F477572
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 724 | 263 | 1448 | 324 |
Family's Representative Sequence
| Representative Sequence | 3300045051|Ga0451576_0412739|Ga0451576_0412739_389_1357 |
| Length | 311 |
| Sequence | LKVRVFYHDKCFDGASSAALFSRFYRERIRSDVEFEFSGLLHRAGALFNEADFDGDENAIVDFKYSSSPKITWWFDHHESAFLTPEDAEHFEQDQSNRKFYDPDFKSCTSFLAMIAQQRFGFNPAPVADLIRWTDIIDGAMYEDARTAVEMKAPAMKLTMVIESAPDQTFVPKLIPLLATKSLGQIIELARHQRSISILEERTKSKDGTLFFDVTDQELEGYNKFVPYYLHPESIYSVGLSKSAFRVKVSVGSNPWAPSEPKVNLARVCERYGGGGHARVGAISFDVTQAEAARKAAAEIVAELRASVRQG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 104 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 106 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 107 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 108 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 109 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 110 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 166 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 167 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 168 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 169 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 170 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 171 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 172 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 173 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 174 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 175 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 176 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 178 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 179 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 180 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 181 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 182 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 183 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 184 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 186 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 187 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 188 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 189 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 190 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 192 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 195 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 196 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 197 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 200 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 201 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 202 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 203 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 204 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 205 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 206 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 207 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 208 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 209 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 210 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 211 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 212 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 213 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 214 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 215 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 216 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 243 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 244 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 245 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 246 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 247 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 248 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 251 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 252 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 253 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 254 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 255 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 256 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.31 |
| Metatranscriptomes | 0.69 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.7 |
| Rhizosphere | 94.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 24.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0451576_0412739 | 3300045051 | Bacteria | 1416 |
| 2 | JGI24743J22301_10000297 | 3300001991 | Bacteria | 5388 |
| 3 | JGI24034J26672_10007352 | 3300002239 | Bacteria | 1598 |
| 4 | JGI24751J29686_10002567 | 3300002459 | Bacteria | 3648 |
| 5 | Ga0065715_10002200 | 3300005293 | Bacteria | 6969 |
| 6 | Ga0070658_10015333 | 3300005327 | Bacteria | 6134 |
| 7 | Ga0070658_10280834 | 3300005327 | Unclassified | 1417 |
| 8 | Ga0070683_100000948 | 3300005329 | Bacteria | 21592 |
| 9 | Ga0070683_100046063 | 3300005329 | Unclassified | 4027 |
| 10 | Ga0070683_100061746 | 3300005329 | Bacteria | 3484 |
| 11 | Ga0070683_100082742 | 3300005329 | Bacteria | 3006 |
| 12 | Ga0070670_100000465 | 3300005331 | Bacteria | 32818 |
| 13 | Ga0070670_100162135 | 3300005331 | Bacteria | 1938 |
| 14 | Ga0068869_100001747 | 3300005334 | Bacteria | 12996 |
| 15 | Ga0068869_100026879 | 3300005334 | Bacteria | 4007 |
| 16 | Ga0070666_10132304 | 3300005335 | Bacteria | 1734 |
| 17 | Ga0070680_100000708 | 3300005336 | Bacteria | 23147 |
| 18 | Ga0070680_100009342 | 3300005336 | Bacteria | 7535 |
| 19 | Ga0070680_100143419 | 3300005336 | Unclassified | 2003 |
| 20 | Ga0070680_100168959 | 3300005336 | Unclassified | 1840 |
| 21 | Ga0070680_100181267 | 3300005336 | Bacteria | 1774 |
| 22 | Ga0068868_100011788 | 3300005338 | Bacteria | 6373 |
| 23 | Ga0068868_100026948 | 3300005338 | Bacteria | 4382 |
| 24 | Ga0068868_100057262 | 3300005338 | Unclassified | 3079 |
| 25 | Ga0068868_100070459 | 3300005338 | Bacteria | 2788 |
| 26 | Ga0068868_100525471 | 3300005338 | Unclassified | 1039 |
| 27 | Ga0070660_100007017 | 3300005339 | Bacteria | 7821 |
| 28 | Ga0070660_100079015 | 3300005339 | Bacteria | 2580 |
| 29 | Ga0070689_100073188 | 3300005340 | Bacteria | 2679 |
| 30 | Ga0070689_100099309 | 3300005340 | Bacteria | 2303 |
| 31 | Ga0070691_10027682 | 3300005341 | Bacteria | 2646 |
| 32 | Ga0070687_100022400 | 3300005343 | Unclassified | 2986 |
| 33 | Ga0070661_100020047 | 3300005344 | Bacteria | 4766 |
| 34 | Ga0070668_100103695 | 3300005347 | Bacteria | 2256 |
| 35 | Ga0070669_100004172 | 3300005353 | Bacteria | 10468 |
| 36 | Ga0070671_100102207 | 3300005355 | Bacteria | 2405 |
| 37 | Ga0070674_100001332 | 3300005356 | Bacteria | 13017 |
| 38 | Ga0070673_100295721 | 3300005364 | Unclassified | 1424 |
| 39 | Ga0070667_100140961 | 3300005367 | Unclassified | 2111 |
| 40 | Ga0070709_10014903 | 3300005434 | Unclassified | 4411 |
| 41 | Ga0070709_10025037 | 3300005434 | Bacteria | 3521 |
| 42 | Ga0070709_10058779 | 3300005434 | Unclassified | 2439 |
| 43 | Ga0070709_10109539 | 3300005434 | Bacteria | 1854 |
| 44 | Ga0070714_100000027 | 3300005435 | Bacteria | 141750 |
| 45 | Ga0070714_100029083 | 3300005435 | Bacteria | 4591 |
| 46 | Ga0070714_100037860 | 3300005435 | Bacteria | 4055 |
| 47 | Ga0070714_100085531 | 3300005435 | Unclassified | 2754 |
| 48 | Ga0070714_100118721 | 3300005435 | Bacteria | 2350 |
| 49 | Ga0070713_100002409 | 3300005436 | Bacteria | 12197 |
| 50 | Ga0070713_100004204 | 3300005436 | Bacteria | 9609 |
| 51 | Ga0070713_100006386 | 3300005436 | Bacteria | 8168 |
| 52 | Ga0070713_100012942 | 3300005436 | Bacteria | 6142 |
| 53 | Ga0070713_100016512 | 3300005436 | Bacteria | 5551 |
| 54 | Ga0070713_100062974 | 3300005436 | Unclassified | 3108 |
| 55 | Ga0070713_100096446 | 3300005436 | Bacteria | 2553 |
| 56 | Ga0070713_100130060 | 3300005436 | Bacteria | 2219 |
| 57 | Ga0070713_100134973 | 3300005436 | Unclassified | 2180 |
| 58 | Ga0070713_100159047 | 3300005436 | Bacteria | 2015 |
| 59 | Ga0070713_100346389 | 3300005436 | Unclassified | 1378 |
| 60 | Ga0070710_10022868 | 3300005437 | Bacteria | 3277 |
| 61 | Ga0070711_100000156 | 3300005439 | Bacteria | 36746 |
| 62 | Ga0070711_100000304 | 3300005439 | Bacteria | 25467 |
| 63 | Ga0070711_100014373 | 3300005439 | Unclassified | 4989 |
| 64 | Ga0070711_100047550 | 3300005439 | Bacteria | 2930 |
| 65 | Ga0070711_100144236 | 3300005439 | Unclassified | 1789 |
| 66 | Ga0070708_100000298 | 3300005445 | Bacteria | 37307 |
| 67 | Ga0070708_100001922 | 3300005445 | Bacteria | 16006 |
| 68 | Ga0070708_100005192 | 3300005445 | Bacteria | 10305 |
| 69 | Ga0070708_100019309 | 3300005445 | Bacteria | 5725 |
| 70 | Ga0070708_100197049 | 3300005445 | Unclassified | 1884 |
| 71 | Ga0070708_100545452 | 3300005445 | Unclassified | 1094 |
| 72 | Ga0070678_100159603 | 3300005456 | Unclassified | 1825 |
| 73 | Ga0070662_100002092 | 3300005457 | Bacteria | 12242 |
| 74 | Ga0070681_10000026 | 3300005458 | Bacteria | 107615 |
| 75 | Ga0070681_10000917 | 3300005458 | Bacteria | 24912 |
| 76 | Ga0070681_10007353 | 3300005458 | Bacteria | 10764 |
| 77 | Ga0070681_10013159 | 3300005458 | Bacteria | 8219 |
| 78 | Ga0070681_10343990 | 3300005458 | Unclassified | 1401 |
| 79 | Ga0068867_100002397 | 3300005459 | Bacteria | 13186 |
| 80 | Ga0070685_10004302 | 3300005466 | Bacteria | 7187 |
| 81 | Ga0070685_10193551 | 3300005466 | Bacteria | 1317 |
| 82 | Ga0070706_100000529 | 3300005467 | Bacteria | 44433 |
| 83 | Ga0070706_100010695 | 3300005467 | Bacteria | 8518 |
| 84 | Ga0070706_100012153 | 3300005467 | Bacteria | 7982 |
| 85 | Ga0070706_100013300 | 3300005467 | Bacteria | 7610 |
| 86 | Ga0070706_100021529 | 3300005467 | Bacteria | 5936 |
| 87 | Ga0070706_100098714 | 3300005467 | Bacteria | 2714 |
| 88 | Ga0070707_100003422 | 3300005468 | Bacteria | 15002 |
| 89 | Ga0070707_100006081 | 3300005468 | Bacteria | 11261 |
| 90 | Ga0070707_100024732 | 3300005468 | Bacteria | 5692 |
| 91 | Ga0070707_100074576 | 3300005468 | Bacteria | 3272 |
| 92 | Ga0070707_100092479 | 3300005468 | Unclassified | 2928 |
| 93 | Ga0070707_100097214 | 3300005468 | Unclassified | 2852 |
| 94 | Ga0070707_100219343 | 3300005468 | Bacteria | 1853 |
| 95 | Ga0070707_100355134 | 3300005468 | Bacteria | 1423 |
| 96 | Ga0070698_100000171 | 3300005471 | Bacteria | 60242 |
| 97 | Ga0070698_100000200 | 3300005471 | Bacteria | 57460 |
| 98 | Ga0070698_100091922 | 3300005471 | Bacteria | 3016 |
| 99 | Ga0070699_100000156 | 3300005518 | Bacteria | 64338 |
| 100 | Ga0070699_100106252 | 3300005518 | Unclassified | 2462 |
| 101 | Ga0070679_100000089 | 3300005530 | Bacteria | 69218 |
| 102 | Ga0070679_100002685 | 3300005530 | Bacteria | 16206 |
| 103 | Ga0070679_100005671 | 3300005530 | Bacteria | 11574 |
| 104 | Ga0070679_100014664 | 3300005530 | Bacteria | 7532 |
| 105 | Ga0070679_100190982 | 3300005530 | Unclassified | 2017 |
| 106 | Ga0070679_100195428 | 3300005530 | Unclassified | 1991 |
| 107 | Ga0070684_100079169 | 3300005535 | Unclassified | 2905 |
| 108 | Ga0070684_100082300 | 3300005535 | Bacteria | 2850 |
| 109 | Ga0070684_100154691 | 3300005535 | Bacteria | 2079 |
| 110 | Ga0070697_100000056 | 3300005536 | Bacteria | 86619 |
| 111 | Ga0070697_100002625 | 3300005536 | Bacteria | 13834 |
| 112 | Ga0070697_100003289 | 3300005536 | Bacteria | 12419 |
| 113 | Ga0070697_100004805 | 3300005536 | Bacteria | 10353 |
| 114 | Ga0070697_100038007 | 3300005536 | Bacteria | 3888 |
| 115 | Ga0070697_100047871 | 3300005536 | Bacteria | 3466 |
| 116 | Ga0070697_100050715 | 3300005536 | Bacteria | 3369 |
| 117 | Ga0070697_100411663 | 3300005536 | Bacteria | 1174 |
| 118 | Ga0068853_100002847 | 3300005539 | Bacteria | 13108 |
| 119 | Ga0068853_100014810 | 3300005539 | Bacteria | 6401 |
| 120 | Ga0068853_100034256 | 3300005539 | Bacteria | 4310 |
| 121 | Ga0068853_100064700 | 3300005539 | Bacteria | 3172 |
| 122 | Ga0068853_100353595 | 3300005539 | Unclassified | 1367 |
| 123 | Ga0070672_100023020 | 3300005543 | Bacteria | 4587 |
| 124 | Ga0070686_100160404 | 3300005544 | Unclassified | 1583 |
| 125 | Ga0070695_100017135 | 3300005545 | Bacteria | 4394 |
| 126 | Ga0070696_100114171 | 3300005546 | Unclassified | 1948 |
| 127 | Ga0070693_100037763 | 3300005547 | Bacteria | 2695 |
| 128 | Ga0070693_100040330 | 3300005547 | Unclassified | 2621 |
| 129 | Ga0070693_100079438 | 3300005547 | Unclassified | 1952 |
| 130 | Ga0070665_100020883 | 3300005548 | Bacteria | 6581 |
| 131 | Ga0068855_100000295 | 3300005563 | Bacteria | 61909 |
| 132 | Ga0068855_100001626 | 3300005563 | Bacteria | 28175 |
| 133 | Ga0068855_100009839 | 3300005563 | Bacteria | 11535 |
| 134 | Ga0068855_100012882 | 3300005563 | Bacteria | 10090 |
| 135 | Ga0068855_100118884 | 3300005563 | Bacteria | 3026 |
| 136 | Ga0068855_100174297 | 3300005563 | Unclassified | 2434 |
| 137 | Ga0070664_100008525 | 3300005564 | Bacteria | 8289 |
| 138 | Ga0070664_100046932 | 3300005564 | Bacteria | 3649 |
| 139 | Ga0070664_100157577 | 3300005564 | Unclassified | 2007 |
| 140 | Ga0070664_100171100 | 3300005564 | Bacteria | 1927 |
| 141 | Ga0068857_100000036 | 3300005577 | Bacteria | 72327 |
| 142 | Ga0068857_100011629 | 3300005577 | Bacteria | 7656 |
| 143 | Ga0068857_100029146 | 3300005577 | Bacteria | 4871 |
| 144 | Ga0068857_100113590 | 3300005577 | Bacteria | 2435 |
| 145 | Ga0068857_100194140 | 3300005577 | Unclassified | 1850 |
| 146 | Ga0068854_100003663 | 3300005578 | Bacteria | 9611 |
| 147 | Ga0068854_100021952 | 3300005578 | Bacteria | 4340 |
| 148 | Ga0068854_100041266 | 3300005578 | Unclassified | 3260 |
| 149 | Ga0068854_100070652 | 3300005578 | Unclassified | 2552 |
| 150 | Ga0068854_100082449 | 3300005578 | Bacteria | 2377 |
| 151 | Ga0068856_100000407 | 3300005614 | Bacteria | 47326 |
| 152 | Ga0068856_100001013 | 3300005614 | Bacteria | 29894 |
| 153 | Ga0068856_100002064 | 3300005614 | Bacteria | 20820 |
| 154 | Ga0068856_100004340 | 3300005614 | Bacteria | 14135 |
| 155 | Ga0068856_100007633 | 3300005614 | Bacteria | 10555 |
| 156 | Ga0068856_100025333 | 3300005614 | Bacteria | 5783 |
| 157 | Ga0068856_100035548 | 3300005614 | Unclassified | 4883 |
| 158 | Ga0068856_100091746 | 3300005614 | Bacteria | 3021 |
| 159 | Ga0070702_100011920 | 3300005615 | Bacteria | 4338 |
| 160 | Ga0068852_100084084 | 3300005616 | Bacteria | 2831 |
| 161 | Ga0068852_100161574 | 3300005616 | Unclassified | 2092 |
| 162 | Ga0068852_100476785 | 3300005616 | Bacteria | 1239 |
| 163 | Ga0068859_100001163 | 3300005617 | Bacteria | 26891 |
| 164 | Ga0068859_100021096 | 3300005617 | Bacteria | 6537 |
| 165 | Ga0068859_100034435 | 3300005617 | Bacteria | 5083 |
| 166 | Ga0068864_100000684 | 3300005618 | Bacteria | 28437 |
| 167 | Ga0068864_100060781 | 3300005618 | Bacteria | 3271 |
| 168 | Ga0068864_100343359 | 3300005618 | Unclassified | 1407 |
| 169 | Ga0068864_100402543 | 3300005618 | Unclassified | 1301 |
| 170 | Ga0068866_10011816 | 3300005718 | Unclassified | 3790 |
| 171 | Ga0068861_100040659 | 3300005719 | Bacteria | 3479 |
| 172 | Ga0068861_100065343 | 3300005719 | Bacteria | 2802 |
| 173 | Ga0068861_100176281 | 3300005719 | Unclassified | 1776 |
| 174 | Ga0068851_10032801 | 3300005834 | Bacteria | 2584 |
| 175 | Ga0068851_10043646 | 3300005834 | Bacteria | 2260 |
| 176 | Ga0068851_10090220 | 3300005834 | Bacteria | 1613 |
| 177 | Ga0068863_100020834 | 3300005841 | Bacteria | 6262 |
| 178 | Ga0068863_100087340 | 3300005841 | Bacteria | 2955 |
| 179 | Ga0068863_100130521 | 3300005841 | Bacteria | 2399 |
| 180 | Ga0068863_100209430 | 3300005841 | Bacteria | 1877 |
| 181 | Ga0068863_100230567 | 3300005841 | Unclassified | 1786 |
| 182 | Ga0068858_100026968 | 3300005842 | Bacteria | 5336 |
| 183 | Ga0068858_100150628 | 3300005842 | Bacteria | 2187 |
| 184 | Ga0068860_100062973 | 3300005843 | Bacteria | 3524 |
| 185 | Ga0068860_100099957 | 3300005843 | Bacteria | 2767 |
| 186 | Ga0068860_100124227 | 3300005843 | Unclassified | 2474 |
| 187 | Ga0081540_1049573 | 3300005983 | Bacteria | 2094 |
| 188 | Ga0070717_10001574 | 3300006028 | Bacteria | 15793 |
| 189 | Ga0070717_10006266 | 3300006028 | Bacteria | 8735 |
| 190 | Ga0070717_10020532 | 3300006028 | Bacteria | 5198 |
| 191 | Ga0070717_10026447 | 3300006028 | Bacteria | 4628 |
| 192 | Ga0070717_10028046 | 3300006028 | Bacteria | 4503 |
| 193 | Ga0070717_10028452 | 3300006028 | Bacteria | 4475 |
| 194 | Ga0070717_10056698 | 3300006028 | Bacteria | 3238 |
| 195 | Ga0070717_10203301 | 3300006028 | Bacteria | 1736 |
| 196 | Ga0070715_10057377 | 3300006163 | Bacteria | 1696 |
| 197 | Ga0070715_10096424 | 3300006163 | Unclassified | 1371 |
| 198 | Ga0070716_100000185 | 3300006173 | Bacteria | 24458 |
| 199 | Ga0070716_100007184 | 3300006173 | Bacteria | 5476 |
| 200 | Ga0070716_100007574 | 3300006173 | Bacteria | 5355 |
| 201 | Ga0070716_100034314 | 3300006173 | Bacteria | 2781 |
| 202 | Ga0070716_100088774 | 3300006173 | Bacteria | 1866 |
| 203 | Ga0070716_100168406 | 3300006173 | Bacteria | 1427 |
| 204 | Ga0070712_100002131 | 3300006175 | Bacteria | 12167 |
| 205 | Ga0070712_100003676 | 3300006175 | Bacteria | 9452 |
| 206 | Ga0070712_100024694 | 3300006175 | Bacteria | 3986 |
| 207 | Ga0070712_100087255 | 3300006175 | Unclassified | 2276 |
| 208 | Ga0070712_100113725 | 3300006175 | Unclassified | 2025 |
| 209 | Ga0070712_100157733 | 3300006175 | Bacteria | 1749 |
| 210 | Ga0097621_100000237 | 3300006237 | Bacteria | 37036 |
| 211 | Ga0097621_100006889 | 3300006237 | Bacteria | 8086 |
| 212 | Ga0097621_100016228 | 3300006237 | Bacteria | 5624 |
| 213 | Ga0097621_100022568 | 3300006237 | Bacteria | 4887 |
| 214 | Ga0097621_100037953 | 3300006237 | Bacteria | 3864 |
| 215 | Ga0097621_100127926 | 3300006237 | Unclassified | 2159 |
| 216 | Ga0097621_100284429 | 3300006237 | Bacteria | 1456 |
| 217 | Ga0068871_100001088 | 3300006358 | Bacteria | 18235 |
| 218 | Ga0068871_100002121 | 3300006358 | Bacteria | 13435 |
| 219 | Ga0068871_100021859 | 3300006358 | Bacteria | 4925 |
| 220 | Ga0068871_100023682 | 3300006358 | Bacteria | 4753 |
| 221 | Ga0068871_100082408 | 3300006358 | Bacteria | 2667 |
| 222 | Ga0068871_100219605 | 3300006358 | Unclassified | 1646 |
| 223 | Ga0075433_10003606 | 3300006852 | Bacteria | 11964 |
| 224 | Ga0075433_10005374 | 3300006852 | Bacteria | 10063 |
| 225 | Ga0075434_100000136 | 3300006871 | Bacteria | 44550 |
| 226 | Ga0075434_100000335 | 3300006871 | Bacteria | 33966 |
| 227 | Ga0068865_100015067 | 3300006881 | Unclassified | 4925 |
| 228 | Ga0068865_100034361 | 3300006881 | Bacteria | 3401 |
| 229 | Ga0068865_100050939 | 3300006881 | Unclassified | 2863 |
| 230 | Ga0075436_100001252 | 3300006914 | Bacteria | 17251 |
| 231 | Ga0075436_100002510 | 3300006914 | Bacteria | 12616 |
| 232 | Ga0075436_100003564 | 3300006914 | Bacteria | 10677 |
| 233 | Ga0075436_100009483 | 3300006914 | Bacteria | 6655 |
| 234 | Ga0097620_100001163 | 3300006931 | Bacteria | 26891 |
| 235 | Ga0097620_100021096 | 3300006931 | Bacteria | 6537 |
| 236 | Ga0097620_100034435 | 3300006931 | Bacteria | 5083 |
| 237 | Ga0075435_100001721 | 3300007076 | Bacteria | 14220 |
| 238 | Ga0075435_100005877 | 3300007076 | Bacteria | 8637 |
| 239 | Ga0075435_100050348 | 3300007076 | Bacteria | 3352 |
| 240 | Ga0075435_100218499 | 3300007076 | Bacteria | 1618 |
| 241 | Ga0105240_10014500 | 3300009093 | Bacteria | 10761 |
| 242 | Ga0105240_10020964 | 3300009093 | Bacteria | 8700 |
| 243 | Ga0105240_10032233 | 3300009093 | Bacteria | 6787 |
| 244 | Ga0105240_10106572 | 3300009093 | Unclassified | 3399 |
| 245 | Ga0105240_10592123 | 3300009093 | Bacteria | 1222 |
| 246 | Ga0105245_10000333 | 3300009098 | Bacteria | 44397 |
| 247 | Ga0105245_10003057 | 3300009098 | Bacteria | 14975 |
| 248 | Ga0105245_10023248 | 3300009098 | Bacteria | 5442 |
| 249 | Ga0105245_10177722 | 3300009098 | Bacteria | 2031 |
| 250 | Ga0105247_10079136 | 3300009101 | Unclassified | 2068 |
| 251 | Ga0114129_10030476 | 3300009147 | Bacteria | 7633 |
| 252 | Ga0105241_10005709 | 3300009174 | Bacteria | 9185 |
| 253 | Ga0105241_10042190 | 3300009174 | Unclassified | 3450 |
| 254 | Ga0105241_10063386 | 3300009174 | Bacteria | 2852 |
| 255 | Ga0105241_10108704 | 3300009174 | Bacteria | 2217 |
| 256 | Ga0105241_10148703 | 3300009174 | Bacteria | 1914 |
| 257 | Ga0105241_10176210 | 3300009174 | Bacteria | 1770 |
| 258 | Ga0105242_10043239 | 3300009176 | Bacteria | 3644 |
| 259 | Ga0105242_10100316 | 3300009176 | Bacteria | 2452 |
| 260 | Ga0105242_10151983 | 3300009176 | Unclassified | 2019 |
| 261 | Ga0105242_10167365 | 3300009176 | Bacteria | 1929 |
| 262 | Ga0105242_10356221 | 3300009176 | Bacteria | 1353 |
| 263 | Ga0105248_10003155 | 3300009177 | Bacteria | 18246 |
| 264 | Ga0105248_10048534 | 3300009177 | Bacteria | 4763 |
| 265 | Ga0105248_10054059 | 3300009177 | Unclassified | 4504 |
| 266 | Ga0105248_10128925 | 3300009177 | Bacteria | 2854 |
| 267 | Ga0105237_10026024 | 3300009545 | Bacteria | 5980 |
| 268 | Ga0105237_10026264 | 3300009545 | Bacteria | 5952 |
| 269 | Ga0105237_10071066 | 3300009545 | Unclassified | 3476 |
| 270 | Ga0105237_10141420 | 3300009545 | Bacteria | 2401 |
| 271 | Ga0105237_10209691 | 3300009545 | Unclassified | 1948 |
| 272 | Ga0105237_10217274 | 3300009545 | Unclassified | 1912 |
| 273 | Ga0105238_10000848 | 3300009551 | Bacteria | 31448 |
| 274 | Ga0105238_10020479 | 3300009551 | Bacteria | 6734 |
| 275 | Ga0105238_10031206 | 3300009551 | Bacteria | 5424 |
| 276 | Ga0105238_10068015 | 3300009551 | Bacteria | 3563 |
| 277 | Ga0105238_10172555 | 3300009551 | Bacteria | 2139 |
| 278 | Ga0105249_10013735 | 3300009553 | Bacteria | 7150 |
| 279 | Ga0105249_10129822 | 3300009553 | Bacteria | 2404 |
| 280 | Ga0099796_10010207 | 3300010159 | Bacteria | 2574 |
| 281 | Ga0105239_10026773 | 3300010375 | Bacteria | 6346 |
| 282 | Ga0105239_10133468 | 3300010375 | Unclassified | 2763 |
| 283 | Ga0105239_10152565 | 3300010375 | Unclassified | 2579 |
| 284 | Ga0105239_10251966 | 3300010375 | Bacteria | 1983 |
| 285 | Ga0105239_10283721 | 3300010375 | Unclassified | 1864 |
| 286 | Ga0105239_10448840 | 3300010375 | Bacteria | 1463 |
| 287 | Ga0105246_10005569 | 3300011119 | Bacteria | 7679 |
| 288 | Ga0105246_10056236 | 3300011119 | Unclassified | 2719 |
| 289 | Ga0105246_10075047 | 3300011119 | Bacteria | 2393 |
| 290 | Ga0105246_10227546 | 3300011119 | Bacteria | 1466 |
| 291 | Ga0157373_10000776 | 3300013100 | Bacteria | 24614 |
| 292 | Ga0157373_10008835 | 3300013100 | Bacteria | 7463 |
| 293 | Ga0157373_10012250 | 3300013100 | Bacteria | 6305 |
| 294 | Ga0157371_10007713 | 3300013102 | Bacteria | 8654 |
| 295 | Ga0157371_10027577 | 3300013102 | Unclassified | 4119 |
| 296 | Ga0157370_10010467 | 3300013104 | Bacteria | 9769 |
| 297 | Ga0157370_10209762 | 3300013104 | Unclassified | 1806 |
| 298 | Ga0157370_10295496 | 3300013104 | Bacteria | 1496 |
| 299 | Ga0157369_10000124 | 3300013105 | Bacteria | 110693 |
| 300 | Ga0157369_10000707 | 3300013105 | Bacteria | 42987 |
| 301 | Ga0157369_10027749 | 3300013105 | Bacteria | 6271 |
| 302 | Ga0157369_10047163 | 3300013105 | Unclassified | 4680 |
| 303 | Ga0157369_10050039 | 3300013105 | Unclassified | 4528 |
| 304 | Ga0157369_10088613 | 3300013105 | Bacteria | 3303 |
| 305 | Ga0157369_10096068 | 3300013105 | Unclassified | 3162 |
| 306 | Ga0157369_10151330 | 3300013105 | Bacteria | 2452 |
| 307 | Ga0157369_10277046 | 3300013105 | Bacteria | 1747 |
| 308 | Ga0157369_10437453 | 3300013105 | Bacteria | 1355 |
| 309 | Ga0157369_10524829 | 3300013105 | Unclassified | 1225 |
| 310 | Ga0157374_10000162 | 3300013296 | Bacteria | 61913 |
| 311 | Ga0157374_10000667 | 3300013296 | Bacteria | 30210 |
| 312 | Ga0157374_10011870 | 3300013296 | Bacteria | 7558 |
| 313 | Ga0157374_10012718 | 3300013296 | Bacteria | 7332 |
| 314 | Ga0157374_10031095 | 3300013296 | Unclassified | 4849 |
| 315 | Ga0157374_10107041 | 3300013296 | Bacteria | 2687 |
| 316 | Ga0157374_10184759 | 3300013296 | Unclassified | 2038 |
| 317 | Ga0157378_10000020 | 3300013297 | Bacteria | 131245 |
| 318 | Ga0157378_10000320 | 3300013297 | Bacteria | 47177 |
| 319 | Ga0157378_10003963 | 3300013297 | Bacteria | 13081 |
| 320 | Ga0157378_10004021 | 3300013297 | Bacteria | 12984 |
| 321 | Ga0157378_10036037 | 3300013297 | Unclassified | 4378 |
| 322 | Ga0157378_10056057 | 3300013297 | Bacteria | 3511 |
| 323 | Ga0157378_10178309 | 3300013297 | Unclassified | 1997 |
| 324 | Ga0163162_10004201 | 3300013306 | Bacteria | 13845 |
| 325 | Ga0163162_10016256 | 3300013306 | Bacteria | 7276 |
| 326 | Ga0163162_10024079 | 3300013306 | Bacteria | 6008 |
| 327 | Ga0163162_10059202 | 3300013306 | Bacteria | 3862 |
| 328 | Ga0157372_10000084 | 3300013307 | Bacteria | 98431 |
| 329 | Ga0157372_10001112 | 3300013307 | Bacteria | 29221 |
| 330 | Ga0157372_10005137 | 3300013307 | Bacteria | 13912 |
| 331 | Ga0157372_10009649 | 3300013307 | Bacteria | 10259 |
| 332 | Ga0157372_10011646 | 3300013307 | Bacteria | 9362 |
| 333 | Ga0157372_10079277 | 3300013307 | Bacteria | 3713 |
| 334 | Ga0157372_10114277 | 3300013307 | Bacteria | 3095 |
| 335 | Ga0157372_10282145 | 3300013307 | Bacteria | 1931 |
| 336 | Ga0157372_10468455 | 3300013307 | Bacteria | 1468 |
| 337 | Ga0157375_10070945 | 3300013308 | Bacteria | 3495 |
| 338 | Ga0163163_10035198 | 3300014325 | Bacteria | 4856 |
| 339 | Ga0163163_10035267 | 3300014325 | Bacteria | 4852 |
| 340 | Ga0163163_10035346 | 3300014325 | Unclassified | 4846 |
| 341 | Ga0163163_10045876 | 3300014325 | Unclassified | 4291 |
| 342 | Ga0157377_10000496 | 3300014745 | Bacteria | 16725 |
| 343 | Ga0157377_10096068 | 3300014745 | Unclassified | 1757 |
| 344 | Ga0157379_10002644 | 3300014968 | Bacteria | 15071 |
| 345 | Ga0157379_10015890 | 3300014968 | Bacteria | 6617 |
| 346 | Ga0157379_10051514 | 3300014968 | Unclassified | 3677 |
| 347 | Ga0157379_10142051 | 3300014968 | Bacteria | 2164 |
| 348 | Ga0157376_10193845 | 3300014969 | Bacteria | 1865 |
| 349 | Ga0157376_10431044 | 3300014969 | Unclassified | 1282 |
| 350 | Ga0182007_10004562 | 3300015262 | Bacteria | 6259 |
| 351 | Ga0163161_10008153 | 3300017792 | Bacteria | 7244 |
| 352 | Ga0213875_10032086 | 3300021388 | Bacteria | 2483 |
| 353 | Ga0224570_100720 | 3300022730 | Unclassified | 2642 |
| 354 | Ga0224569_100054 | 3300022732 | Bacteria | 7305 |
| 355 | Ga0224572_1000889 | 3300024225 | Unclassified | 4041 |
| 356 | Ga0228598_1000075 | 3300024227 | Bacteria | 15071 |
| 357 | Ga0228598_1001966 | 3300024227 | Unclassified | 4485 |
| 358 | Ga0207697_10008791 | 3300025315 | Bacteria | 4396 |
| 359 | Ga0207692_10019553 | 3300025898 | Unclassified | 3063 |
| 360 | Ga0207692_10103635 | 3300025898 | Bacteria | 1567 |
| 361 | Ga0207642_10003061 | 3300025899 | Bacteria | 5238 |
| 362 | Ga0207642_10007502 | 3300025899 | Unclassified | 3688 |
| 363 | Ga0207647_10148765 | 3300025904 | Bacteria | 1369 |
| 364 | Ga0207685_10003278 | 3300025905 | Unclassified | 3911 |
| 365 | Ga0207685_10040534 | 3300025905 | Bacteria | 1736 |
| 366 | Ga0207699_10000583 | 3300025906 | Bacteria | 17907 |
| 367 | Ga0207699_10005252 | 3300025906 | Bacteria | 6199 |
| 368 | Ga0207699_10014425 | 3300025906 | Bacteria | 4073 |
| 369 | Ga0207699_10014623 | 3300025906 | Bacteria | 4052 |
| 370 | Ga0207699_10023106 | 3300025906 | Bacteria | 3380 |
| 371 | Ga0207699_10037991 | 3300025906 | Bacteria | 2756 |
| 372 | Ga0207699_10057815 | 3300025906 | Bacteria | 2317 |
| 373 | Ga0207699_10088397 | 3300025906 | Bacteria | 1939 |
| 374 | Ga0207645_10003498 | 3300025907 | Bacteria | 11891 |
| 375 | Ga0207643_10003053 | 3300025908 | Bacteria | 8999 |
| 376 | Ga0207684_10000702 | 3300025910 | Bacteria | 39479 |
| 377 | Ga0207684_10001046 | 3300025910 | Bacteria | 30907 |
| 378 | Ga0207684_10015468 | 3300025910 | Bacteria | 6565 |
| 379 | Ga0207654_10069059 | 3300025911 | Bacteria | 2092 |
| 380 | Ga0207707_10000800 | 3300025912 | Bacteria | 30836 |
| 381 | Ga0207707_10001177 | 3300025912 | Bacteria | 24644 |
| 382 | Ga0207707_10119041 | 3300025912 | Unclassified | 2308 |
| 383 | Ga0207707_10254005 | 3300025912 | Bacteria | 1527 |
| 384 | Ga0207707_10283030 | 3300025912 | Unclassified | 1436 |
| 385 | Ga0207695_10029736 | 3300025913 | Bacteria | 6028 |
| 386 | Ga0207695_10031459 | 3300025913 | Bacteria | 5820 |
| 387 | Ga0207695_10080946 | 3300025913 | Unclassified | 3288 |
| 388 | Ga0207695_10105072 | 3300025913 | Unclassified | 2812 |
| 389 | Ga0207695_10125703 | 3300025913 | Bacteria | 2527 |
| 390 | Ga0207671_10044324 | 3300025914 | Unclassified | 3290 |
| 391 | Ga0207671_10144665 | 3300025914 | Bacteria | 1833 |
| 392 | Ga0207693_10000284 | 3300025915 | Bacteria | 47232 |
| 393 | Ga0207693_10001237 | 3300025915 | Bacteria | 22760 |
| 394 | Ga0207693_10001760 | 3300025915 | Bacteria | 19003 |
| 395 | Ga0207693_10011856 | 3300025915 | Bacteria | 7048 |
| 396 | Ga0207693_10015937 | 3300025915 | Bacteria | 6018 |
| 397 | Ga0207693_10024221 | 3300025915 | Bacteria | 4819 |
| 398 | Ga0207693_10026111 | 3300025915 | Bacteria | 4625 |
| 399 | Ga0207693_10030550 | 3300025915 | Bacteria | 4256 |
| 400 | Ga0207693_10062673 | 3300025915 | Unclassified | 2913 |
| 401 | Ga0207693_10063402 | 3300025915 | Bacteria | 2895 |
| 402 | Ga0207663_10002968 | 3300025916 | Bacteria | 8203 |
| 403 | Ga0207663_10053394 | 3300025916 | Bacteria | 2525 |
| 404 | Ga0207663_10063757 | 3300025916 | Unclassified | 2348 |
| 405 | Ga0207663_10067708 | 3300025916 | Unclassified | 2291 |
| 406 | Ga0207663_10071872 | 3300025916 | Bacteria | 2234 |
| 407 | Ga0207663_10076977 | 3300025916 | Bacteria | 2170 |
| 408 | Ga0207663_10148005 | 3300025916 | Unclassified | 1644 |
| 409 | Ga0207660_10000064 | 3300025917 | Bacteria | 55686 |
| 410 | Ga0207660_10036924 | 3300025917 | Unclassified | 3400 |
| 411 | Ga0207662_10006874 | 3300025918 | Bacteria | 6163 |
| 412 | Ga0207657_10001068 | 3300025919 | Bacteria | 29011 |
| 413 | Ga0207657_10001233 | 3300025919 | Bacteria | 27320 |
| 414 | Ga0207649_10009111 | 3300025920 | Bacteria | 5427 |
| 415 | Ga0207652_10002643 | 3300025921 | Bacteria | 15037 |
| 416 | Ga0207652_10008560 | 3300025921 | Bacteria | 8233 |
| 417 | Ga0207652_10032354 | 3300025921 | Unclassified | 4396 |
| 418 | Ga0207652_10175673 | 3300025921 | Unclassified | 1923 |
| 419 | Ga0207652_10269175 | 3300025921 | Bacteria | 1537 |
| 420 | Ga0207652_10328644 | 3300025921 | Bacteria | 1380 |
| 421 | Ga0207652_10371710 | 3300025921 | Unclassified | 1290 |
| 422 | Ga0207646_10000261 | 3300025922 | Bacteria | 71826 |
| 423 | Ga0207646_10005506 | 3300025922 | Bacteria | 13307 |
| 424 | Ga0207646_10082103 | 3300025922 | Unclassified | 2882 |
| 425 | Ga0207646_10086176 | 3300025922 | Bacteria | 2810 |
| 426 | Ga0207646_10171939 | 3300025922 | Bacteria | 1957 |
| 427 | Ga0207646_10185246 | 3300025922 | Unclassified | 1880 |
| 428 | Ga0207694_10000434 | 3300025924 | Bacteria | 38832 |
| 429 | Ga0207694_10064360 | 3300025924 | Unclassified | 2858 |
| 430 | Ga0207694_10075016 | 3300025924 | Bacteria | 2647 |
| 431 | Ga0207694_10095824 | 3300025924 | Unclassified | 2347 |
| 432 | Ga0207650_10000380 | 3300025925 | Bacteria | 41633 |
| 433 | Ga0207650_10000976 | 3300025925 | Bacteria | 21527 |
| 434 | Ga0207650_10113229 | 3300025925 | Bacteria | 2103 |
| 435 | Ga0207650_10381764 | 3300025925 | Unclassified | 1163 |
| 436 | Ga0207687_10003252 | 3300025927 | Bacteria | 11004 |
| 437 | Ga0207687_10015735 | 3300025927 | Bacteria | 4964 |
| 438 | Ga0207700_10000907 | 3300025928 | Bacteria | 16997 |
| 439 | Ga0207700_10002636 | 3300025928 | Bacteria | 10330 |
| 440 | Ga0207700_10007820 | 3300025928 | Bacteria | 6572 |
| 441 | Ga0207700_10009996 | 3300025928 | Bacteria | 5961 |
| 442 | Ga0207700_10012271 | 3300025928 | Bacteria | 5517 |
| 443 | Ga0207700_10052013 | 3300025928 | Bacteria | 3060 |
| 444 | Ga0207700_10054368 | 3300025928 | Unclassified | 3005 |
| 445 | Ga0207700_10211936 | 3300025928 | Bacteria | 1638 |
| 446 | Ga0207700_10382209 | 3300025928 | Bacteria | 1232 |
| 447 | Ga0207700_10416678 | 3300025928 | Unclassified | 1179 |
| 448 | Ga0207664_10001566 | 3300025929 | Bacteria | 15016 |
| 449 | Ga0207664_10010018 | 3300025929 | Bacteria | 6679 |
| 450 | Ga0207664_10015490 | 3300025929 | Bacteria | 5536 |
| 451 | Ga0207664_10031448 | 3300025929 | Unclassified | 4061 |
| 452 | Ga0207664_10051490 | 3300025929 | Bacteria | 3252 |
| 453 | Ga0207664_10063927 | 3300025929 | Bacteria | 2942 |
| 454 | Ga0207664_10103789 | 3300025929 | Unclassified | 2353 |
| 455 | Ga0207664_10116386 | 3300025929 | Bacteria | 2230 |
| 456 | Ga0207664_10154117 | 3300025929 | Unclassified | 1954 |
| 457 | Ga0207644_10078828 | 3300025931 | Bacteria | 2429 |
| 458 | Ga0207706_10000528 | 3300025933 | Bacteria | 40520 |
| 459 | Ga0207706_10030144 | 3300025933 | Unclassified | 4840 |
| 460 | Ga0207686_10159006 | 3300025934 | Bacteria | 1582 |
| 461 | Ga0207670_10007670 | 3300025936 | Bacteria | 6043 |
| 462 | Ga0207669_10008095 | 3300025937 | Bacteria | 4916 |
| 463 | Ga0207704_10011426 | 3300025938 | Unclassified | 4371 |
| 464 | Ga0207704_10033530 | 3300025938 | Unclassified | 2921 |
| 465 | Ga0207665_10003656 | 3300025939 | Bacteria | 10268 |
| 466 | Ga0207665_10005675 | 3300025939 | Bacteria | 8313 |
| 467 | Ga0207665_10011051 | 3300025939 | Bacteria | 5924 |
| 468 | Ga0207665_10011161 | 3300025939 | Bacteria | 5894 |
| 469 | Ga0207665_10015545 | 3300025939 | Bacteria | 4994 |
| 470 | Ga0207665_10048956 | 3300025939 | Bacteria | 2839 |
| 471 | Ga0207665_10060552 | 3300025939 | Bacteria | 2564 |
| 472 | Ga0207691_10002383 | 3300025940 | Bacteria | 18381 |
| 473 | Ga0207711_10028395 | 3300025941 | Bacteria | 4708 |
| 474 | Ga0207711_10071563 | 3300025941 | Unclassified | 3009 |
| 475 | Ga0207711_10083122 | 3300025941 | Bacteria | 2800 |
| 476 | Ga0207711_10125158 | 3300025941 | Bacteria | 2298 |
| 477 | Ga0207689_10000303 | 3300025942 | Bacteria | 45120 |
| 478 | Ga0207689_10009630 | 3300025942 | Bacteria | 8329 |
| 479 | Ga0207689_10182081 | 3300025942 | Bacteria | 1732 |
| 480 | Ga0207661_10012219 | 3300025944 | Bacteria | 6237 |
| 481 | Ga0207661_10204228 | 3300025944 | Bacteria | 1739 |
| 482 | Ga0207661_10232253 | 3300025944 | Bacteria | 1634 |
| 483 | Ga0207679_10000049 | 3300025945 | Bacteria | 119045 |
| 484 | Ga0207679_10005041 | 3300025945 | Bacteria | 8255 |
| 485 | Ga0207679_10156790 | 3300025945 | Bacteria | 1860 |
| 486 | Ga0207667_10000213 | 3300025949 | Bacteria | 81973 |
| 487 | Ga0207667_10003075 | 3300025949 | Bacteria | 20688 |
| 488 | Ga0207667_10080646 | 3300025949 | Unclassified | 3371 |
| 489 | Ga0207667_10124071 | 3300025949 | Unclassified | 2660 |
| 490 | Ga0207667_10167691 | 3300025949 | Bacteria | 2257 |
| 491 | Ga0207640_10010314 | 3300025981 | Bacteria | 5259 |
| 492 | Ga0207640_10016469 | 3300025981 | Bacteria | 4301 |
| 493 | Ga0207677_10004705 | 3300026023 | Bacteria | 7352 |
| 494 | Ga0207677_10017827 | 3300026023 | Unclassified | 4246 |
| 495 | Ga0207703_10002915 | 3300026035 | Bacteria | 14565 |
| 496 | Ga0207703_10050053 | 3300026035 | Bacteria | 3380 |
| 497 | Ga0207703_10054468 | 3300026035 | Bacteria | 3253 |
| 498 | Ga0207639_10025048 | 3300026041 | Bacteria | 4324 |
| 499 | Ga0207639_10268930 | 3300026041 | Bacteria | 1494 |
| 500 | Ga0207639_10344514 | 3300026041 | Bacteria | 1329 |
| 501 | Ga0207678_10000123 | 3300026067 | Bacteria | 64544 |
| 502 | Ga0207702_10000114 | 3300026078 | Bacteria | 93951 |
| 503 | Ga0207702_10001495 | 3300026078 | Bacteria | 23103 |
| 504 | Ga0207702_10002913 | 3300026078 | Bacteria | 16016 |
| 505 | Ga0207702_10005292 | 3300026078 | Bacteria | 11321 |
| 506 | Ga0207702_10022028 | 3300026078 | Bacteria | 5278 |
| 507 | Ga0207702_10365927 | 3300026078 | Bacteria | 1383 |
| 508 | Ga0207641_10000009 | 3300026088 | Bacteria | 407901 |
| 509 | Ga0207641_10033720 | 3300026088 | Unclassified | 4254 |
| 510 | Ga0207641_10053335 | 3300026088 | Bacteria | 3427 |
| 511 | Ga0207641_10069228 | 3300026088 | Unclassified | 3029 |
| 512 | Ga0207641_10075506 | 3300026088 | Unclassified | 2910 |
| 513 | Ga0207641_10098592 | 3300026088 | Unclassified | 2570 |
| 514 | Ga0207641_10404678 | 3300026088 | Unclassified | 1311 |
| 515 | Ga0207641_10426115 | 3300026088 | Unclassified | 1278 |
| 516 | Ga0207648_10005573 | 3300026089 | Bacteria | 12665 |
| 517 | Ga0207648_10030497 | 3300026089 | Unclassified | 4775 |
| 518 | Ga0207676_10000144 | 3300026095 | Bacteria | 61909 |
| 519 | Ga0207676_10004134 | 3300026095 | Bacteria | 10249 |
| 520 | Ga0207676_10106876 | 3300026095 | Unclassified | 2333 |
| 521 | Ga0207674_10000010 | 3300026116 | Bacteria | 196710 |
| 522 | Ga0207674_10000860 | 3300026116 | Bacteria | 39670 |
| 523 | Ga0207674_10001389 | 3300026116 | Bacteria | 31181 |
| 524 | Ga0207674_10201902 | 3300026116 | Bacteria | 1937 |
| 525 | Ga0207674_10212779 | 3300026116 | Unclassified | 1882 |
| 526 | Ga0207675_100013398 | 3300026118 | Bacteria | 7652 |
| 527 | Ga0207675_100094214 | 3300026118 | Bacteria | 2817 |
| 528 | Ga0207675_100298736 | 3300026118 | Unclassified | 1568 |
| 529 | Ga0207683_10002284 | 3300026121 | Bacteria | 16811 |
| 530 | Ga0207698_10063514 | 3300026142 | Unclassified | 2890 |
| 531 | Ga0207698_10226983 | 3300026142 | Bacteria | 1692 |
| 532 | Ga0207698_10355896 | 3300026142 | Unclassified | 1385 |
| 533 | Ga0207698_10429653 | 3300026142 | Bacteria | 1270 |
| 534 | Ga0265356_1000316 | 3300028017 | Bacteria | 9022 |
| 535 | Ga0268266_10033446 | 3300028379 | Bacteria | 4370 |
| 536 | Ga0268264_10082709 | 3300028381 | Unclassified | 2748 |
| 537 | Ga0268264_10126223 | 3300028381 | Bacteria | 2261 |
| 538 | Ga0268264_10265953 | 3300028381 | Bacteria | 1600 |
| 539 | Ga0265338_10005692 | 3300028800 | Bacteria | 16121 |
| 540 | Ga0265338_10017267 | 3300028800 | Bacteria | 7789 |
| 541 | Ga0265338_10048055 | 3300028800 | Bacteria | 3887 |
| 542 | Ga0265762_1007431 | 3300030760 | Bacteria | 1953 |
| 543 | Ga0265762_1022611 | 3300030760 | Bacteria | 1163 |
| 544 | Ga0265760_10000898 | 3300031090 | Bacteria | 8603 |
| 545 | Ga0265760_10001161 | 3300031090 | Bacteria | 7680 |
| 546 | Ga0265760_10002492 | 3300031090 | Bacteria | 5372 |
| 547 | Ga0265330_10048607 | 3300031235 | Unclassified | 1865 |
| 548 | Ga0265328_10030602 | 3300031239 | Bacteria | 2005 |
| 549 | Ga0265325_10011049 | 3300031241 | Bacteria | 5196 |
| 550 | Ga0265340_10008402 | 3300031247 | Bacteria | 5578 |
| 551 | Ga0265340_10070819 | 3300031247 | Bacteria | 1653 |
| 552 | Ga0265340_10138923 | 3300031247 | Bacteria | 1112 |
| 553 | Ga0265339_10003305 | 3300031249 | Bacteria | 11291 |
| 554 | Ga0265339_10005827 | 3300031249 | Bacteria | 8172 |
| 555 | Ga0265339_10014760 | 3300031249 | Unclassified | 4702 |
| 556 | Ga0265331_10011573 | 3300031250 | Bacteria | 4826 |
| 557 | Ga0265331_10049624 | 3300031250 | Bacteria | 2016 |
| 558 | Ga0265327_10028651 | 3300031251 | Bacteria | 3181 |
| 559 | Ga0265316_10042591 | 3300031344 | Unclassified | 3627 |
| 560 | Ga0265316_10073698 | 3300031344 | Bacteria | 2629 |
| 561 | Ga0265316_10079221 | 3300031344 | Bacteria | 2521 |
| 562 | Ga0265316_10140273 | 3300031344 | Bacteria | 1816 |
| 563 | Ga0265314_10004539 | 3300031711 | Bacteria | 12824 |
| 564 | Ga0265314_10010141 | 3300031711 | Bacteria | 7894 |
| 565 | Ga0265314_10071223 | 3300031711 | Unclassified | 2327 |
| 566 | Ga0265314_10075727 | 3300031711 | Bacteria | 2238 |
| 567 | Ga0265314_10098526 | 3300031711 | Bacteria | 1885 |
| 568 | Ga0265314_10145502 | 3300031711 | Bacteria | 1460 |
| 569 | Ga0265314_10153391 | 3300031711 | Unclassified | 1410 |
| 570 | Ga0265342_10009741 | 3300031712 | Bacteria | 6729 |
| 571 | Ga0307412_10155586 | 3300031911 | Bacteria | 1692 |
| 572 | Ga0307412_10248662 | 3300031911 | Bacteria | 1380 |
| 573 | Ga0307409_100006768 | 3300031995 | Bacteria | 6779 |
| 574 | Ga0307416_100446796 | 3300032002 | Bacteria | 1344 |
| 575 | Ga0307411_10048450 | 3300032005 | Unclassified | 2754 |
| 576 | Ga0307415_100118188 | 3300032126 | Bacteria | 1982 |
| 577 | Ga0316214_1006610 | 3300033545 | Bacteria | 1534 |
| 578 | Ga0373923_0005377 | 3300035111 | Bacteria | 4346 |
| 579 | Ga0373923_0051490 | 3300035111 | Unclassified | 1728 |
| 580 | Ga0373923_0056228 | 3300035111 | Bacteria | 1660 |
| 581 | Ga0373945_0003625 | 3300035116 | Unclassified | 4864 |
| 582 | Ga0373945_0021405 | 3300035116 | Unclassified | 2222 |
| 583 | Ga0373953_0011708 | 3300035117 | Bacteria | 3088 |
| 584 | Ga0373956_0009712 | 3300035119 | Bacteria | 3918 |
| 585 | Ga0373956_0017984 | 3300035119 | Unclassified | 2989 |
| 586 | Ga0373957_0005803 | 3300035120 | Bacteria | 3851 |
| 587 | Ga0373957_0006934 | 3300035120 | Bacteria | 3597 |
| 588 | Ga0373943_0000085 | 3300035170 | Bacteria | 33641 |
| 589 | Ga0373943_0003611 | 3300035170 | Bacteria | 7038 |
| 590 | Ga0373946_0003034 | 3300035171 | Bacteria | 5953 |
| 591 | Ga0373946_0034891 | 3300035171 | Bacteria | 2033 |
| 592 | Ga0373924_0000431 | 3300035410 | Bacteria | 12867 |
| 593 | Ga0373924_0002004 | 3300035410 | Bacteria | 6776 |
| 594 | Ga0373931_0123558 | 3300035691 | Unclassified | 1482 |
| 595 | Ga0373935_0005099 | 3300035692 | Bacteria | 7741 |
| 596 | Ga0373935_0018553 | 3300035692 | Unclassified | 4234 |
| 597 | Ga0373927_0000441 | 3300035695 | Bacteria | 31834 |
| 598 | Ga0373927_0012059 | 3300035695 | Bacteria | 5749 |
| 599 | Ga0373933_0048470 | 3300035724 | Unclassified | 2530 |
| 600 | Ga0373947_0000049 | 3300035725 | Bacteria | 60041 |
| 601 | Ga0373947_0016305 | 3300035725 | Bacteria | 4270 |
| 602 | Ga0373947_0031834 | 3300035725 | Unclassified | 3106 |
| 603 | Ga0373937_0000140 | 3300036401 | Bacteria | 69752 |
| 604 | Ga0373937_0048635 | 3300036401 | Unclassified | 3883 |
| 605 | Ga0373937_0053953 | 3300036401 | Bacteria | 3688 |
| 606 | Ga0373937_0194150 | 3300036401 | Unclassified | 1908 |
| 607 | Ga0373925_0001549 | 3300037068 | Bacteria | 19557 |
| 608 | Ga0373925_0010285 | 3300037068 | Bacteria | 6786 |
| 609 | Ga0373925_0021077 | 3300037068 | Unclassified | 4748 |
| 610 | Ga0395900_0230540 | 3300037418 | Unclassified | 1863 |
| 611 | Ga0395898_0102701 | 3300037466 | Unclassified | 2744 |
| 612 | Ga0395905_0072245 | 3300037471 | Bacteria | 3235 |
| 613 | Ga0395905_0088952 | 3300037471 | Bacteria | 2894 |
| 614 | Ga0395905_0090084 | 3300037471 | Bacteria | 2875 |
| 615 | Ga0436364_0350231 | 3300037853 | Unclassified | 2936 |
| 616 | Ga0395901_0138709 | 3300038443 | Unclassified | 2556 |
| 617 | Ga0436360_0607181 | 3300039438 | Bacteria | 1360 |
| 618 | Ga0436363_0873349 | 3300039450 | Unclassified | 3324 |
| 619 | Ga0436363_1620627 | 3300039450 | Bacteria | 1704 |
| 620 | Ga0451577_0001386 | 3300042876 | Bacteria | 32430 |
| 621 | Ga0453683_0039642 | 3300044673 | Bacteria | 2960 |
| 622 | Ga0466965_0193091 | 3300044683 | Bacteria | 1078 |
| 623 | Ga0466963_0001110 | 3300044694 | Bacteria | 14041 |
| 624 | Ga0466963_0134854 | 3300044694 | Bacteria | 1708 |
| 625 | Ga0466963_0164523 | 3300044694 | Bacteria | 1545 |
| 626 | Ga0466964_0088471 | 3300044706 | Bacteria | 1343 |
| 627 | Ga0453684_0000324 | 3300044712 | Bacteria | 201431 |
| 628 | Ga0466957_0002324 | 3300044842 | Bacteria | 10198 |
| 629 | Ga0466959_0024546 | 3300045049 | Bacteria | 4467 |
| 630 | Ga0466959_0261650 | 3300045049 | Bacteria | 1191 |
| 631 | Ga0451576_0055889 | 3300045051 | Bacteria | 4129 |
| 632 | Ga0451576_0066644 | 3300045051 | Bacteria | 3748 |
| 633 | Ga0466958_0158659 | 3300045836 | Bacteria | 1428 |
| 634 | Ga0466967_0002707 | 3300045976 | Bacteria | 11201 |
| 635 | Ga0466967_0054224 | 3300045976 | Bacteria | 3527 |
| 636 | Ga0466967_0083310 | 3300045976 | Unclassified | 2892 |
| 637 | Ga0466967_0528954 | 3300045976 | Bacteria | 1159 |
| 638 | Ga0495651_0161894 | 3300046462 | Bacteria | 1602 |
| 639 | Ga0495653_0115884 | 3300046463 | Bacteria | 1917 |
| 640 | Ga0495580_0000448 | 3300046472 | Bacteria | 34094 |
| 641 | Ga0495580_0002832 | 3300046472 | Bacteria | 14915 |
| 642 | Ga0495580_0008841 | 3300046472 | Bacteria | 7973 |
| 643 | Ga0495580_0009224 | 3300046472 | Bacteria | 7774 |
| 644 | Ga0495580_0044807 | 3300046472 | Bacteria | 3145 |
| 645 | Ga0495580_0096778 | 3300046472 | Bacteria | 2053 |
| 646 | Ga0495580_0206887 | 3300046472 | Bacteria | 1351 |
| 647 | Ga0495582_0001056 | 3300046473 | Bacteria | 15486 |
| 648 | Ga0495582_0022390 | 3300046473 | Unclassified | 3457 |
| 649 | Ga0495582_0027409 | 3300046473 | Unclassified | 3123 |
| 650 | Ga0495594_0093992 | 3300046499 | Unclassified | 1682 |
| 651 | Ga0495608_0084036 | 3300046511 | Unclassified | 2066 |
| 652 | Ga0495628_0100889 | 3300046516 | Unclassified | 2228 |
| 653 | Ga0495630_0026417 | 3300046517 | Bacteria | 4298 |
| 654 | Ga0495665_0002114 | 3300046531 | Bacteria | 10754 |
| 655 | Ga0495665_0053398 | 3300046531 | Bacteria | 2137 |
| 656 | Ga0495659_0009191 | 3300046664 | Bacteria | 3152 |
| 657 | Ga0495599_0094865 | 3300046678 | Unclassified | 1861 |
| 658 | Ga0495623_0003146 | 3300046679 | Bacteria | 10885 |
| 659 | Ga0495623_0045665 | 3300046679 | Bacteria | 2782 |
| 660 | Ga0495658_0055445 | 3300046683 | Unclassified | 2258 |
| 661 | Ga0495669_0014999 | 3300046684 | Unclassified | 3315 |
| 662 | Ga0495669_0137425 | 3300046684 | Bacteria | 1153 |
| 663 | Ga0495624_0223863 | 3300046690 | Unclassified | 1140 |
| 664 | Ga0495600_0125701 | 3300046809 | Bacteria | 1668 |
| 665 | Ga0495581_0172397 | 3300047315 | Unclassified | 1265 |
| 666 | Ga0495604_0037361 | 3300047317 | Bacteria | 3825 |
| 667 | Ga0495676_0181453 | 3300047321 | Unclassified | 1475 |
| 668 | Ga0495680_0245938 | 3300047322 | Bacteria | 1269 |
| 669 | Ga0495675_0014882 | 3300047444 | Unclassified | 4921 |
| 670 | Ga0495684_0137288 | 3300047471 | Bacteria | 1835 |
| 671 | Ga0495593_0127833 | 3300047673 | Unclassified | 1291 |
| 672 | Ga0495602_0103688 | 3300048088 | Unclassified | 2328 |
| 673 | Ga0496100_0077744 | 3300048903 | Bacteria | 2232 |
| 674 | Ga0496101_0059798 | 3300048904 | Bacteria | 2763 |
| 675 | Ga0496101_0100935 | 3300048904 | Unclassified | 2160 |
| 676 | Ga0496102_0001130 | 3300048905 | Bacteria | 24464 |
| 677 | Ga0496102_0183497 | 3300048905 | Unclassified | 1971 |
| 678 | Ga0496102_0196274 | 3300048905 | Unclassified | 1902 |
| 679 | Ga0496102_0399858 | 3300048905 | Bacteria | 1292 |
| 680 | Ga0496103_0002084 | 3300048906 | Bacteria | 12771 |
| 681 | Ga0496103_0230744 | 3300048906 | Bacteria | 1191 |
| 682 | Ga0496104_0133562 | 3300048907 | Bacteria | 2384 |
| 683 | Ga0496105_0001548 | 3300048908 | Bacteria | 16277 |
| 684 | Ga0496105_0013752 | 3300048908 | Bacteria | 6426 |
| 685 | Ga0496105_0160456 | 3300048908 | Unclassified | 1846 |
| 686 | Ga0496106_0078505 | 3300048909 | Bacteria | 2533 |
| 687 | Ga0496107_0104069 | 3300048910 | Bacteria | 2083 |
| 688 | Ga0496107_0188982 | 3300048910 | Bacteria | 1530 |
| 689 | Ga0496108_0000329 | 3300048911 | Bacteria | 40126 |
| 690 | Ga0496109_0000084 | 3300048912 | Bacteria | 95803 |
| 691 | Ga0496109_0065900 | 3300048912 | Unclassified | 3316 |
| 692 | Ga0496110_0014106 | 3300048913 | Bacteria | 6625 |
| 693 | Ga0496110_0039017 | 3300048913 | Unclassified | 4134 |
| 694 | Ga0496110_0263126 | 3300048913 | Bacteria | 1570 |
| 695 | Ga0496111_0018144 | 3300048914 | Unclassified | 4872 |
| 696 | Ga0496111_0081058 | 3300048914 | Unclassified | 2369 |
| 697 | Ga0496112_0000030 | 3300048915 | Bacteria | 120429 |
| 698 | Ga0496112_0005183 | 3300048915 | Bacteria | 11207 |
| 699 | Ga0496112_0010593 | 3300048915 | Bacteria | 8376 |
| 700 | Ga0496112_0011664 | 3300048915 | Bacteria | 8038 |
| 701 | Ga0496112_0017674 | 3300048915 | Bacteria | 6708 |
| 702 | Ga0496112_0209211 | 3300048915 | Bacteria | 1908 |
| 703 | Ga0496112_0265707 | 3300048915 | Bacteria | 1665 |
| 704 | Ga0496113_0000877 | 3300048916 | Bacteria | 15800 |
| 705 | Ga0496114_0230663 | 3300048917 | Bacteria | 1626 |
| 706 | Ga0496115_0017185 | 3300048918 | Bacteria | 5522 |
| 707 | nmdc:mga0n895_121152_c1 | 3300050512 | Bacteria | 2637 |
| 708 | nmdc:mga0n895_242975_c1 | 3300050512 | Unclassified | 1827 |
| 709 | nmdc:mga0n895_2972_c1 | 3300050512 | Bacteria | 13454 |
| 710 | nmdc:mga0n895_662_c1 | 3300050512 | Bacteria | 24071 |
| 711 | nmdc:mga0rr50_29961_c1 | 3300050513 | Bacteria | 3846 |
| 712 | nmdc:mga0rr50_319252_c1 | 3300050513 | Unclassified | 1302 |
| 713 | nmdc:mga0rr50_32418_c1 | 3300050513 | Bacteria | 3722 |
| 714 | nmdc:mga0rr50_6153_c1 | 3300050513 | Bacteria | 7267 |
| 715 | nmdc:mga08x19_14163_c1 | 3300050514 | Bacteria | 4834 |
| 716 | nmdc:mga08x19_2262_c1 | 3300050514 | Bacteria | 11712 |
| 717 | nmdc:mga08x19_7417_c1 | 3300050514 | Bacteria | 6513 |
| 718 | nmdc:mga08x19_9704_c1 | 3300050514 | Bacteria | 5763 |
| 719 | nmdc:mga0a205_5062_c1 | 3300050515 | Bacteria | 11859 |
| 720 | nmdc:mga0a205_6820_c1 | 3300050515 | Bacteria | 10329 |
| 721 | Ga0495612_0075489 | 3300053078 | Unclassified | 1411 |
| 722 | Ga0495595_0133747 | 3300053084 | Bacteria | 1214 |
| 723 | Ga0495619_0139970 | 3300053085 | Unclassified | 1666 |
| 724 | Ga0501082_0208548 | 3300060353 | Bacteria | 1700 |
| 725 | Ga0451576_0412739 | |||
| 726 | JGI24743J22301_10000297 | |||
| 727 | JGI24034J26672_10007352 | |||
| 728 | JGI24751J29686_10002567 | |||
| 729 | Ga0065715_10002200 | |||
| 730 | Ga0070658_10015333 | |||
| 731 | Ga0070658_10280834 | |||
| 732 | Ga0070683_100000948 | |||
| 733 | Ga0070683_100046063 | |||
| 734 | Ga0070683_100061746 | |||
| 735 | Ga0070683_100082742 | |||
| 736 | Ga0070670_100000465 | |||
| 737 | Ga0070670_100162135 | |||
| 738 | Ga0068869_100001747 | |||
| 739 | Ga0068869_100026879 | |||
| 740 | Ga0070666_10132304 | |||
| 741 | Ga0070680_100000708 | |||
| 742 | Ga0070680_100009342 | |||
| 743 | Ga0070680_100143419 | |||
| 744 | Ga0070680_100168959 | |||
| 745 | Ga0070680_100181267 | |||
| 746 | Ga0068868_100011788 | |||
| 747 | Ga0068868_100026948 | |||
| 748 | Ga0068868_100057262 | |||
| 749 | Ga0068868_100070459 | |||
| 750 | Ga0068868_100525471 | |||
| 751 | Ga0070660_100007017 | |||
| 752 | Ga0070660_100079015 | |||
| 753 | Ga0070689_100073188 | |||
| 754 | Ga0070689_100099309 | |||
| 755 | Ga0070691_10027682 | |||
| 756 | Ga0070687_100022400 | |||
| 757 | Ga0070661_100020047 | |||
| 758 | Ga0070668_100103695 | |||
| 759 | Ga0070669_100004172 | |||
| 760 | Ga0070671_100102207 | |||
| 761 | Ga0070674_100001332 | |||
| 762 | Ga0070673_100295721 | |||
| 763 | Ga0070667_100140961 | |||
| 764 | Ga0070709_10014903 | |||
| 765 | Ga0070709_10025037 | |||
| 766 | Ga0070709_10058779 | |||
| 767 | Ga0070709_10109539 | |||
| 768 | Ga0070714_100000027 | |||
| 769 | Ga0070714_100029083 | |||
| 770 | Ga0070714_100037860 | |||
| 771 | Ga0070714_100085531 | |||
| 772 | Ga0070714_100118721 | |||
| 773 | Ga0070713_100002409 | |||
| 774 | Ga0070713_100004204 | |||
| 775 | Ga0070713_100006386 | |||
| 776 | Ga0070713_100012942 | |||
| 777 | Ga0070713_100016512 | |||
| 778 | Ga0070713_100062974 | |||
| 779 | Ga0070713_100096446 | |||
| 780 | Ga0070713_100130060 | |||
| 781 | Ga0070713_100134973 | |||
| 782 | Ga0070713_100159047 | |||
| 783 | Ga0070713_100346389 | |||
| 784 | Ga0070710_10022868 | |||
| 785 | Ga0070711_100000156 | |||
| 786 | Ga0070711_100000304 | |||
| 787 | Ga0070711_100014373 | |||
| 788 | Ga0070711_100047550 | |||
| 789 | Ga0070711_100144236 | |||
| 790 | Ga0070708_100000298 | |||
| 791 | Ga0070708_100001922 | |||
| 792 | Ga0070708_100005192 | |||
| 793 | Ga0070708_100019309 | |||
| 794 | Ga0070708_100197049 | |||
| 795 | Ga0070708_100545452 | |||
| 796 | Ga0070678_100159603 | |||
| 797 | Ga0070662_100002092 | |||
| 798 | Ga0070681_10000026 | |||
| 799 | Ga0070681_10000917 | |||
| 800 | Ga0070681_10007353 | |||
| 801 | Ga0070681_10013159 | |||
| 802 | Ga0070681_10343990 | |||
| 803 | Ga0068867_100002397 | |||
| 804 | Ga0070685_10004302 | |||
| 805 | Ga0070685_10193551 | |||
| 806 | Ga0070706_100000529 | |||
| 807 | Ga0070706_100010695 | |||
| 808 | Ga0070706_100012153 | |||
| 809 | Ga0070706_100013300 | |||
| 810 | Ga0070706_100021529 | |||
| 811 | Ga0070706_100098714 | |||
| 812 | Ga0070707_100003422 | |||
| 813 | Ga0070707_100006081 | |||
| 814 | Ga0070707_100024732 | |||
| 815 | Ga0070707_100074576 | |||
| 816 | Ga0070707_100092479 | |||
| 817 | Ga0070707_100097214 | |||
| 818 | Ga0070707_100219343 | |||
| 819 | Ga0070707_100355134 | |||
| 820 | Ga0070698_100000171 | |||
| 821 | Ga0070698_100000200 | |||
| 822 | Ga0070698_100091922 | |||
| 823 | Ga0070699_100000156 | |||
| 824 | Ga0070699_100106252 | |||
| 825 | Ga0070679_100000089 | |||
| 826 | Ga0070679_100002685 | |||
| 827 | Ga0070679_100005671 | |||
| 828 | Ga0070679_100014664 | |||
| 829 | Ga0070679_100190982 | |||
| 830 | Ga0070679_100195428 | |||
| 831 | Ga0070684_100079169 | |||
| 832 | Ga0070684_100082300 | |||
| 833 | Ga0070684_100154691 | |||
| 834 | Ga0070697_100000056 | |||
| 835 | Ga0070697_100002625 | |||
| 836 | Ga0070697_100003289 | |||
| 837 | Ga0070697_100004805 | |||
| 838 | Ga0070697_100038007 | |||
| 839 | Ga0070697_100047871 | |||
| 840 | Ga0070697_100050715 | |||
| 841 | Ga0070697_100411663 | |||
| 842 | Ga0068853_100002847 | |||
| 843 | Ga0068853_100014810 | |||
| 844 | Ga0068853_100034256 | |||
| 845 | Ga0068853_100064700 | |||
| 846 | Ga0068853_100353595 | |||
| 847 | Ga0070672_100023020 | |||
| 848 | Ga0070686_100160404 | |||
| 849 | Ga0070695_100017135 | |||
| 850 | Ga0070696_100114171 | |||
| 851 | Ga0070693_100037763 | |||
| 852 | Ga0070693_100040330 | |||
| 853 | Ga0070693_100079438 | |||
| 854 | Ga0070665_100020883 | |||
| 855 | Ga0068855_100000295 | |||
| 856 | Ga0068855_100001626 | |||
| 857 | Ga0068855_100009839 | |||
| 858 | Ga0068855_100012882 | |||
| 859 | Ga0068855_100118884 | |||
| 860 | Ga0068855_100174297 | |||
| 861 | Ga0070664_100008525 | |||
| 862 | Ga0070664_100046932 | |||
| 863 | Ga0070664_100157577 | |||
| 864 | Ga0070664_100171100 | |||
| 865 | Ga0068857_100000036 | |||
| 866 | Ga0068857_100011629 | |||
| 867 | Ga0068857_100029146 | |||
| 868 | Ga0068857_100113590 | |||
| 869 | Ga0068857_100194140 | |||
| 870 | Ga0068854_100003663 | |||
| 871 | Ga0068854_100021952 | |||
| 872 | Ga0068854_100041266 | |||
| 873 | Ga0068854_100070652 | |||
| 874 | Ga0068854_100082449 | |||
| 875 | Ga0068856_100000407 | |||
| 876 | Ga0068856_100001013 | |||
| 877 | Ga0068856_100002064 | |||
| 878 | Ga0068856_100004340 | |||
| 879 | Ga0068856_100007633 | |||
| 880 | Ga0068856_100025333 | |||
| 881 | Ga0068856_100035548 | |||
| 882 | Ga0068856_100091746 | |||
| 883 | Ga0070702_100011920 | |||
| 884 | Ga0068852_100084084 | |||
| 885 | Ga0068852_100161574 | |||
| 886 | Ga0068852_100476785 | |||
| 887 | Ga0068859_100001163 | |||
| 888 | Ga0068859_100021096 | |||
| 889 | Ga0068859_100034435 | |||
| 890 | Ga0068864_100000684 | |||
| 891 | Ga0068864_100060781 | |||
| 892 | Ga0068864_100343359 | |||
| 893 | Ga0068864_100402543 | |||
| 894 | Ga0068866_10011816 | |||
| 895 | Ga0068861_100040659 | |||
| 896 | Ga0068861_100065343 | |||
| 897 | Ga0068861_100176281 | |||
| 898 | Ga0068851_10032801 | |||
| 899 | Ga0068851_10043646 | |||
| 900 | Ga0068851_10090220 | |||
| 901 | Ga0068863_100020834 | |||
| 902 | Ga0068863_100087340 | |||
| 903 | Ga0068863_100130521 | |||
| 904 | Ga0068863_100209430 | |||
| 905 | Ga0068863_100230567 | |||
| 906 | Ga0068858_100026968 | |||
| 907 | Ga0068858_100150628 | |||
| 908 | Ga0068860_100062973 | |||
| 909 | Ga0068860_100099957 | |||
| 910 | Ga0068860_100124227 | |||
| 911 | Ga0081540_1049573 | |||
| 912 | Ga0070717_10001574 | |||
| 913 | Ga0070717_10006266 | |||
| 914 | Ga0070717_10020532 | |||
| 915 | Ga0070717_10026447 | |||
| 916 | Ga0070717_10028046 | |||
| 917 | Ga0070717_10028452 | |||
| 918 | Ga0070717_10056698 | |||
| 919 | Ga0070717_10203301 | |||
| 920 | Ga0070715_10057377 | |||
| 921 | Ga0070715_10096424 | |||
| 922 | Ga0070716_100000185 | |||
| 923 | Ga0070716_100007184 | |||
| 924 | Ga0070716_100007574 | |||
| 925 | Ga0070716_100034314 | |||
| 926 | Ga0070716_100088774 | |||
| 927 | Ga0070716_100168406 | |||
| 928 | Ga0070712_100002131 | |||
| 929 | Ga0070712_100003676 | |||
| 930 | Ga0070712_100024694 | |||
| 931 | Ga0070712_100087255 | |||
| 932 | Ga0070712_100113725 | |||
| 933 | Ga0070712_100157733 | |||
| 934 | Ga0097621_100000237 | |||
| 935 | Ga0097621_100006889 | |||
| 936 | Ga0097621_100016228 | |||
| 937 | Ga0097621_100022568 | |||
| 938 | Ga0097621_100037953 | |||
| 939 | Ga0097621_100127926 | |||
| 940 | Ga0097621_100284429 | |||
| 941 | Ga0068871_100001088 | |||
| 942 | Ga0068871_100002121 | |||
| 943 | Ga0068871_100021859 | |||
| 944 | Ga0068871_100023682 | |||
| 945 | Ga0068871_100082408 | |||
| 946 | Ga0068871_100219605 | |||
| 947 | Ga0075433_10003606 | |||
| 948 | Ga0075433_10005374 | |||
| 949 | Ga0075434_100000136 | |||
| 950 | Ga0075434_100000335 | |||
| 951 | Ga0068865_100015067 | |||
| 952 | Ga0068865_100034361 | |||
| 953 | Ga0068865_100050939 | |||
| 954 | Ga0075436_100001252 | |||
| 955 | Ga0075436_100002510 | |||
| 956 | Ga0075436_100003564 | |||
| 957 | Ga0075436_100009483 | |||
| 958 | Ga0097620_100001163 | |||
| 959 | Ga0097620_100021096 | |||
| 960 | Ga0097620_100034435 | |||
| 961 | Ga0075435_100001721 | |||
| 962 | Ga0075435_100005877 | |||
| 963 | Ga0075435_100050348 | |||
| 964 | Ga0075435_100218499 | |||
| 965 | Ga0105240_10014500 | |||
| 966 | Ga0105240_10020964 | |||
| 967 | Ga0105240_10032233 | |||
| 968 | Ga0105240_10106572 | |||
| 969 | Ga0105240_10592123 | |||
| 970 | Ga0105245_10000333 | |||
| 971 | Ga0105245_10003057 | |||
| 972 | Ga0105245_10023248 | |||
| 973 | Ga0105245_10177722 | |||
| 974 | Ga0105247_10079136 | |||
| 975 | Ga0114129_10030476 | |||
| 976 | Ga0105241_10005709 | |||
| 977 | Ga0105241_10042190 | |||
| 978 | Ga0105241_10063386 | |||
| 979 | Ga0105241_10108704 | |||
| 980 | Ga0105241_10148703 | |||
| 981 | Ga0105241_10176210 | |||
| 982 | Ga0105242_10043239 | |||
| 983 | Ga0105242_10100316 | |||
| 984 | Ga0105242_10151983 | |||
| 985 | Ga0105242_10167365 | |||
| 986 | Ga0105242_10356221 | |||
| 987 | Ga0105248_10003155 | |||
| 988 | Ga0105248_10048534 | |||
| 989 | Ga0105248_10054059 | |||
| 990 | Ga0105248_10128925 | |||
| 991 | Ga0105237_10026024 | |||
| 992 | Ga0105237_10026264 | |||
| 993 | Ga0105237_10071066 | |||
| 994 | Ga0105237_10141420 | |||
| 995 | Ga0105237_10209691 | |||
| 996 | Ga0105237_10217274 | |||
| 997 | Ga0105238_10000848 | |||
| 998 | Ga0105238_10020479 | |||
| 999 | Ga0105238_10031206 | |||
| 1000 | Ga0105238_10068015 | |||
| 1001 | Ga0105238_10172555 | |||
| 1002 | Ga0105249_10013735 | |||
| 1003 | Ga0105249_10129822 | |||
| 1004 | Ga0099796_10010207 | |||
| 1005 | Ga0105239_10026773 | |||
| 1006 | Ga0105239_10133468 | |||
| 1007 | Ga0105239_10152565 | |||
| 1008 | Ga0105239_10251966 | |||
| 1009 | Ga0105239_10283721 | |||
| 1010 | Ga0105239_10448840 | |||
| 1011 | Ga0105246_10005569 | |||
| 1012 | Ga0105246_10056236 | |||
| 1013 | Ga0105246_10075047 | |||
| 1014 | Ga0105246_10227546 | |||
| 1015 | Ga0157373_10000776 | |||
| 1016 | Ga0157373_10008835 | |||
| 1017 | Ga0157373_10012250 | |||
| 1018 | Ga0157371_10007713 | |||
| 1019 | Ga0157371_10027577 | |||
| 1020 | Ga0157370_10010467 | |||
| 1021 | Ga0157370_10209762 | |||
| 1022 | Ga0157370_10295496 | |||
| 1023 | Ga0157369_10000124 | |||
| 1024 | Ga0157369_10000707 | |||
| 1025 | Ga0157369_10027749 | |||
| 1026 | Ga0157369_10047163 | |||
| 1027 | Ga0157369_10050039 | |||
| 1028 | Ga0157369_10088613 | |||
| 1029 | Ga0157369_10096068 | |||
| 1030 | Ga0157369_10151330 | |||
| 1031 | Ga0157369_10277046 | |||
| 1032 | Ga0157369_10437453 | |||
| 1033 | Ga0157369_10524829 | |||
| 1034 | Ga0157374_10000162 | |||
| 1035 | Ga0157374_10000667 | |||
| 1036 | Ga0157374_10011870 | |||
| 1037 | Ga0157374_10012718 | |||
| 1038 | Ga0157374_10031095 | |||
| 1039 | Ga0157374_10107041 | |||
| 1040 | Ga0157374_10184759 | |||
| 1041 | Ga0157378_10000020 | |||
| 1042 | Ga0157378_10000320 | |||
| 1043 | Ga0157378_10003963 | |||
| 1044 | Ga0157378_10004021 | |||
| 1045 | Ga0157378_10036037 | |||
| 1046 | Ga0157378_10056057 | |||
| 1047 | Ga0157378_10178309 | |||
| 1048 | Ga0163162_10004201 | |||
| 1049 | Ga0163162_10016256 | |||
| 1050 | Ga0163162_10024079 | |||
| 1051 | Ga0163162_10059202 | |||
| 1052 | Ga0157372_10000084 | |||
| 1053 | Ga0157372_10001112 | |||
| 1054 | Ga0157372_10005137 | |||
| 1055 | Ga0157372_10009649 | |||
| 1056 | Ga0157372_10011646 | |||
| 1057 | Ga0157372_10079277 | |||
| 1058 | Ga0157372_10114277 | |||
| 1059 | Ga0157372_10282145 | |||
| 1060 | Ga0157372_10468455 | |||
| 1061 | Ga0157375_10070945 | |||
| 1062 | Ga0163163_10035198 | |||
| 1063 | Ga0163163_10035267 | |||
| 1064 | Ga0163163_10035346 | |||
| 1065 | Ga0163163_10045876 | |||
| 1066 | Ga0157377_10000496 | |||
| 1067 | Ga0157377_10096068 | |||
| 1068 | Ga0157379_10002644 | |||
| 1069 | Ga0157379_10015890 | |||
| 1070 | Ga0157379_10051514 | |||
| 1071 | Ga0157379_10142051 | |||
| 1072 | Ga0157376_10193845 | |||
| 1073 | Ga0157376_10431044 | |||
| 1074 | Ga0182007_10004562 | |||
| 1075 | Ga0163161_10008153 | |||
| 1076 | Ga0213875_10032086 | |||
| 1077 | Ga0224570_100720 | |||
| 1078 | Ga0224569_100054 | |||
| 1079 | Ga0224572_1000889 | |||
| 1080 | Ga0228598_1000075 | |||
| 1081 | Ga0228598_1001966 | |||
| 1082 | Ga0207697_10008791 | |||
| 1083 | Ga0207692_10019553 | |||
| 1084 | Ga0207692_10103635 | |||
| 1085 | Ga0207642_10003061 | |||
| 1086 | Ga0207642_10007502 | |||
| 1087 | Ga0207647_10148765 | |||
| 1088 | Ga0207685_10003278 | |||
| 1089 | Ga0207685_10040534 | |||
| 1090 | Ga0207699_10000583 | |||
| 1091 | Ga0207699_10005252 | |||
| 1092 | Ga0207699_10014425 | |||
| 1093 | Ga0207699_10014623 | |||
| 1094 | Ga0207699_10023106 | |||
| 1095 | Ga0207699_10037991 | |||
| 1096 | Ga0207699_10057815 | |||
| 1097 | Ga0207699_10088397 | |||
| 1098 | Ga0207645_10003498 | |||
| 1099 | Ga0207643_10003053 | |||
| 1100 | Ga0207684_10000702 | |||
| 1101 | Ga0207684_10001046 | |||
| 1102 | Ga0207684_10015468 | |||
| 1103 | Ga0207654_10069059 | |||
| 1104 | Ga0207707_10000800 | |||
| 1105 | Ga0207707_10001177 | |||
| 1106 | Ga0207707_10119041 | |||
| 1107 | Ga0207707_10254005 | |||
| 1108 | Ga0207707_10283030 | |||
| 1109 | Ga0207695_10029736 | |||
| 1110 | Ga0207695_10031459 | |||
| 1111 | Ga0207695_10080946 | |||
| 1112 | Ga0207695_10105072 | |||
| 1113 | Ga0207695_10125703 | |||
| 1114 | Ga0207671_10044324 | |||
| 1115 | Ga0207671_10144665 | |||
| 1116 | Ga0207693_10000284 | |||
| 1117 | Ga0207693_10001237 | |||
| 1118 | Ga0207693_10001760 | |||
| 1119 | Ga0207693_10011856 | |||
| 1120 | Ga0207693_10015937 | |||
| 1121 | Ga0207693_10024221 | |||
| 1122 | Ga0207693_10026111 | |||
| 1123 | Ga0207693_10030550 | |||
| 1124 | Ga0207693_10062673 | |||
| 1125 | Ga0207693_10063402 | |||
| 1126 | Ga0207663_10002968 | |||
| 1127 | Ga0207663_10053394 | |||
| 1128 | Ga0207663_10063757 | |||
| 1129 | Ga0207663_10067708 | |||
| 1130 | Ga0207663_10071872 | |||
| 1131 | Ga0207663_10076977 | |||
| 1132 | Ga0207663_10148005 | |||
| 1133 | Ga0207660_10000064 | |||
| 1134 | Ga0207660_10036924 | |||
| 1135 | Ga0207662_10006874 | |||
| 1136 | Ga0207657_10001068 | |||
| 1137 | Ga0207657_10001233 | |||
| 1138 | Ga0207649_10009111 | |||
| 1139 | Ga0207652_10002643 | |||
| 1140 | Ga0207652_10008560 | |||
| 1141 | Ga0207652_10032354 | |||
| 1142 | Ga0207652_10175673 | |||
| 1143 | Ga0207652_10269175 | |||
| 1144 | Ga0207652_10328644 | |||
| 1145 | Ga0207652_10371710 | |||
| 1146 | Ga0207646_10000261 | |||
| 1147 | Ga0207646_10005506 | |||
| 1148 | Ga0207646_10082103 | |||
| 1149 | Ga0207646_10086176 | |||
| 1150 | Ga0207646_10171939 | |||
| 1151 | Ga0207646_10185246 | |||
| 1152 | Ga0207694_10000434 | |||
| 1153 | Ga0207694_10064360 | |||
| 1154 | Ga0207694_10075016 | |||
| 1155 | Ga0207694_10095824 | |||
| 1156 | Ga0207650_10000380 | |||
| 1157 | Ga0207650_10000976 | |||
| 1158 | Ga0207650_10113229 | |||
| 1159 | Ga0207650_10381764 | |||
| 1160 | Ga0207687_10003252 | |||
| 1161 | Ga0207687_10015735 | |||
| 1162 | Ga0207700_10000907 | |||
| 1163 | Ga0207700_10002636 | |||
| 1164 | Ga0207700_10007820 | |||
| 1165 | Ga0207700_10009996 | |||
| 1166 | Ga0207700_10012271 | |||
| 1167 | Ga0207700_10052013 | |||
| 1168 | Ga0207700_10054368 | |||
| 1169 | Ga0207700_10211936 | |||
| 1170 | Ga0207700_10382209 | |||
| 1171 | Ga0207700_10416678 | |||
| 1172 | Ga0207664_10001566 | |||
| 1173 | Ga0207664_10010018 | |||
| 1174 | Ga0207664_10015490 | |||
| 1175 | Ga0207664_10031448 | |||
| 1176 | Ga0207664_10051490 | |||
| 1177 | Ga0207664_10063927 | |||
| 1178 | Ga0207664_10103789 | |||
| 1179 | Ga0207664_10116386 | |||
| 1180 | Ga0207664_10154117 | |||
| 1181 | Ga0207644_10078828 | |||
| 1182 | Ga0207706_10000528 | |||
| 1183 | Ga0207706_10030144 | |||
| 1184 | Ga0207686_10159006 | |||
| 1185 | Ga0207670_10007670 | |||
| 1186 | Ga0207669_10008095 | |||
| 1187 | Ga0207704_10011426 | |||
| 1188 | Ga0207704_10033530 | |||
| 1189 | Ga0207665_10003656 | |||
| 1190 | Ga0207665_10005675 | |||
| 1191 | Ga0207665_10011051 | |||
| 1192 | Ga0207665_10011161 | |||
| 1193 | Ga0207665_10015545 | |||
| 1194 | Ga0207665_10048956 | |||
| 1195 | Ga0207665_10060552 | |||
| 1196 | Ga0207691_10002383 | |||
| 1197 | Ga0207711_10028395 | |||
| 1198 | Ga0207711_10071563 | |||
| 1199 | Ga0207711_10083122 | |||
| 1200 | Ga0207711_10125158 | |||
| 1201 | Ga0207689_10000303 | |||
| 1202 | Ga0207689_10009630 | |||
| 1203 | Ga0207689_10182081 | |||
| 1204 | Ga0207661_10012219 | |||
| 1205 | Ga0207661_10204228 | |||
| 1206 | Ga0207661_10232253 | |||
| 1207 | Ga0207679_10000049 | |||
| 1208 | Ga0207679_10005041 | |||
| 1209 | Ga0207679_10156790 | |||
| 1210 | Ga0207667_10000213 | |||
| 1211 | Ga0207667_10003075 | |||
| 1212 | Ga0207667_10080646 | |||
| 1213 | Ga0207667_10124071 | |||
| 1214 | Ga0207667_10167691 | |||
| 1215 | Ga0207640_10010314 | |||
| 1216 | Ga0207640_10016469 | |||
| 1217 | Ga0207677_10004705 | |||
| 1218 | Ga0207677_10017827 | |||
| 1219 | Ga0207703_10002915 | |||
| 1220 | Ga0207703_10050053 | |||
| 1221 | Ga0207703_10054468 | |||
| 1222 | Ga0207639_10025048 | |||
| 1223 | Ga0207639_10268930 | |||
| 1224 | Ga0207639_10344514 | |||
| 1225 | Ga0207678_10000123 | |||
| 1226 | Ga0207702_10000114 | |||
| 1227 | Ga0207702_10001495 | |||
| 1228 | Ga0207702_10002913 | |||
| 1229 | Ga0207702_10005292 | |||
| 1230 | Ga0207702_10022028 | |||
| 1231 | Ga0207702_10365927 | |||
| 1232 | Ga0207641_10000009 | |||
| 1233 | Ga0207641_10033720 | |||
| 1234 | Ga0207641_10053335 | |||
| 1235 | Ga0207641_10069228 | |||
| 1236 | Ga0207641_10075506 | |||
| 1237 | Ga0207641_10098592 | |||
| 1238 | Ga0207641_10404678 | |||
| 1239 | Ga0207641_10426115 | |||
| 1240 | Ga0207648_10005573 | |||
| 1241 | Ga0207648_10030497 | |||
| 1242 | Ga0207676_10000144 | |||
| 1243 | Ga0207676_10004134 | |||
| 1244 | Ga0207676_10106876 | |||
| 1245 | Ga0207674_10000010 | |||
| 1246 | Ga0207674_10000860 | |||
| 1247 | Ga0207674_10001389 | |||
| 1248 | Ga0207674_10201902 | |||
| 1249 | Ga0207674_10212779 | |||
| 1250 | Ga0207675_100013398 | |||
| 1251 | Ga0207675_100094214 | |||
| 1252 | Ga0207675_100298736 | |||
| 1253 | Ga0207683_10002284 | |||
| 1254 | Ga0207698_10063514 | |||
| 1255 | Ga0207698_10226983 | |||
| 1256 | Ga0207698_10355896 | |||
| 1257 | Ga0207698_10429653 | |||
| 1258 | Ga0265356_1000316 | |||
| 1259 | Ga0268266_10033446 | |||
| 1260 | Ga0268264_10082709 | |||
| 1261 | Ga0268264_10126223 | |||
| 1262 | Ga0268264_10265953 | |||
| 1263 | Ga0265338_10005692 | |||
| 1264 | Ga0265338_10017267 | |||
| 1265 | Ga0265338_10048055 | |||
| 1266 | Ga0265762_1007431 | |||
| 1267 | Ga0265762_1022611 | |||
| 1268 | Ga0265760_10000898 | |||
| 1269 | Ga0265760_10001161 | |||
| 1270 | Ga0265760_10002492 | |||
| 1271 | Ga0265330_10048607 | |||
| 1272 | Ga0265328_10030602 | |||
| 1273 | Ga0265325_10011049 | |||
| 1274 | Ga0265340_10008402 | |||
| 1275 | Ga0265340_10070819 | |||
| 1276 | Ga0265340_10138923 | |||
| 1277 | Ga0265339_10003305 | |||
| 1278 | Ga0265339_10005827 | |||
| 1279 | Ga0265339_10014760 | |||
| 1280 | Ga0265331_10011573 | |||
| 1281 | Ga0265331_10049624 | |||
| 1282 | Ga0265327_10028651 | |||
| 1283 | Ga0265316_10042591 | |||
| 1284 | Ga0265316_10073698 | |||
| 1285 | Ga0265316_10079221 | |||
| 1286 | Ga0265316_10140273 | |||
| 1287 | Ga0265314_10004539 | |||
| 1288 | Ga0265314_10010141 | |||
| 1289 | Ga0265314_10071223 | |||
| 1290 | Ga0265314_10075727 | |||
| 1291 | Ga0265314_10098526 | |||
| 1292 | Ga0265314_10145502 | |||
| 1293 | Ga0265314_10153391 | |||
| 1294 | Ga0265342_10009741 | |||
| 1295 | Ga0307412_10155586 | |||
| 1296 | Ga0307412_10248662 | |||
| 1297 | Ga0307409_100006768 | |||
| 1298 | Ga0307416_100446796 | |||
| 1299 | Ga0307411_10048450 | |||
| 1300 | Ga0307415_100118188 | |||
| 1301 | Ga0316214_1006610 | |||
| 1302 | Ga0373923_0005377 | |||
| 1303 | Ga0373923_0051490 | |||
| 1304 | Ga0373923_0056228 | |||
| 1305 | Ga0373945_0003625 | |||
| 1306 | Ga0373945_0021405 | |||
| 1307 | Ga0373953_0011708 | |||
| 1308 | Ga0373956_0009712 | |||
| 1309 | Ga0373956_0017984 | |||
| 1310 | Ga0373957_0005803 | |||
| 1311 | Ga0373957_0006934 | |||
| 1312 | Ga0373943_0000085 | |||
| 1313 | Ga0373943_0003611 | |||
| 1314 | Ga0373946_0003034 | |||
| 1315 | Ga0373946_0034891 | |||
| 1316 | Ga0373924_0000431 | |||
| 1317 | Ga0373924_0002004 | |||
| 1318 | Ga0373931_0123558 | |||
| 1319 | Ga0373935_0005099 | |||
| 1320 | Ga0373935_0018553 | |||
| 1321 | Ga0373927_0000441 | |||
| 1322 | Ga0373927_0012059 | |||
| 1323 | Ga0373933_0048470 | |||
| 1324 | Ga0373947_0000049 | |||
| 1325 | Ga0373947_0016305 | |||
| 1326 | Ga0373947_0031834 | |||
| 1327 | Ga0373937_0000140 | |||
| 1328 | Ga0373937_0048635 | |||
| 1329 | Ga0373937_0053953 | |||
| 1330 | Ga0373937_0194150 | |||
| 1331 | Ga0373925_0001549 | |||
| 1332 | Ga0373925_0010285 | |||
| 1333 | Ga0373925_0021077 | |||
| 1334 | Ga0395900_0230540 | |||
| 1335 | Ga0395898_0102701 | |||
| 1336 | Ga0395905_0072245 | |||
| 1337 | Ga0395905_0088952 | |||
| 1338 | Ga0395905_0090084 | |||
| 1339 | Ga0436364_0350231 | |||
| 1340 | Ga0395901_0138709 | |||
| 1341 | Ga0436360_0607181 | |||
| 1342 | Ga0436363_0873349 | |||
| 1343 | Ga0436363_1620627 | |||
| 1344 | Ga0451577_0001386 | |||
| 1345 | Ga0453683_0039642 | |||
| 1346 | Ga0466965_0193091 | |||
| 1347 | Ga0466963_0001110 | |||
| 1348 | Ga0466963_0134854 | |||
| 1349 | Ga0466963_0164523 | |||
| 1350 | Ga0466964_0088471 | |||
| 1351 | Ga0453684_0000324 | |||
| 1352 | Ga0466957_0002324 | |||
| 1353 | Ga0466959_0024546 | |||
| 1354 | Ga0466959_0261650 | |||
| 1355 | Ga0451576_0055889 | |||
| 1356 | Ga0451576_0066644 | |||
| 1357 | Ga0466958_0158659 | |||
| 1358 | Ga0466967_0002707 | |||
| 1359 | Ga0466967_0054224 | |||
| 1360 | Ga0466967_0083310 | |||
| 1361 | Ga0466967_0528954 | |||
| 1362 | Ga0495651_0161894 | |||
| 1363 | Ga0495653_0115884 | |||
| 1364 | Ga0495580_0000448 | |||
| 1365 | Ga0495580_0002832 | |||
| 1366 | Ga0495580_0008841 | |||
| 1367 | Ga0495580_0009224 | |||
| 1368 | Ga0495580_0044807 | |||
| 1369 | Ga0495580_0096778 | |||
| 1370 | Ga0495580_0206887 | |||
| 1371 | Ga0495582_0001056 | |||
| 1372 | Ga0495582_0022390 | |||
| 1373 | Ga0495582_0027409 | |||
| 1374 | Ga0495594_0093992 | |||
| 1375 | Ga0495608_0084036 | |||
| 1376 | Ga0495628_0100889 | |||
| 1377 | Ga0495630_0026417 | |||
| 1378 | Ga0495665_0002114 | |||
| 1379 | Ga0495665_0053398 | |||
| 1380 | Ga0495659_0009191 | |||
| 1381 | Ga0495599_0094865 | |||
| 1382 | Ga0495623_0003146 | |||
| 1383 | Ga0495623_0045665 | |||
| 1384 | Ga0495658_0055445 | |||
| 1385 | Ga0495669_0014999 | |||
| 1386 | Ga0495669_0137425 | |||
| 1387 | Ga0495624_0223863 | |||
| 1388 | Ga0495600_0125701 | |||
| 1389 | Ga0495581_0172397 | |||
| 1390 | Ga0495604_0037361 | |||
| 1391 | Ga0495676_0181453 | |||
| 1392 | Ga0495680_0245938 | |||
| 1393 | Ga0495675_0014882 | |||
| 1394 | Ga0495684_0137288 | |||
| 1395 | Ga0495593_0127833 | |||
| 1396 | Ga0495602_0103688 | |||
| 1397 | Ga0496100_0077744 | |||
| 1398 | Ga0496101_0059798 | |||
| 1399 | Ga0496101_0100935 | |||
| 1400 | Ga0496102_0001130 | |||
| 1401 | Ga0496102_0183497 | |||
| 1402 | Ga0496102_0196274 | |||
| 1403 | Ga0496102_0399858 | |||
| 1404 | Ga0496103_0002084 | |||
| 1405 | Ga0496103_0230744 | |||
| 1406 | Ga0496104_0133562 | |||
| 1407 | Ga0496105_0001548 | |||
| 1408 | Ga0496105_0013752 | |||
| 1409 | Ga0496105_0160456 | |||
| 1410 | Ga0496106_0078505 | |||
| 1411 | Ga0496107_0104069 | |||
| 1412 | Ga0496107_0188982 | |||
| 1413 | Ga0496108_0000329 | |||
| 1414 | Ga0496109_0000084 | |||
| 1415 | Ga0496109_0065900 | |||
| 1416 | Ga0496110_0014106 | |||
| 1417 | Ga0496110_0039017 | |||
| 1418 | Ga0496110_0263126 | |||
| 1419 | Ga0496111_0018144 | |||
| 1420 | Ga0496111_0081058 | |||
| 1421 | Ga0496112_0000030 | |||
| 1422 | Ga0496112_0005183 | |||
| 1423 | Ga0496112_0010593 | |||
| 1424 | Ga0496112_0011664 | |||
| 1425 | Ga0496112_0017674 | |||
| 1426 | Ga0496112_0209211 | |||
| 1427 | Ga0496112_0265707 | |||
| 1428 | Ga0496113_0000877 | |||
| 1429 | Ga0496114_0230663 | |||
| 1430 | Ga0496115_0017185 | |||
| 1431 | nmdc:mga0n895_121152_c1 | |||
| 1432 | nmdc:mga0n895_242975_c1 | |||
| 1433 | nmdc:mga0n895_2972_c1 | |||
| 1434 | nmdc:mga0n895_662_c1 | |||
| 1435 | nmdc:mga0rr50_29961_c1 | |||
| 1436 | nmdc:mga0rr50_319252_c1 | |||
| 1437 | nmdc:mga0rr50_32418_c1 | |||
| 1438 | nmdc:mga0rr50_6153_c1 | |||
| 1439 | nmdc:mga08x19_14163_c1 | |||
| 1440 | nmdc:mga08x19_2262_c1 | |||
| 1441 | nmdc:mga08x19_7417_c1 | |||
| 1442 | nmdc:mga08x19_9704_c1 | |||
| 1443 | nmdc:mga0a205_5062_c1 | |||
| 1444 | nmdc:mga0a205_6820_c1 | |||
| 1445 | Ga0495612_0075489 | |||
| 1446 | Ga0495595_0133747 | |||
| 1447 | Ga0495619_0139970 | |||
| 1448 | Ga0501082_0208548 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3o66-assembly1.cif.gz_A | crystal structure of glycine betaine/carnitine/choline abc transporter | 0.7854 | 21 | 60 |
| 4xcw-assembly2.cif.gz_D | crystal structure of molybdenum cofactor biosynthesis protein moga from helicobacter pylori str. j99 | 0.7174 | 21 | 81 |
| 6eyq-assembly1.cif.gz_A | crystal structure of a mutated opubc in complex with choline | 0.7141 | 24 | 65 |
| 6eyl-assembly2.cif.gz_B | crystal structure of opubc in complex with carnitine | 0.7088 | 23 | 65 |
| 7d62-assembly1.cif.gz_A | pgpg-specific phosphodiesterase - pggh from vibrio cholrae | 0.7073 | 22 | 338 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9LXC3_291_389_3.10.310.30 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; | 0.7658 | 268 | 323 | 3.10.310.30 |
| af_A0A1D6HFN8_137_214_3.10.310.30 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; | 0.7361 | 263 | 327 | 3.10.310.30 |
| af_P37676_23_328_3.40.190.170 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.7253 | 21 | 60 | 3.40.190.170 |
| 3k02A01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.7025 | 21 | 63 | 3.40.190.10 |
| af_Q2FXM3_201_313_3.10.310.30 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; | 0.7011 | 228 | 340 | 3.10.310.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7X1X0-F1-model_v4 | Phosphoesterase | 0.9945 | 23 | 156 |
|
| AF-A0A2V9TSG5-F1-model_v4 | Phosphoesterase | 0.9925 | 23 | 264 |
|
| AF-A0A841JNP4-F1-model_v4 | Phosphoesterase | 0.9881 | 23 | 338 |
|
| AF-A0A2V7X8P8-F1-model_v4 | Phosphoesterase | 0.9852 | 127 | 342 |
|
| AF-A0A838GW61-F1-model_v4 | deleted | 0.9846 | 23 | 114 |
|