bacteria 34726
728 Ga0501082_0066339 3300060353 Bacteria 3109
729 Ga0530510_0145906 3300061734 Bacteria 1745
730 Ga0530510_0742440 3300061734 Bacteria 748

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031616 Ga0307508_10187823 Ga0307508_101878231 183
2 3300033528 Ga0316588_1129405 Ga0316588_11294051 183
3 3300039110 Ga0400487_48358 Ga0400487_48358_773_1330 183
4 3300042876 Ga0451577_0088068 Ga0451577_0088068_2000_2551 183
5 3300042876 Ga0451577_0544815 Ga0451577_0544815_384_935 183
6 3300042876 Ga0451577_0780444 Ga0451577_0780444_51_602 183
7 3300044673 Ga0453683_0068956 Ga0453683_0068956_1521_2090 183
8 3300044673 Ga0453683_0479060 Ga0453683_0479060_21_572 183
9 3300044712 Ga0453684_0004808 Ga0453684_0004808_10259_10810 183
10 3300044712 Ga0453684_0007794 Ga0453684_0007794_283_834 183
11 3300044712 Ga0453684_0043198 Ga0453684_0043198_3350_3901 183
12 3300044712 Ga0453684_0152673 Ga0453684_0152673_506_1057 183
13 3300044712 Ga0453684_0255348 Ga0453684_0255348_717_1268 183
14 3300044712 Ga0453684_0459160 Ga0453684_0459160_48_599 183
15 3300045051 Ga0451576_0201696 Ga0451576_0201696_1485_2036 183
16 3300046477 Ga0495664_0309766 Ga0495664_0309766_67_624 183
17 3300046516 Ga0495628_0632093 Ga0495628_0632093_23_607 183
18 3300046533 Ga0495640_0100943 Ga0495640_0100943_577_1170 183
19 3300046663 Ga0495635_0069154 Ga0495635_0069154_1470_2063 183
20 3300047319 Ga0495674_0009268 Ga0495674_0009268_4773_5366 183
21 3300047444 Ga0495675_0356972 Ga0495675_0356972_21_614 183
22 3300048088 Ga0495602_0129153 Ga0495602_0129153_428_1021 183
23 3300049572 Ga0501036_0958730 Ga0501036_0958730_82_633 183
24 3300049576 Ga0501040_0419561 Ga0501040_0419561_388_939 183
25 3300049577 Ga0501041_0350520 Ga0501041_0350520_245_799 183
26 3300049579 Ga0501043_0667873 Ga0501043_0667873_172_747 183
27 3300049592 Ga0501076_0244579 Ga0501076_0244579_10_561 183
28 3300061734 Ga0530510_0145906 Ga0530510_0145906_1156_1707 183
29 3300061734 Ga0530510_0742440 Ga0530510_0742440_155_706 183
30 3300031727 Ga0316576_10012436 Ga0316576_100124368 184
31 3300044673 Ga0453683_0020861 Ga0453683_0020861_536_1090 184
32 3300044673 Ga0453683_0167923 Ga0453683_0167923_662_1216 184
33 3300044712 Ga0453684_0009271 Ga0453684_0009271_14495_15070 184
34 3300044712 Ga0453684_0018536 Ga0453684_0018536_672_1226 184
35 3300044712 Ga0453684_0112396 Ga0453684_0112396_2711_3265 184
36 3300044712 Ga0453684_0156208 Ga0453684_0156208_1481_2035 184
37 3300045051 Ga0451576_0000508 Ga0451576_0000508_55048_55602 184
38 3300045051 Ga0451576_0069480 Ga0451576_0069480_2179_2733 184
39 3300045051 Ga0451576_1207852 Ga0451576_1207852_43_597 184
40 3300049578 Ga0501042_0490213 Ga0501042_0490213_28_582 184
41 3300049585 Ga0501069_0447831 Ga0501069_0447831_21_599 184
42 3300049741 Ga0501079_0221444 Ga0501079_0221444_72_650 184
43 3300054114 Ga0501084_0673087 Ga0501084_0673087_23_601 184
44 3300060353 Ga0501082_0066339 Ga0501082_0066339_853_1407 184
45 3300049569 Ga0501032_0547919 Ga0501032_0547919_66_626 186
46 3300028800 Ga0265338_10015868 Ga0265338_100158682 187
47 3300031241 Ga0265325_10294621 Ga0265325_102946212 187
48 3300031247 Ga0265340_10017709 Ga0265340_100177093 187
49 3300031250 Ga0265331_10006314 Ga0265331_100063143 187
50 3300031344 Ga0265316_10001586 Ga0265316_1000158620 187
51 3300031344 Ga0265316_10034691 Ga0265316_100346912 187
52 3300005355 Ga0070671_100387295 Ga0070671_1003872952 189
53 3300014325 Ga0163163_10712776 Ga0163163_107127761 189
54 3300036401 Ga0373937_0092088 Ga0373937_0092088_2031_2612 190
55 3300046476 Ga0495662_0084799 Ga0495662_0084799_168_749 190
56 3300046477 Ga0495664_0048528 Ga0495664_0048528_1333_1914 190
57 3300046511 Ga0495608_0158548 Ga0495608_0158548_158_739 190
58 3300046516 Ga0495628_0113195 Ga0495628_0113195_1047_1628 190
59 3300046517 Ga0495630_0351232 Ga0495630_0351232_330_911 190
60 3300046529 Ga0495652_0077795 Ga0495652_0077795_500_1081 190
61 3300046535 Ga0495586_0203297 Ga0495586_0203297_424_1005 190
62 3300046536 Ga0495587_0133821 Ga0495587_0133821_787_1368 190
63 3300046543 Ga0495645_0066392 Ga0495645_0066392_1435_2016 190
64 3300046559 Ga0495667_0037201 Ga0495667_0037201_1687_2268 190
65 3300046642 Ga0495634_0041533 Ga0495634_0041533_2292_2873 190
66 3300046663 Ga0495635_0034978 Ga0495635_0034978_113_694 190
67 3300046675 Ga0495657_0061077 Ga0495657_0061077_253_834 190
68 3300046678 Ga0495599_0020419 Ga0495599_0020419_2133_2714 190
69 3300046679 Ga0495623_0057808 Ga0495623_0057808_452_1033 190
70 3300046689 Ga0495613_0034488 Ga0495613_0034488_313_894 190
71 3300046809 Ga0495600_0037589 Ga0495600_0037589_779_1360 190
72 3300047317 Ga0495604_0101045 Ga0495604_0101045_1103_1684 190
73 3300047319 Ga0495674_0041326 Ga0495674_0041326_1502_2083 190
74 3300047322 Ga0495680_0157457 Ga0495680_0157457_926_1507 190
75 3300047444 Ga0495675_0290800 Ga0495675_0290800_118_699 190
76 3300047471 Ga0495684_0059394 Ga0495684_0059394_1245_1826 190
77 3300047673 Ga0495593_0260462 Ga0495593_0260462_100_681 190
78 3300048088 Ga0495602_0247501 Ga0495602_0247501_619_1200 190
79 3300050512 nmdc:mga0n895_1062062_c1 nmdc:mga0n895_1062062_c1_101_682 190
80 3300053077 Ga0495601_0390222 Ga0495601_0390222_241_822 190
81 3300053085 Ga0495619_0406392 Ga0495619_0406392_65_646 190
82 3300060353 Ga0501082_0000500 Ga0501082_0000500_3636_4217 190
83 3300005545 Ga0070695_100150418 Ga0070695_1001504182 191
84 3300025925 Ga0207650_10042667 Ga0207650_100426675 191
85 3300005365 Ga0070688_100572401 Ga0070688_1005724012 192
86 3300005434 Ga0070709_10417986 Ga0070709_104179861 192
87 3300005436 Ga0070713_100221470 Ga0070713_1002214702 192
88 3300005841 Ga0068863_100344085 Ga0068863_1003440852 192
89 3300006028 Ga0070717_11346560 Ga0070717_113465601 192
90 3300007076 Ga0075435_100187808 Ga0075435_1001878082 192
91 3300025906 Ga0207699_10259068 Ga0207699_102590682 192
92 3300036401 Ga0373937_0710918 Ga0373937_0710918_248_835 192
93 3300049824 Ga0501045_0215151 Ga0501045_0215151_620_1204 192
94 3300035695 Ga0373927_0562051 Ga0373927_0562051_146_733 193
95 3300005364 Ga0070673_100031611 Ga0070673_1000316111 194
96 3300005535 Ga0070684_100820268 Ga0070684_1008202682 194
97 3300006358 Ga0068871_100242391 Ga0068871_1002423912 194
98 3300009093 Ga0105240_10001965 Ga0105240_1000196512 194
99 3300013105 Ga0157369_10212334 Ga0157369_102123342 194
100 3300013307 Ga0157372_10304356 Ga0157372_103043562 194
101 3300014969 Ga0157376_10620145 Ga0157376_106201452 194
102 3300031344 Ga0265316_10003793 Ga0265316_100037935 194
103 3300048903 Ga0496100_0095496 Ga0496100_0095496_323_907 194
104 3300048904 Ga0496101_0174263 Ga0496101_0174263_127_711 194
105 3300048905 Ga0496102_0070898 Ga0496102_0070898_2238_2822 194
106 3300048906 Ga0496103_0126989 Ga0496103_0126989_575_1159 194
107 3300048907 Ga0496104_0080794 Ga0496104_0080794_519_1103 194
108 3300048911 Ga0496108_0000105 Ga0496108_0000105_61455_62039 194
109 3300048912 Ga0496109_0000008 Ga0496109_0000008_162163_162747 194
110 3300048913 Ga0496110_0006952 Ga0496110_0006952_4936_5520 194
111 3300048915 Ga0496112_0006521 Ga0496112_0006521_7829_8413 194
112 3300048916 Ga0496113_0000740 Ga0496113_0000740_10555_11139 194
113 3300005328 Ga0070676_10064385 Ga0070676_100643853 195
114 3300005329 Ga0070683_100000026 Ga0070683_10000002688 195
115 3300005335 Ga0070666_10187314 Ga0070666_101873142 195
116 3300005336 Ga0070680_100279279 Ga0070680_1002792792 195
117 3300005337 Ga0070682_100393570 Ga0070682_1003935702 195
118 3300005338 Ga0068868_100524125 Ga0068868_1005241252 195
119 3300005339 Ga0070660_100039364 Ga0070660_1000393644 195
120 3300005344 Ga0070661_100157898 Ga0070661_1001578982 195
121 3300005355 Ga0070671_100267480 Ga0070671_1002674802 195
122 3300005366 Ga0070659_100359833 Ga0070659_1003598332 195
123 3300005435 Ga0070714_100031659 Ga0070714_1000316595 195
124 3300005435 Ga0070714_100133767 Ga0070714_1001337672 195
125 3300005435 Ga0070714_100446168 Ga0070714_1004461682 195
126 3300005435 Ga0070714_100752081 Ga0070714_1007520811 195
127 3300005436 Ga0070713_100000441 Ga0070713_10000044125 195
128 3300005436 Ga0070713_100007620 Ga0070713_1000076206 195
129 3300005436 Ga0070713_100013545 Ga0070713_1000135454 195
130 3300005436 Ga0070713_100134367 Ga0070713_1001343671 195
131 3300005439 Ga0070711_100005922 Ga0070711_1000059223 195
132 3300005439 Ga0070711_100137176 Ga0070711_1001371762 195
133 3300005457 Ga0070662_100282563 Ga0070662_1002825632 195
134 3300005458 Ga0070681_10018999 Ga0070681_100189992 195
135 3300005458 Ga0070681_10191500 Ga0070681_101915002 195
136 3300005530 Ga0070679_100250148 Ga0070679_1002501482 195
137 3300005535 Ga0070684_100000012 Ga0070684_100000012136 195
138 3300005546 Ga0070696_100883854 Ga0070696_1008838542 195
139 3300005563 Ga0068855_100263335 Ga0068855_1002633352 195
140 3300005563 Ga0068855_100833125 Ga0068855_1008331252 195
141 3300005564 Ga0070664_100043507 Ga0070664_1000435073 195
142 3300005577 Ga0068857_100091368 Ga0068857_1000913682 195
143 3300005578 Ga0068854_100022813 Ga0068854_1000228132 195
144 3300005614 Ga0068856_100010274 Ga0068856_1000102746 195
145 3300005614 Ga0068856_100097796 Ga0068856_1000977963 195
146 3300005614 Ga0068856_100134259 Ga0068856_1001342593 195
147 3300005616 Ga0068852_100118155 Ga0068852_1001181554 195
148 3300005618 Ga0068864_100417490 Ga0068864_1004174902 195
149 3300005834 Ga0068851_10004133 Ga0068851_100041332 195
150 3300005841 Ga0068863_100030784 Ga0068863_1000307845 195
151 3300006163 Ga0070715_10032767 Ga0070715_100327672 195
152 3300006175 Ga0070712_100000618 Ga0070712_1000006186 195
153 3300006175 Ga0070712_100072370 Ga0070712_1000723703 195
154 3300006175 Ga0070712_100105021 Ga0070712_1001050213 195
155 3300006175 Ga0070712_100585364 Ga0070712_1005853641 195
156 3300006237 Ga0097621_100100757 Ga0097621_1001007572 195
157 3300006237 Ga0097621_100554534 Ga0097621_1005545342 195
158 3300009093 Ga0105240_10102802 Ga0105240_101028025 195
159 3300009093 Ga0105240_10120460 Ga0105240_101204602 195
160 3300009174 Ga0105241_10006802 Ga0105241_100068026 195
161 3300009177 Ga0105248_10064893 Ga0105248_100648932 195
162 3300009545 Ga0105237_10098788 Ga0105237_100987882 195
163 3300009551 Ga0105238_10045706 Ga0105238_100457065 195
164 3300010375 Ga0105239_10131716 Ga0105239_101317162 195
165 3300010375 Ga0105239_11271662 Ga0105239_112716622 195
166 3300013104 Ga0157370_10142125 Ga0157370_101421253 195
167 3300013105 Ga0157369_10181551 Ga0157369_101815513 195
168 3300013105 Ga0157369_10221743 Ga0157369_102217432 195
169 3300013105 Ga0157369_10440596 Ga0157369_104405961 195
170 3300013296 Ga0157374_10016590 Ga0157374_100165904 195
171 3300013297 Ga0157378_10057220 Ga0157378_100572202 195
172 3300013307 Ga0157372_10042655 Ga0157372_100426552 195
173 3300013307 Ga0157372_10160416 Ga0157372_101604163 195
174 3300013307 Ga0157372_10552166 Ga0157372_105521662 195
175 3300013307 Ga0157372_10644518 Ga0157372_106445181 195
176 3300014497 Ga0182008_10021442 Ga0182008_100214422 195
177 3300014745 Ga0157377_10140231 Ga0157377_101402312 195
178 3300015262 Ga0182007_10003556 Ga0182007_100035563 195
179 3300015262 Ga0182007_10035180 Ga0182007_100351801 195
180 3300015265 Ga0182005_1015497 Ga0182005_10154972 195
181 3300025321 Ga0207656_10101569 Ga0207656_101015692 195
182 3300025906 Ga0207699_10000209 Ga0207699_1000020921 195
183 3300025907 Ga0207645_10488268 Ga0207645_104882682 195
184 3300025911 Ga0207654_10125613 Ga0207654_101256132 195
185 3300025912 Ga0207707_10152524 Ga0207707_101525242 195
186 3300025912 Ga0207707_10218470 Ga0207707_102184701 195
187 3300025913 Ga0207695_10098428 Ga0207695_100984283 195
188 3300025914 Ga0207671_10123347 Ga0207671_101233473 195
189 3300025915 Ga0207693_10000026 Ga0207693_1000002648 195
190 3300025915 Ga0207693_10084361 Ga0207693_100843613 195
191 3300025915 Ga0207693_10171956 Ga0207693_101719562 195
192 3300025915 Ga0207693_10568332 Ga0207693_105683322 195
193 3300025916 Ga0207663_10079713 Ga0207663_100797132 195
194 3300025919 Ga0207657_10000734 Ga0207657_1000073425 195
195 3300025920 Ga0207649_10596295 Ga0207649_105962951 195
196 3300025921 Ga0207652_10309404 Ga0207652_103094042 195
197 3300025921 Ga0207652_10445028 Ga0207652_104450281 195
198 3300025924 Ga0207694_10030154 Ga0207694_100301542 195
199 3300025928 Ga0207700_10000306 Ga0207700_1000030619 195
200 3300025928 Ga0207700_10033738 Ga0207700_100337383 195
201 3300025928 Ga0207700_10070101 Ga0207700_100701012 195
202 3300025928 Ga0207700_10134363 Ga0207700_101343631 195
203 3300025928 Ga0207700_10242667 Ga0207700_102426672 195
204 3300025929 Ga0207664_10036740 Ga0207664_100367402 195
205 3300025929 Ga0207664_10355438 Ga0207664_103554382 195
206 3300025931 Ga0207644_10043093 Ga0207644_100430932 195
207 3300025932 Ga0207690_10380823 Ga0207690_103808232 195
208 3300025933 Ga0207706_10002540 Ga0207706_100025407 195
209 3300025939 Ga0207665_10041512 Ga0207665_100415122 195
210 3300025941 Ga0207711_10070016 Ga0207711_100700163 195
211 3300025944 Ga0207661_10000003 Ga0207661_10000003474 195
212 3300025949 Ga0207667_10085153 Ga0207667_100851533 195
213 3300025949 Ga0207667_11470757 Ga0207667_114707571 195
214 3300025981 Ga0207640_10236209 Ga0207640_102362092 195
215 3300026023 Ga0207677_10644072 Ga0207677_106440722 195
216 3300026041 Ga0207639_10304207 Ga0207639_103042072 195
217 3300026078 Ga0207702_10087077 Ga0207702_100870772 195
218 3300026078 Ga0207702_10110295 Ga0207702_101102952 195
219 3300026088 Ga0207641_11510486 Ga0207641_115104861 195
220 3300026116 Ga0207674_10108132 Ga0207674_101081323 195
221 3300026142 Ga0207698_10512240 Ga0207698_105122401 195
222 3300031249 Ga0265339_10097025 Ga0265339_100970252 195
223 3300031250 Ga0265331_10071947 Ga0265331_100719472 195
224 3300031344 Ga0265316_10192947 Ga0265316_101929472 195
225 3300031712 Ga0265342_10255454 Ga0265342_102554541 195
226 3300035086 Ga0373934_0095718 Ga0373934_0095718_24_611 195
227 3300035692 Ga0373935_0337797 Ga0373935_0337797_375_962 195
228 3300036401 Ga0373937_0437845 Ga0373937_0437845_287_874 195
229 3300036401 Ga0373937_0532452 Ga0373937_0532452_165_779 195
230 3300044712 Ga0453684_1039479 Ga0453684_1039479_103_699 195
231 3300046472 Ga0495580_0023319 Ga0495580_0023319_1358_1945 195
232 3300046472 Ga0495580_0035448 Ga0495580_0035448_2479_3093 195
233 3300046511 Ga0495608_0094355 Ga0495608_0094355_270_884 195
234 3300046529 Ga0495652_0267677 Ga0495652_0267677_158_781 195
235 3300046542 Ga0495597_0129583 Ga0495597_0129583_345_932 195
236 3300046559 Ga0495667_0021053 Ga0495667_0021053_2798_3412 195
237 3300046679 Ga0495623_0070232 Ga0495623_0070232_1101_1715 195
238 3300047319 Ga0495674_0491966 Ga0495674_0491966_133_747 195
239 3300047444 Ga0495675_0062844 Ga0495675_0062844_1272_1886 195
240 3300047471 Ga0495684_0012376 Ga0495684_0012376_697_1311 195
241 3300048088 Ga0495602_0124558 Ga0495602_0124558_1374_1988 195
242 3300048903 Ga0496100_0201946 Ga0496100_0201946_196_783 195
243 3300048904 Ga0496101_0134964 Ga0496101_0134964_935_1522 195
244 3300048905 Ga0496102_0062825 Ga0496102_0062825_1042_1629 195
245 3300048906 Ga0496103_0068956 Ga0496103_0068956_461_1048 195
246 3300048907 Ga0496104_0033407 Ga0496104_0033407_2376_2963 195
247 3300048908 Ga0496105_0075007 Ga0496105_0075007_484_1071 195
248 3300048909 Ga0496106_0405614 Ga0496106_0405614_157_744 195
249 3300048912 Ga0496109_0214432 Ga0496109_0214432_596_1183 195
250 3300048913 Ga0496110_0015129 Ga0496110_0015129_3104_3691 195
251 3300048915 Ga0496112_0487621 Ga0496112_0487621_268_855 195
252 3300048916 Ga0496113_0188096 Ga0496113_0188096_467_1054 195
253 3300005329 Ga0070683_100172155 Ga0070683_1001721551 196
254 3300005334 Ga0068869_100663966 Ga0068869_1006639662 196
255 3300005340 Ga0070689_100273318 Ga0070689_1002733182 196
256 3300005340 Ga0070689_100706555 Ga0070689_1007065552 196
257 3300005434 Ga0070709_10029013 Ga0070709_100290132 196
258 3300005436 Ga0070713_100188999 Ga0070713_1001889992 196
259 3300005436 Ga0070713_101342043 Ga0070713_1013420431 196
260 3300005437 Ga0070710_10308230 Ga0070710_103082302 196
261 3300005439 Ga0070711_100073773 Ga0070711_1000737732 196
262 3300005535 Ga0070684_100006986 Ga0070684_1000069863 196
263 3300005548 Ga0070665_100515810 Ga0070665_1005158102 196
264 3300005618 Ga0068864_100775414 Ga0068864_1007754141 196
265 3300005841 Ga0068863_100100958 Ga0068863_1001009583 196
266 3300005842 Ga0068858_101187163 Ga0068858_1011871631 196
267 3300006173 Ga0070716_100035194 Ga0070716_1000351943 196
268 3300006173 Ga0070716_100222453 Ga0070716_1002224532 196
269 3300006175 Ga0070712_100081286 Ga0070712_1000812863 196
270 3300006175 Ga0070712_100546753 Ga0070712_1005467531 196
271 3300009098 Ga0105245_10331270 Ga0105245_103312702 196
272 3300009177 Ga0105248_10148064 Ga0105248_101480643 196
273 3300009177 Ga0105248_10310607 Ga0105248_103106071 196
274 3300009177 Ga0105248_10335364 Ga0105248_103353643 196
275 3300009545 Ga0105237_10015526 Ga0105237_100155264 196
276 3300009545 Ga0105237_10891073 Ga0105237_108910731 196
277 3300009551 Ga0105238_10558339 Ga0105238_105583392 196
278 3300010375 Ga0105239_10044777 Ga0105239_100447773 196
279 3300011119 Ga0105246_10550236 Ga0105246_105502362 196
280 3300013296 Ga0157374_10072789 Ga0157374_100727894 196
281 3300013306 Ga0163162_10547556 Ga0163162_105475563 196
282 3300013306 Ga0163162_11967925 Ga0163162_119679251 196
283 3300013308 Ga0157375_10939265 Ga0157375_109392651 196
284 3300014325 Ga0163163_10009479 Ga0163163_100094796 196
285 3300014325 Ga0163163_10009809 Ga0163163_100098092 196
286 3300014325 Ga0163163_10117975 Ga0163163_101179752 196
287 3300014325 Ga0163163_10420359 Ga0163163_104203592 196
288 3300014969 Ga0157376_10005005 Ga0157376_100050052 196
289 3300017792 Ga0163161_10183483 Ga0163161_101834833 196
290 3300025898 Ga0207692_10369624 Ga0207692_103696242 196
291 3300025913 Ga0207695_10004010 Ga0207695_1000401014 196
292 3300025914 Ga0207671_10044854 Ga0207671_100448541 196
293 3300025915 Ga0207693_10026362 Ga0207693_100263624 196
294 3300025916 Ga0207663_10370320 Ga0207663_103703201 196
295 3300025924 Ga0207694_10883105 Ga0207694_108831051 196
296 3300025936 Ga0207670_10269899 Ga0207670_102698991 196
297 3300025941 Ga0207711_10066861 Ga0207711_100668612 196
298 3300025941 Ga0207711_10095749 Ga0207711_100957493 196
299 3300025941 Ga0207711_10345001 Ga0207711_103450012 196
300 3300025941 Ga0207711_10712585 Ga0207711_107125852 196
301 3300025942 Ga0207689_10280422 Ga0207689_102804222 196
302 3300025944 Ga0207661_10689291 Ga0207661_106892912 196
303 3300025986 Ga0207658_10591554 Ga0207658_105915542 196
304 3300026023 Ga0207677_10177066 Ga0207677_101770662 196
305 3300026035 Ga0207703_10768259 Ga0207703_107682592 196
306 3300026088 Ga0207641_10082261 Ga0207641_100822613 196
307 3300031344 Ga0265316_10140022 Ga0265316_101400221 196
308 3300031344 Ga0265316_10249817 Ga0265316_102498172 196
309 3300031548 Ga0307408_100152076 Ga0307408_1001520762 196
310 3300031731 Ga0307405_10013056 Ga0307405_100130563 196
311 3300031824 Ga0307413_10093964 Ga0307413_100939642 196
312 3300031852 Ga0307410_10011350 Ga0307410_100113503 196
313 3300031852 Ga0307410_10019394 Ga0307410_100193942 196
314 3300031901 Ga0307406_10015404 Ga0307406_100154043 196
315 3300031903 Ga0307407_10116037 Ga0307407_101160373 196
316 3300031903 Ga0307407_10263805 Ga0307407_102638051 196
317 3300031911 Ga0307412_10353244 Ga0307412_103532442 196
318 3300031995 Ga0307409_100078288 Ga0307409_1000782883 196
319 3300031995 Ga0307409_100752564 Ga0307409_1007525642 196
320 3300032002 Ga0307416_100060990 Ga0307416_1000609903 196
321 3300032002 Ga0307416_100122663 Ga0307416_1001226633 196
322 3300032005 Ga0307411_10047205 Ga0307411_100472052 196
323 3300032005 Ga0307411_10152033 Ga0307411_101520333 196
324 3300032126 Ga0307415_100029680 Ga0307415_1000296803 196
325 3300035695 Ga0373927_0218593 Ga0373927_0218593_477_1067 196
326 3300036401 Ga0373937_0321289 Ga0373937_0321289_25_615 196
327 3300037068 Ga0373925_0293846 Ga0373925_0293846_628_1218 196
328 3300037471 Ga0395905_0996523 Ga0395905_0996523_49_642 196
329 3300039453 Ga0436362_0417381 Ga0436362_0417381_23_616 196
330 3300045051 Ga0451576_0390582 Ga0451576_0390582_644_1243 196
331 3300046472 Ga0495580_0109097 Ga0495580_0109097_1076_1666 196
332 3300046472 Ga0495580_0337045 Ga0495580_0337045_102_719 196
333 3300046516 Ga0495628_0238957 Ga0495628_0238957_234_851 196
334 3300046543 Ga0495645_0048164 Ga0495645_0048164_81_698 196
335 3300046543 Ga0495645_0217162 Ga0495645_0217162_226_822 196
336 3300046559 Ga0495667_0504123 Ga0495667_0504123_114_710 196
337 3300046663 Ga0495635_0083069 Ga0495635_0083069_1356_1952 196
338 3300046679 Ga0495623_0209966 Ga0495623_0209966_21_617 196
339 3300047444 Ga0495675_0340738 Ga0495675_0340738_183_779 196
340 3300048088 Ga0495602_0135022 Ga0495602_0135022_622_1218 196
341 3300048905 Ga0496102_0043668 Ga0496102_0043668_1218_1808 196
342 3300048918 Ga0496115_0669528 Ga0496115_0669528_70_666 196
343 3300049519 Ga0501296_009665 Ga0501296_009665_81_680 196
344 3300049521 Ga0501298_005780 Ga0501298_005780_112_711 196
345 3300049585 Ga0501069_0129243 Ga0501069_0129243_685_1275 196
346 3300049686 Ga0501257_028974 Ga0501257_028974_178_777 196
347 3300005329 Ga0070683_100172502 Ga0070683_1001725022 197
348 3300005336 Ga0070680_100044909 Ga0070680_1000449093 197
349 3300005344 Ga0070661_100300620 Ga0070661_1003006201 197
350 3300005434 Ga0070709_10002941 Ga0070709_100029418 197
351 3300005435 Ga0070714_100015780 Ga0070714_1000157807 197
352 3300005435 Ga0070714_100153943 Ga0070714_1001539432 197
353 3300005436 Ga0070713_100000134 Ga0070713_10000013416 197
354 3300005436 Ga0070713_100160653 Ga0070713_1001606532 197
355 3300005436 Ga0070713_100251471 Ga0070713_1002514712 197
356 3300005436 Ga0070713_100489836 Ga0070713_1004898361 197
357 3300005437 Ga0070710_10008950 Ga0070710_100089504 197
358 3300005437 Ga0070710_10049876 Ga0070710_100498763 197
359 3300005437 Ga0070710_10300764 Ga0070710_103007642 197
360 3300005439 Ga0070711_100000271 Ga0070711_1000002717 197
361 3300005439 Ga0070711_100045473 Ga0070711_1000454734 197
362 3300005439 Ga0070711_100056293 Ga0070711_1000562933 197
363 3300005439 Ga0070711_100101616 Ga0070711_1001016162 197
364 3300005457 Ga0070662_100265422 Ga0070662_1002654224 197
365 3300005458 Ga0070681_10003858 Ga0070681_100038587 197
366 3300005458 Ga0070681_10120493 Ga0070681_101204934 197
367 3300005468 Ga0070707_100098525 Ga0070707_1000985252 197
368 3300005471 Ga0070698_101075734 Ga0070698_1010757341 197
369 3300005530 Ga0070679_100006572 Ga0070679_1000065724 197
370 3300005530 Ga0070679_100865629 Ga0070679_1008656292 197
371 3300005535 Ga0070684_100090646 Ga0070684_1000906462 197
372 3300005563 Ga0068855_100039804 Ga0068855_1000398044 197
373 3300005577 Ga0068857_100008251 Ga0068857_1000082513 197
374 3300005614 Ga0068856_100278065 Ga0068856_1002780652 197
375 3300005614 Ga0068856_100469825 Ga0068856_1004698251 197
376 3300005616 Ga0068852_100176071 Ga0068852_1001760712 197
377 3300005618 Ga0068864_100061650 Ga0068864_1000616503 197
378 3300005841 Ga0068863_100018704 Ga0068863_1000187045 197
379 3300006028 Ga0070717_10001624 Ga0070717_1000162410 197
380 3300006028 Ga0070717_10015703 Ga0070717_100157035 197
381 3300006028 Ga0070717_10120618 Ga0070717_101206183 197
382 3300006028 Ga0070717_10187222 Ga0070717_101872221 197
383 3300006163 Ga0070715_10001203 Ga0070715_100012038 197
384 3300006173 Ga0070716_100000113 Ga0070716_1000001135 197
385 3300006173 Ga0070716_100006183 Ga0070716_1000061837 197
386 3300006173 Ga0070716_100095885 Ga0070716_1000958852 197
387 3300006175 Ga0070712_100000262 Ga0070712_1000002628 197
388 3300006175 Ga0070712_100004634 Ga0070712_1000046346 197
389 3300006175 Ga0070712_100037406 Ga0070712_1000374064 197
390 3300006175 Ga0070712_100578286 Ga0070712_1005782861 197
391 3300006852 Ga0075433_10110820 Ga0075433_101108202 197
392 3300006871 Ga0075434_100004984 Ga0075434_10000498411 197
393 3300007076 Ga0075435_100191727 Ga0075435_1001917271 197
394 3300009177 Ga0105248_10261816 Ga0105248_102618163 197
395 3300009551 Ga0105238_11158071 Ga0105238_111580711 197
396 3300010375 Ga0105239_10051978 Ga0105239_100519782 197
397 3300011119 Ga0105246_10640643 Ga0105246_106406431 197
398 3300013105 Ga0157369_10000299 Ga0157369_1000029964 197
399 3300013105 Ga0157369_10213168 Ga0157369_102131682 197
400 3300013296 Ga0157374_10064262 Ga0157374_100642623 197
401 3300013306 Ga0163162_11870365 Ga0163162_118703651 197
402 3300014325 Ga0163163_10002018 Ga0163163_100020188 197
403 3300014325 Ga0163163_10051413 Ga0163163_100514132 197
404 3300014325 Ga0163163_10211496 Ga0163163_102114962 197
405 3300014969 Ga0157376_10178505 Ga0157376_101785053 197
406 3300014969 Ga0157376_10515535 Ga0157376_105155351 197
407 3300025898 Ga0207692_10003745 Ga0207692_100037455 197
408 3300025898 Ga0207692_10099109 Ga0207692_100991093 197
409 3300025898 Ga0207692_10259032 Ga0207692_102590322 197
410 3300025898 Ga0207692_10288523 Ga0207692_102885231 197
411 3300025905 Ga0207685_10000745 Ga0207685_100007457 197
412 3300025906 Ga0207699_10006400 Ga0207699_100064005 197
413 3300025906 Ga0207699_10042939 Ga0207699_100429391 197
414 3300025906 Ga0207699_10047965 Ga0207699_100479652 197
415 3300025906 Ga0207699_10080297 Ga0207699_100802972 197
416 3300025906 Ga0207699_10481679 Ga0207699_104816791 197
417 3300025906 Ga0207699_10573046 Ga0207699_105730461 197
418 3300025910 Ga0207684_10024360 Ga0207684_100243601 197
419 3300025912 Ga0207707_10013290 Ga0207707_100132904 197
420 3300025912 Ga0207707_10449172 Ga0207707_104491722 197
421 3300025915 Ga0207693_10000275 Ga0207693_1000027536 197
422 3300025915 Ga0207693_10006920 Ga0207693_100069206 197
423 3300025915 Ga0207693_10007857 Ga0207693_100078574 197
424 3300025915 Ga0207693_10527289 Ga0207693_105272891 197
425 3300025916 Ga0207663_10015635 Ga0207663_100156352 197
426 3300025916 Ga0207663_10040443 Ga0207663_100404433 197
427 3300025921 Ga0207652_10009354 Ga0207652_100093544 197
428 3300025922 Ga0207646_10167696 Ga0207646_101676962 197
429 3300025928 Ga0207700_10125356 Ga0207700_101253563 197
430 3300025928 Ga0207700_10147366 Ga0207700_101473662 197
431 3300025928 Ga0207700_10187400 Ga0207700_101874002 197
432 3300025929 Ga0207664_10000087 Ga0207664_1000008745 197
433 3300025929 Ga0207664_10012370 Ga0207664_100123703 197
434 3300025929 Ga0207664_10019525 Ga0207664_100195255 197
435 3300025929 Ga0207664_10251116 Ga0207664_102511161 197
436 3300025939 Ga0207665_10000378 Ga0207665_100003785 197
437 3300025939 Ga0207665_10116978 Ga0207665_101169782 197
438 3300025944 Ga0207661_10170580 Ga0207661_101705802 197
439 3300025949 Ga0207667_10066114 Ga0207667_100661143 197
440 3300026088 Ga0207641_10112273 Ga0207641_101122733 197
441 3300026095 Ga0207676_10642436 Ga0207676_106424362 197
442 3300026116 Ga0207674_10010225 Ga0207674_100102254 197
443 3300026116 Ga0207674_10026353 Ga0207674_100263533 197
444 3300028800 Ga0265338_10003313 Ga0265338_100033139 197
445 3300028800 Ga0265338_10011557 Ga0265338_100115573 197
446 3300028800 Ga0265338_10084846 Ga0265338_100848462 197
447 3300028800 Ga0265338_10200839 Ga0265338_102008392 197
448 3300028800 Ga0265338_10219890 Ga0265338_102198903 197
449 3300031090 Ga0265760_10063354 Ga0265760_100633542 197
450 3300031235 Ga0265330_10107147 Ga0265330_101071472 197
451 3300031238 Ga0265332_10011313 Ga0265332_100113132 197
452 3300031238 Ga0265332_10052063 Ga0265332_100520632 197
453 3300031239 Ga0265328_10019249 Ga0265328_100192493 197
454 3300031239 Ga0265328_10071933 Ga0265328_100719332 197
455 3300031241 Ga0265325_10008405 Ga0265325_100084052 197
456 3300031241 Ga0265325_10044574 Ga0265325_100445742 197
457 3300031241 Ga0265325_10337724 Ga0265325_103377241 197
458 3300031247 Ga0265340_10011576 Ga0265340_100115764 197
459 3300031247 Ga0265340_10039410 Ga0265340_100394103 197
460 3300031247 Ga0265340_10042480 Ga0265340_100424802 197
461 3300031247 Ga0265340_10091526 Ga0265340_100915262 197
462 3300031249 Ga0265339_10015513 Ga0265339_100155132 197
463 3300031249 Ga0265339_10075737 Ga0265339_100757372 197
464 3300031249 Ga0265339_10128431 Ga0265339_101284312 197
465 3300031250 Ga0265331_10043370 Ga0265331_100433703 197
466 3300031250 Ga0265331_10185008 Ga0265331_101850082 197
467 3300031251 Ga0265327_10029065 Ga0265327_100290653 197
468 3300031344 Ga0265316_10011708 Ga0265316_100117086 197
469 3300031344 Ga0265316_10013616 Ga0265316_100136168 197
470 3300031344 Ga0265316_10045745 Ga0265316_100457452 197
471 3300031344 Ga0265316_10091718 Ga0265316_100917182 197
472 3300031344 Ga0265316_10096204 Ga0265316_100962042 197
473 3300031344 Ga0265316_10109120 Ga0265316_101091203 197
474 3300031344 Ga0265316_10144278 Ga0265316_101442781 197
475 3300031595 Ga0265313_10029444 Ga0265313_100294441 197
476 3300031712 Ga0265342_10062190 Ga0265342_100621902 197
477 3300031712 Ga0265342_10130283 Ga0265342_101302832 197
478 3300031712 Ga0265342_10186218 Ga0265342_101862182 197
479 3300035083 Ga0373926_0067130 Ga0373926_0067130_341_934 197
480 3300035086 Ga0373934_0108509 Ga0373934_0108509_302_895 197
481 3300035111 Ga0373923_0024164 Ga0373923_0024164_244_837 197
482 3300035113 Ga0373936_0019394 Ga0373936_0019394_1076_1669 197
483 3300035113 Ga0373936_0035469 Ga0373936_0035469_1258_1851 197
484 3300035116 Ga0373945_0008745 Ga0373945_0008745_41_634 197
485 3300035116 Ga0373945_0009368 Ga0373945_0009368_1011_1604 197
486 3300035117 Ga0373953_0127369 Ga0373953_0127369_10_603 197
487 3300035120 Ga0373957_0112755 Ga0373957_0112755_163_756 197
488 3300035170 Ga0373943_0001626 Ga0373943_0001626_7252_7845 197
489 3300035171 Ga0373946_0007422 Ga0373946_0007422_2862_3455 197
490 3300035172 Ga0373955_0007025 Ga0373955_0007025_3837_4430 197
491 3300035410 Ga0373924_0060056 Ga0373924_0060056_939_1532 197
492 3300035692 Ga0373935_0005817 Ga0373935_0005817_5049_5642 197
493 3300035692 Ga0373935_0177769 Ga0373935_0177769_337_957 197
494 3300035695 Ga0373927_0005658 Ga0373927_0005658_4203_4796 197
495 3300035695 Ga0373927_0510111 Ga0373927_0510111_24_617 197
496 3300035724 Ga0373933_0058022 Ga0373933_0058022_586_1179 197
497 3300035724 Ga0373933_0074113 Ga0373933_0074113_276_869 197
498 3300035724 Ga0373933_0347727 Ga0373933_0347727_74_667 197
499 3300035725 Ga0373947_0005213 Ga0373947_0005213_2048_2641 197
500 3300035725 Ga0373947_0033579 Ga0373947_0033579_478_1071 197
501 3300035725 Ga0373947_0091948 Ga0373947_0091948_634_1254 197
502 3300035725 Ga0373947_0612340 Ga0373947_0612340_32_631 197
503 3300036401 Ga0373937_0891447 Ga0373937_0891447_115_708 197
504 3300037068 Ga0373925_0004658 Ga0373925_0004658_2346_2939 197
505 3300037068 Ga0373925_0129617 Ga0373925_0129617_791_1384 197
506 3300037068 Ga0373925_0478959 Ga0373925_0478959_171_791 197
507 3300037068 Ga0373925_0657610 Ga0373925_0657610_229_822 197
508 3300039450 Ga0436363_1670777 Ga0436363_1670777_396_989 197
509 3300042876 Ga0451577_0088529 Ga0451577_0088529_2120_2719 197
510 3300042876 Ga0451577_0231907 Ga0451577_0231907_154_753 197
511 3300044694 Ga0466963_0363900 Ga0466963_0363900_242_838 197
512 3300044712 Ga0453684_1352734 Ga0453684_1352734_103_711 197
513 3300045051 Ga0451576_0014682 Ga0451576_0014682_2470_3069 197
514 3300045051 Ga0451576_0913402 Ga0451576_0913402_216_815 197
515 3300045051 Ga0451576_1576639 Ga0451576_1576639_64_660 197
516 3300046459 Ga0495629_0530594 Ga0495629_0530594_122_715 197
517 3300046472 Ga0495580_0001289 Ga0495580_0001289_17336_17929 197
518 3300046472 Ga0495580_0001629 Ga0495580_0001629_7487_8086 197
519 3300046472 Ga0495580_0001942 Ga0495580_0001942_3027_3626 197
520 3300046472 Ga0495580_0002140 Ga0495580_0002140_2825_3418 197
521 3300046472 Ga0495580_0022575 Ga0495580_0022575_2182_2784 197
522 3300046473 Ga0495582_0002195 Ga0495582_0002195_10252_10845 197
523 3300046477 Ga0495664_0197227 Ga0495664_0197227_240_860 197
524 3300046491 Ga0495584_0359412 Ga0495584_0359412_118_717 197
525 3300046516 Ga0495628_0291006 Ga0495628_0291006_401_1021 197
526 3300046517 Ga0495630_0159613 Ga0495630_0159613_334_927 197
527 3300046526 Ga0495666_0296234 Ga0495666_0296234_125_718 197
528 3300046531 Ga0495665_0086863 Ga0495665_0086863_889_1482 197
529 3300046531 Ga0495665_0130241 Ga0495665_0130241_459_1067 197
530 3300046533 Ga0495640_0120533 Ga0495640_0120533_968_1588 197
531 3300046535 Ga0495586_0336996 Ga0495586_0336996_19_639 197
532 3300046678 Ga0495599_0313790 Ga0495599_0313790_292_912 197
533 3300046679 Ga0495623_0225280 Ga0495623_0225280_139_759 197
534 3300046683 Ga0495658_0020496 Ga0495658_0020496_760_1353 197
535 3300046684 Ga0495669_0071717 Ga0495669_0071717_638_1231 197
536 3300046689 Ga0495613_0091852 Ga0495613_0091852_1449_2042 197
537 3300046690 Ga0495624_0317867 Ga0495624_0317867_177_770 197
538 3300047317 Ga0495604_0581456 Ga0495604_0581456_88_681 197
539 3300047319 Ga0495674_0053954 Ga0495674_0053954_1572_2165 197
540 3300047319 Ga0495674_0077571 Ga0495674_0077571_863_1456 197
541 3300047321 Ga0495676_0531589 Ga0495676_0531589_94_687 197
542 3300047471 Ga0495684_0454842 Ga0495684_0454842_195_815 197
543 3300047471 Ga0495684_0518357 Ga0495684_0518357_175_768 197
544 3300047673 Ga0495593_0219838 Ga0495593_0219838_230_823 197
545 3300048088 Ga0495602_0054542 Ga0495602_0054542_245_865 197
546 3300048907 Ga0496104_0050964 Ga0496104_0050964_2445_3038 197
547 3300048908 Ga0496105_0471417 Ga0496105_0471417_282_875 197
548 3300048911 Ga0496108_0810520 Ga0496108_0810520_60_668 197
549 3300048913 Ga0496110_0894563 Ga0496110_0894563_64_672 197
550 3300048915 Ga0496112_0074774 Ga0496112_0074774_244_852 197
551 3300048915 Ga0496112_0487958 Ga0496112_0487958_508_1104 197
552 3300048918 Ga0496115_0003194 Ga0496115_0003194_9923_10516 197
553 3300050512 nmdc:mga0n895_3653_c1 nmdc:mga0n895_3653_c1_2845_3444 197
554 3300050513 nmdc:mga0rr50_197673_c1 nmdc:mga0rr50_197673_c1_975_1574 197
555 3300050514 nmdc:mga08x19_9468_c1 nmdc:mga08x19_9468_c1_782_1381 197
556 3300050515 nmdc:mga0a205_56054_c1 nmdc:mga0a205_56054_c1_2864_3463 197
557 3300053077 Ga0495601_0102137 Ga0495601_0102137_1114_1707 197
558 3300053085 Ga0495619_0395395 Ga0495619_0395395_286_894 197
559 3300005436 Ga0070713_100989354 Ga0070713_1009893541 198
560 3300005437 Ga0070710_10002183 Ga0070710_100021835 198
561 3300025898 Ga0207692_10001607 Ga0207692_100016075 198
562 3300025910 Ga0207684_10171974 Ga0207684_101719742 198
563 3300025922 Ga0207646_10115834 Ga0207646_101158342 198
564 3300028036 Ga0265355_1000430 Ga0265355_10004302 198
565 3300030878 Ga0265770_1010399 Ga0265770_10103992 198
566 3300030879 Ga0265765_1002649 Ga0265765_10026492 198
567 3300030879 Ga0265765_1016532 Ga0265765_10165322 198
568 3300031090 Ga0265760_10007781 Ga0265760_100077812 198
569 3300031090 Ga0265760_10024863 Ga0265760_100248632 198
570 3300031247 Ga0265340_10059053 Ga0265340_100590532 198
571 3300031711 Ga0265314_10005392 Ga0265314_100053926 198
572 3300031711 Ga0265314_10039432 Ga0265314_100394322 198
573 3300045051 Ga0451576_0343409 Ga0451576_0343409_586_1188 198
574 3300046678 Ga0495599_0272622 Ga0495599_0272622_382_987 198
575 3300046679 Ga0495623_0224364 Ga0495623_0224364_186_791 198
576 3300048088 Ga0495602_0147010 Ga0495602_0147010_131_736 198
577 3300048088 Ga0495602_0403179 Ga0495602_0403179_358_954 198
578 2162886012 MBSR1b_contig_1198449 MBSR1b_0011.00005160 199
579 2162886012 MBSR1b_contig_8674379 MBSR1b_0863.00007130 199
580 2162886012 MBSR1b_contig_9766659 MBSR1b_0152.00000170 199
581 3300001976 JGI24752J21851_1006675 JGI24752J21851_10066752 199
582 3300001978 JGI24747J21853_1000701 JGI24747J21853_10007012 199
583 3300001991 JGI24743J22301_10005717 JGI24743J22301_100057172 199
584 3300002076 JGI24749J21850_1007403 JGI24749J21850_10074031 199
585 3300002239 JGI24034J26672_10001382 JGI24034J26672_100013824 199
586 3300002239 JGI24034J26672_10001383 JGI24034J26672_100013833 199
587 3300002459 JGI24751J29686_10000869 JGI24751J29686_100008696 199
588 3300005290 Ga0065712_10075947 Ga0065712_100759474 199
589 3300005293 Ga0065715_10003405 Ga0065715_100034054 199
590 3300005327 Ga0070658_10061915 Ga0070658_100619153 199
591 3300005328 Ga0070676_10004067 Ga0070676_100040672 199
592 3300005329 Ga0070683_100000533 Ga0070683_10000053311 199
593 3300005331 Ga0070670_100033379 Ga0070670_1000333792 199
594 3300005331 Ga0070670_100197815 Ga0070670_1001978152 199
595 3300005333 Ga0070677_10057274 Ga0070677_100572742 199
596 3300005334 Ga0068869_100153510 Ga0068869_1001535102 199
597 3300005335 Ga0070666_10043322 Ga0070666_100433223 199
598 3300005337 Ga0070682_100021004 Ga0070682_1000210044 199
599 3300005338 Ga0068868_100006775 Ga0068868_1000067753 199
600 3300005338 Ga0068868_100066103 Ga0068868_1000661032 199
601 3300005339 Ga0070660_100001060 Ga0070660_1000010609 199
602 3300005340 Ga0070689_100012831 Ga0070689_1000128313 199
603 3300005343 Ga0070687_100007584 Ga0070687_1000075843 199
604 3300005344 Ga0070661_100029564 Ga0070661_1000295642 199
605 3300005347 Ga0070668_100004691 Ga0070668_10000469110 199
606 3300005353 Ga0070669_100004930 Ga0070669_1000049302 199
607 3300005354 Ga0070675_100305514 Ga0070675_1003055141 199
608 3300005355 Ga0070671_100198234 Ga0070671_1001982342 199
609 3300005355 Ga0070671_100353968 Ga0070671_1003539682 199
610 3300005356 Ga0070674_100003936 Ga0070674_1000039363 199
611 3300005365 Ga0070688_100000378 Ga0070688_1000003787 199
612 3300005366 Ga0070659_100004918 Ga0070659_1000049188 199
613 3300005438 Ga0070701_10037568 Ga0070701_100375682 199
614 3300005441 Ga0070700_100187937 Ga0070700_1001879371 199
615 3300005455 Ga0070663_100005199 Ga0070663_1000051996 199
616 3300005455 Ga0070663_100648986 Ga0070663_1006489862 199
617 3300005458 Ga0070681_10831091 Ga0070681_108310912 199
618 3300005535 Ga0070684_100005118 Ga0070684_1000051185 199
619 3300005539 Ga0068853_100062588 Ga0068853_1000625882 199
620 3300005543 Ga0070672_100003124 Ga0070672_1000031249 199
621 3300005544 Ga0070686_100350177 Ga0070686_1003501772 199
622 3300005548 Ga0070665_100889235 Ga0070665_1008892352 199
623 3300005563 Ga0068855_100195131 Ga0068855_1001951313 199
624 3300005564 Ga0070664_100104340 Ga0070664_1001043402 199
625 3300005577 Ga0068857_100002432 Ga0068857_10000243212 199
626 3300005614 Ga0068856_100120944 Ga0068856_1001209443 199
627 3300005617 Ga0068859_100011366 Ga0068859_1000113662 199
628 3300005618 Ga0068864_100002059 Ga0068864_1000020597 199
629 3300005718 Ga0068866_10007446 Ga0068866_100074463 199
630 3300005719 Ga0068861_100155144 Ga0068861_1001551442 199
631 3300005834 Ga0068851_10008504 Ga0068851_100085045 199
632 3300005841 Ga0068863_100058413 Ga0068863_1000584132 199
633 3300005841 Ga0068863_100085129 Ga0068863_1000851292 199
634 3300005842 Ga0068858_100016136 Ga0068858_1000161367 199
635 3300005843 Ga0068860_100293184 Ga0068860_1002931842 199
636 3300005844 Ga0068862_100084677 Ga0068862_1000846772 199
637 3300005844 Ga0068862_100123710 Ga0068862_1001237102 199
638 3300006358 Ga0068871_100027596 Ga0068871_1000275962 199
639 3300006881 Ga0068865_100036139 Ga0068865_1000361392 199
640 3300006931 Ga0097620_100011366 Ga0097620_1000113662 199
641 3300009092 Ga0105250_10010971 Ga0105250_100109715 199
642 3300009093 Ga0105240_10026610 Ga0105240_100266105 199
643 3300009098 Ga0105245_10005901 Ga0105245_100059013 199
644 3300009098 Ga0105245_10012755 Ga0105245_100127554 199
645 3300009101 Ga0105247_10008845 Ga0105247_100088455 199
646 3300009174 Ga0105241_10007216 Ga0105241_100072163 199
647 3300009177 Ga0105248_10141947 Ga0105248_101419473 199
648 3300009545 Ga0105237_10079314 Ga0105237_100793144 199
649 3300009553 Ga0105249_10028800 Ga0105249_100288004 199
650 3300009553 Ga0105249_10041076 Ga0105249_100410763 199
651 3300010375 Ga0105239_10005687 Ga0105239_1000568712 199
652 3300010375 Ga0105239_10258807 Ga0105239_102588073 199
653 3300011119 Ga0105246_10016424 Ga0105246_100164243 199
654 3300013104 Ga0157370_10599761 Ga0157370_105997612 199
655 3300013105 Ga0157369_10012638 Ga0157369_100126385 199
656 3300013297 Ga0157378_10867282 Ga0157378_108672822 199
657 3300013306 Ga0163162_10022906 Ga0163162_100229063 199
658 3300013307 Ga0157372_10001242 Ga0157372_1000124219 199
659 3300013307 Ga0157372_10426129 Ga0157372_104261292 199
660 3300013308 Ga0157375_10087636 Ga0157375_100876363 199
661 3300014325 Ga0163163_10010446 Ga0163163_100104462 199
662 3300014325 Ga0163163_10031232 Ga0163163_100312324 199
663 3300014326 Ga0157380_10031994 Ga0157380_100319943 199
664 3300014497 Ga0182008_10022661 Ga0182008_100226613 199
665 3300014745 Ga0157377_10000323 Ga0157377_100003235 199
666 3300014968 Ga0157379_10003917 Ga0157379_1000391711 199
667 3300014969 Ga0157376_10241578 Ga0157376_102415782 199
668 3300015261 Ga0182006_1008649 Ga0182006_10086493 199
669 3300015262 Ga0182007_10019228 Ga0182007_100192283 199
670 3300017792 Ga0163161_10002760 Ga0163161_100027603 199
671 3300025315 Ga0207697_10002298 Ga0207697_100022989 199
672 3300025321 Ga0207656_10009745 Ga0207656_100097452 199
673 3300025893 Ga0207682_10053306 Ga0207682_100533062 199
674 3300025899 Ga0207642_10031650 Ga0207642_100316502 199
675 3300025900 Ga0207710_10041907 Ga0207710_100419072 199
676 3300025901 Ga0207688_10005486 Ga0207688_100054865 199
677 3300025904 Ga0207647_10000837 Ga0207647_100008372 199
678 3300025907 Ga0207645_10000020 Ga0207645_1000002068 199
679 3300025908 Ga0207643_10017059 Ga0207643_100170594 199
680 3300025909 Ga0207705_10062814 Ga0207705_100628143 199
681 3300025912 Ga0207707_10710463 Ga0207707_107104632 199
682 3300025913 Ga0207695_10162125 Ga0207695_101621252 199
683 3300025914 Ga0207671_10313845 Ga0207671_103138452 199
684 3300025918 Ga0207662_10000337 Ga0207662_100003372 199
685 3300025919 Ga0207657_10005925 Ga0207657_100059254 199
686 3300025920 Ga0207649_10000281 Ga0207649_100002814 199
687 3300025921 Ga0207652_10457705 Ga0207652_104577051 199
688 3300025925 Ga0207650_10000076 Ga0207650_1000007697 199
689 3300025927 Ga0207687_10008503 Ga0207687_100085034 199
690 3300025929 Ga0207664_10944598 Ga0207664_109445981 199
691 3300025931 Ga0207644_10019111 Ga0207644_100191114 199
692 3300025931 Ga0207644_10687880 Ga0207644_106878802 199
693 3300025932 Ga0207690_10084483 Ga0207690_100844832 199
694 3300025933 Ga0207706_10000684 Ga0207706_100006849 199
695 3300025936 Ga0207670_10023873 Ga0207670_100238735 199
696 3300025937 Ga0207669_10413638 Ga0207669_104136382 199
697 3300025938 Ga0207704_10197282 Ga0207704_101972822 199
698 3300025940 Ga0207691_10000533 Ga0207691_1000053325 199
699 3300025941 Ga0207711_10016329 Ga0207711_100163295 199
700 3300025942 Ga0207689_10000097 Ga0207689_1000009764 199
701 3300025944 Ga0207661_10000329 Ga0207661_1000032916 199
702 3300025945 Ga0207679_10000086 Ga0207679_1000008667 199
703 3300025949 Ga0207667_10424647 Ga0207667_104246472 199
704 3300025960 Ga0207651_10025675 Ga0207651_100256752 199
705 3300025961 Ga0207712_10380382 Ga0207712_103803821 199
706 3300026023 Ga0207677_10011159 Ga0207677_100111596 199
707 3300026023 Ga0207677_10062846 Ga0207677_100628462 199
708 3300026035 Ga0207703_10003138 Ga0207703_100031389 199
709 3300026041 Ga0207639_10292189 Ga0207639_102921892 199
710 3300026067 Ga0207678_10000092 Ga0207678_1000009259 199
711 3300026067 Ga0207678_10584931 Ga0207678_105849312 199
712 3300026078 Ga0207702_10074218 Ga0207702_100742183 199
713 3300026088 Ga0207641_10001986 Ga0207641_100019864 199
714 3300026088 Ga0207641_10030963 Ga0207641_100309633 199
715 3300026089 Ga0207648_10000027 Ga0207648_1000002721 199
716 3300026095 Ga0207676_10000301 Ga0207676_100003018 199
717 3300026116 Ga0207674_10002631 Ga0207674_1000263112 199
718 3300026118 Ga0207675_100207491 Ga0207675_1002074912 199
719 3300026121 Ga0207683_10001351 Ga0207683_100013515 199
720 3300028379 Ga0268266_10001514 Ga0268266_100015145 199
721 3300028380 Ga0268265_10081488 Ga0268265_100814882 199
722 3300028380 Ga0268265_10093670 Ga0268265_100936702 199
723 3300028381 Ga0268264_10023678 Ga0268264_100236782 199
724 3300028381 Ga0268264_10062355 Ga0268264_100623552 199
725 3300048905 Ga0496102_0877343 Ga0496102_0877343_49_654 199
726 3300048915 Ga0496112_0177422 Ga0496112_0177422_824_1423 199
727 3300050513 nmdc:mga0rr50_529409_c1 nmdc:mga0rr50_529409_c1_153_758 199
728 3300050514 nmdc:mga08x19_113661_c1 nmdc:mga08x19_113661_c1_671_1276 199
729 3300050514 nmdc:mga08x19_298406_c1 nmdc:mga08x19_298406_c1_76_681 199
730 3300050514 nmdc:mga08x19_347814_c1 nmdc:mga08x19_347814_c1_235_840 199

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01558

POR

Pyruvate ferredoxin/flavodoxin oxidoreductase

12

174

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3on3-assembly2.cif.gz_A the crystal structure of keto/oxoacid ferredoxin oxidoreductase, gamma subunit from geobacter sulfurreducens pca 0.923 4 178
3on3-assembly3.cif.gz_B the crystal structure of keto/oxoacid ferredoxin oxidoreductase, gamma subunit from geobacter sulfurreducens pca 0.9159 1 180
3on3-assembly3.cif.gz_B the crystal structure of keto/oxoacid ferredoxin oxidoreductase, gamma subunit from geobacter sulfurreducens pca 0.9109 1 180
3on3-assembly2.cif.gz_A the crystal structure of keto/oxoacid ferredoxin oxidoreductase, gamma subunit from geobacter sulfurreducens pca 0.9072 4 178
3g2e-assembly1.cif.gz_D structure of putative oorc subunit of 2-oxoglutarate:acceptor oxidoreductase from campylobacter jejuni 0.9042 1 182
ID Description Score Start End Superfamily
3on3A00 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.9149 4 178 3.40.920.10
3on3A00 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.8992 4 178 3.40.920.10
3g2eC00 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.8964 3 182 3.40.920.10
3g2eC00 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.8872 3 182 3.40.920.10
af_Q2FZ05_1_182_3.40.920.10 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.875 1 177 3.40.920.10
ID Description Score Start End GO Terms
AF-A0A7C5HJL1-F1-model_v4 Pyruvate ferredoxin oxidoreductase 0.981 4 175 GO:0016903
AF-A0A7V1ZHL4-F1-model_v4 Pyruvate ferredoxin oxidoreductase 0.9768 27 177 GO:0016903
AF-A0A7C7R8G7-F1-model_v4 deleted 0.9756 4 177
AF-A0A812ACJ7-F1-model_v4 deleted 0.9748 72 176
AF-A0A7C0Y387-F1-model_v4 Pyruvate ferredoxin oxidoreductase 0.9736 1 177 GO:0016020
GO:0016903

Feature Viewer

pLDDT pTM Quality
87.63 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map