F477366

General Info

Members Datasets Scaffolds Average Seq Length
721 285 1442 438

Family's Representative Sequence

Representative Sequence 3300025921|Ga0207652_10006097|Ga0207652_100060978
Length 430
Sequence MTEIASIHAREILDSRGNPTVEADVVLEDGTRGRAAVPSGASTGEHEAVELRDGDKEHYLGKGVLQAVENVESLIAPELQGMDAANQRLIDATMIAIDGTENKGKLGANAILAVSMACARASAQALGVPLYRYIGGLNACILPTPMMNILNGGAHADNNVDFQEFMVMPVGAETFSDALRWGTEVFHTLKGVLKKKGYNTAVGDEGGFAPSLKSNVEALEVILEAIELAGYKVGEQIAIALDPAASEFYNKDTGKYVFKKSDKSEKNSEQMAAYWESWVRQYPIISIEDGLAEDDWTGWKILTEKVGRTTQLVGDDLFVTNSKRLQRGIEEGVANSILVKVNQIGTISETLDAIELARRNGYTSIISHRSGETEDTFIADLAVGTGAGQIKTGSASRTDRIAKYNQLLRIEEELGQTAQFLGRASVNCGE

Samples

Sample ID Description Type Environment
1 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
116 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
184 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
185 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
188 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
189 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
190 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
191 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
194 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
195 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
196 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
197 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
198 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
199 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
202 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
203 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
209 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
212 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
216 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
217 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
218 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
219 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
220 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
221 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
222 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
223 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
224 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
225 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
226 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
229 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
230 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
231 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
232 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
233 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
234 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
235 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
236 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
237 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
238 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
252 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
260 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
261 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
262 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
263 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
264 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
265 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
266 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
267 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
268 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
269 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
270 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
271 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
272 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
273 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
281 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
282 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
283 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
284 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
285 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.75
Metatranscriptomes 0.69
Isolates 0.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 3.47
Rhizosphere 95.7
Stem 0
Stem Tuber 0
Unclassified 0.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207652_10006097 3300025921 Bacteria 9753
2 MBSR1b_contig_7733811 2162886012 Bacteria 2112
3 JGI24034J26672_10000892 3300002239 Bacteria 3892
4 rootH2_10014965 3300003320 Bacteria 14011
5 Ga0065712_10004189 3300005290 Bacteria 5515
6 Ga0065712_10016765 3300005290 Bacteria 1919
7 Ga0065715_10092986 3300005293 Bacteria 4850
8 Ga0070658_10083614 3300005327 Bacteria 2624
9 Ga0070658_10221785 3300005327 Bacteria 1599
10 Ga0070676_10008787 3300005328 Bacteria 5452
11 Ga0070683_100001910 3300005329 Bacteria 16302
12 Ga0070683_100015621 3300005329 Bacteria 6673
13 Ga0070683_100093302 3300005329 Bacteria 2828
14 Ga0070683_100133021 3300005329 Bacteria 2354
15 Ga0070670_100001939 3300005331 Bacteria 16933
16 Ga0070677_10011803 3300005333 Bacteria 3021
17 Ga0068869_100005267 3300005334 Bacteria 8124
18 Ga0068869_100011474 3300005334 Bacteria 5811
19 Ga0068869_100059867 3300005334 Bacteria 2789
20 Ga0068869_100061455 3300005334 Bacteria 2756
21 Ga0070666_10018525 3300005335 Bacteria 4479
22 Ga0070680_100026207 3300005336 Bacteria 4663
23 Ga0070682_100016758 3300005337 Bacteria 4264
24 Ga0068868_100000991 3300005338 Bacteria 19363
25 Ga0068868_100008904 3300005338 Bacteria 7194
26 Ga0068868_100019302 3300005338 Bacteria 5107
27 Ga0068868_100019411 3300005338 Bacteria 5093
28 Ga0068868_100026260 3300005338 Bacteria 4436
29 Ga0070660_100242763 3300005339 Bacteria 1467
30 Ga0070689_100001082 3300005340 Bacteria 17081
31 Ga0070689_100029955 3300005340 Bacteria 4127
32 Ga0070661_100010865 3300005344 Bacteria 6341
33 Ga0070692_10089125 3300005345 Bacteria 1674
34 Ga0070668_100046647 3300005347 Bacteria 3328
35 Ga0070668_100084268 3300005347 Bacteria 2496
36 Ga0070669_100066064 3300005353 Bacteria 2665
37 Ga0070675_100008528 3300005354 Bacteria 7958
38 Ga0070675_100021708 3300005354 Bacteria 5129
39 Ga0070671_100142141 3300005355 Bacteria 2025
40 Ga0070674_100002948 3300005356 Bacteria 9436
41 Ga0070674_100010250 3300005356 Bacteria 5655
42 Ga0070673_100028947 3300005364 Bacteria 4126
43 Ga0070673_100040856 3300005364 Bacteria 3561
44 Ga0070688_100000289 3300005365 Bacteria 25802
45 Ga0070688_100023744 3300005365 Bacteria 3610
46 Ga0070659_100002441 3300005366 Bacteria 13204
47 Ga0070659_100012571 3300005366 Bacteria 6276
48 Ga0070667_100019230 3300005367 Bacteria 5665
49 Ga0070667_100056955 3300005367 Bacteria 3302
50 Ga0070667_100064298 3300005367 Bacteria 3113
51 Ga0070709_10002435 3300005434 Bacteria 10083
52 Ga0070709_10006252 3300005434 Bacteria 6483
53 Ga0070709_10102098 3300005434 Bacteria 1913
54 Ga0070714_100001114 3300005435 Bacteria 19295
55 Ga0070714_100002389 3300005435 Bacteria 13814
56 Ga0070714_100011371 3300005435 Bacteria 7060
57 Ga0070714_100078862 3300005435 Bacteria 2863
58 Ga0070713_100023352 3300005436 Bacteria 4797
59 Ga0070713_100027439 3300005436 Bacteria 4482
60 Ga0070713_100056250 3300005436 Bacteria 3272
61 Ga0070713_100077822 3300005436 Bacteria 2821
62 Ga0070710_10022116 3300005437 Bacteria 3323
63 Ga0070710_10040012 3300005437 Bacteria 2582
64 Ga0070711_100042150 3300005439 Bacteria 3084
65 Ga0070711_100079707 3300005439 Bacteria 2329
66 Ga0070711_100212480 3300005439 Bacteria 1499
67 Ga0070700_100050944 3300005441 Bacteria 2576
68 Ga0070694_100000701 3300005444 Bacteria 18653
69 Ga0070708_100000443 3300005445 Bacteria 30954
70 Ga0070708_100004243 3300005445 Bacteria 11260
71 Ga0070708_100013479 3300005445 Bacteria 6695
72 Ga0070708_100021725 3300005445 Bacteria 5433
73 Ga0070708_100029327 3300005445 Bacteria 4744
74 Ga0070708_100186594 3300005445 Bacteria 1939
75 Ga0070663_100007577 3300005455 Bacteria 6619
76 Ga0070663_100061519 3300005455 Bacteria 2704
77 Ga0070662_100004251 3300005457 Bacteria 9028
78 Ga0070662_100016834 3300005457 Bacteria 4914
79 Ga0070662_100103594 3300005457 Bacteria 2158
80 Ga0070681_10000091 3300005458 Bacteria 67429
81 Ga0070681_10048708 3300005458 Bacteria 4234
82 Ga0070681_10132477 3300005458 Bacteria 2425
83 Ga0070681_10142530 3300005458 Bacteria 2326
84 Ga0068867_100002857 3300005459 Bacteria 12148
85 Ga0068867_100003152 3300005459 Bacteria 11625
86 Ga0068867_100035780 3300005459 Bacteria 3603
87 Ga0068867_100046263 3300005459 Bacteria 3195
88 Ga0070685_10002319 3300005466 Bacteria 9808
89 Ga0070685_10034550 3300005466 Bacteria 2848
90 Ga0070706_100000706 3300005467 Bacteria 37581
91 Ga0070706_100011053 3300005467 Bacteria 8381
92 Ga0070707_100043108 3300005468 Bacteria 4319
93 Ga0070698_100000638 3300005471 Bacteria 37638
94 Ga0070698_100009020 3300005471 Bacteria 10723
95 Ga0070698_100032703 3300005471 Bacteria 5386
96 Ga0070698_100037822 3300005471 Bacteria 4975
97 Ga0070699_100010924 3300005518 Bacteria 7855
98 Ga0070699_100015286 3300005518 Bacteria 6595
99 Ga0070699_100027894 3300005518 Bacteria 4870
100 Ga0070699_100088395 3300005518 Bacteria 2706
101 Ga0070699_100208974 3300005518 Bacteria 1737
102 Ga0070699_100232560 3300005518 Bacteria 1644
103 Ga0070679_100009934 3300005530 Bacteria 9009
104 Ga0070679_100011535 3300005530 Bacteria 8423
105 Ga0070679_100052462 3300005530 Bacteria 4061
106 Ga0070679_100100390 3300005530 Bacteria 2881
107 Ga0070679_100157010 3300005530 Bacteria 2249
108 Ga0070684_100001382 3300005535 Bacteria 17441
109 Ga0070684_100035220 3300005535 Bacteria 4284
110 Ga0070684_100065510 3300005535 Bacteria 3189
111 Ga0070684_100082412 3300005535 Bacteria 2848
112 Ga0070684_100119125 3300005535 Bacteria 2374
113 Ga0070684_100255357 3300005535 Bacteria 1602
114 Ga0070697_100000122 3300005536 Bacteria 61581
115 Ga0070697_100000190 3300005536 Bacteria 50723
116 Ga0070697_100001893 3300005536 Bacteria 15997
117 Ga0070697_100001942 3300005536 Bacteria 15820
118 Ga0070697_100074908 3300005536 Bacteria 2781
119 Ga0070697_100117006 3300005536 Bacteria 2227
120 Ga0068853_100011958 3300005539 Bacteria 7059
121 Ga0068853_100016719 3300005539 Bacteria 6041
122 Ga0068853_100026049 3300005539 Bacteria 4909
123 Ga0068853_100037904 3300005539 Bacteria 4105
124 Ga0068853_100064676 3300005539 Bacteria 3173
125 Ga0068853_100071082 3300005539 Bacteria 3030
126 Ga0068853_100220743 3300005539 Bacteria 1731
127 Ga0070672_100002640 3300005543 Bacteria 11462
128 Ga0070686_100010874 3300005544 Bacteria 5150
129 Ga0070686_100039308 3300005544 Bacteria 2947
130 Ga0070695_100139645 3300005545 Bacteria 1679
131 Ga0070696_100003116 3300005546 Bacteria 11034
132 Ga0070696_100116489 3300005546 Bacteria 1929
133 Ga0070665_100090717 3300005548 Bacteria 3062
134 Ga0068855_100001870 3300005563 Bacteria 26178
135 Ga0068855_100002676 3300005563 Bacteria 21960
136 Ga0068855_100005074 3300005563 Bacteria 16056
137 Ga0068855_100014684 3300005563 Bacteria 9434
138 Ga0068855_100036015 3300005563 Bacteria 5892
139 Ga0068855_100073434 3300005563 Bacteria 3974
140 Ga0070664_100000782 3300005564 Bacteria 24526
141 Ga0070664_100049327 3300005564 Bacteria 3560
142 Ga0070664_100290224 3300005564 Bacteria 1477
143 Ga0068857_100002750 3300005577 Bacteria 14452
144 Ga0068857_100013858 3300005577 Bacteria 7022
145 Ga0068857_100029847 3300005577 Bacteria 4811
146 Ga0068857_100043851 3300005577 Bacteria 3967
147 Ga0068857_100101724 3300005577 Bacteria 2579
148 Ga0068854_100008839 3300005578 Bacteria 6483
149 Ga0068854_100020111 3300005578 Bacteria 4510
150 Ga0068856_100000107 3300005614 Bacteria 81707
151 Ga0068856_100000900 3300005614 Bacteria 31839
152 Ga0068856_100003544 3300005614 Bacteria 15716
153 Ga0068856_100018743 3300005614 Bacteria 6709
154 Ga0068856_100026009 3300005614 Bacteria 5707
155 Ga0068856_100042739 3300005614 Bacteria 4459
156 Ga0068856_100049453 3300005614 Bacteria 4144
157 Ga0070702_100002886 3300005615 Bacteria 7556
158 Ga0070702_100007315 3300005615 Bacteria 5281
159 Ga0068852_100001821 3300005616 Bacteria 14493
160 Ga0068852_100004228 3300005616 Bacteria 10134
161 Ga0068852_100009113 3300005616 Bacteria 7348
162 Ga0068852_100032494 3300005616 Bacteria 4321
163 Ga0068852_100201084 3300005616 Bacteria 1886
164 Ga0068859_100000573 3300005617 Bacteria 36716
165 Ga0068859_100015326 3300005617 Bacteria 7700
166 Ga0068859_100037738 3300005617 Bacteria 4849
167 Ga0068859_100098794 3300005617 Bacteria 2973
168 Ga0068859_100252159 3300005617 Bacteria 1855
169 Ga0068864_100003555 3300005618 Bacteria 12884
170 Ga0068864_100003567 3300005618 Bacteria 12861
171 Ga0068864_100025817 3300005618 Bacteria 4951
172 Ga0068864_100170364 3300005618 Bacteria 1985
173 Ga0068866_10003201 3300005718 Bacteria 6745
174 Ga0068861_100002752 3300005719 Bacteria 11529
175 Ga0068861_100017888 3300005719 Bacteria 5038
176 Ga0068851_10002205 3300005834 Bacteria 8567
177 Ga0068851_10064732 3300005834 Bacteria 1879
178 Ga0068863_100014276 3300005841 Bacteria 7650
179 Ga0068863_100031732 3300005841 Bacteria 5041
180 Ga0068863_100036081 3300005841 Bacteria 4708
181 Ga0068863_100037763 3300005841 Bacteria 4596
182 Ga0068863_100053669 3300005841 Bacteria 3821
183 Ga0068863_100061157 3300005841 Bacteria 3560
184 Ga0068863_100068329 3300005841 Bacteria 3362
185 Ga0068858_100000430 3300005842 Bacteria 43681
186 Ga0068858_100000597 3300005842 Bacteria 37673
187 Ga0068858_100022034 3300005842 Bacteria 5950
188 Ga0068858_100047702 3300005842 Bacteria 3970
189 Ga0068858_100103475 3300005842 Bacteria 2656
190 Ga0068858_100165397 3300005842 Bacteria 2084
191 Ga0068860_100081440 3300005843 Bacteria 3078
192 Ga0068862_100013951 3300005844 Bacteria 6661
193 Ga0068862_100033898 3300005844 Bacteria 4319
194 Ga0070717_10006164 3300006028 Bacteria 8803
195 Ga0070717_10008636 3300006028 Bacteria 7617
196 Ga0070717_10015653 3300006028 Bacteria 5861
197 Ga0070717_10024547 3300006028 Bacteria 4788
198 Ga0070717_10044754 3300006028 Bacteria 3617
199 Ga0070717_10127596 3300006028 Bacteria 2185
200 Ga0070717_10200794 3300006028 Bacteria 1746
201 Ga0075364_10000724 3300006051 Bacteria 17261
202 Ga0070716_100000002 3300006173 Bacteria 396037
203 Ga0070716_100000080 3300006173 Bacteria 37843
204 Ga0070716_100015203 3300006173 Bacteria 3950
205 Ga0070712_100000087 3300006175 Bacteria 48016
206 Ga0070712_100000422 3300006175 Bacteria 24266
207 Ga0070712_100010552 3300006175 Bacteria 5832
208 Ga0070712_100010789 3300006175 Bacteria 5776
209 Ga0070712_100011697 3300006175 Bacteria 5574
210 Ga0070712_100074001 3300006175 Bacteria 2446
211 Ga0097621_100000223 3300006237 Bacteria 37820
212 Ga0097621_100000442 3300006237 Bacteria 29002
213 Ga0097621_100009274 3300006237 Bacteria 7141
214 Ga0097621_100013894 3300006237 Bacteria 6013
215 Ga0097621_100031884 3300006237 Bacteria 4183
216 Ga0097621_100111429 3300006237 Bacteria 2313
217 Ga0068871_100000231 3300006358 Bacteria 39603
218 Ga0068871_100035521 3300006358 Bacteria 3961
219 Ga0068871_100047477 3300006358 Bacteria 3463
220 Ga0068871_100053436 3300006358 Bacteria 3274
221 Ga0075430_100045650 3300006846 Bacteria 3701
222 Ga0075431_100072730 3300006847 Bacteria 3548
223 Ga0075434_100000037 3300006871 Bacteria 60689
224 Ga0075434_100017528 3300006871 Bacteria 6903
225 Ga0075434_100108192 3300006871 Bacteria 2791
226 Ga0068865_100017191 3300006881 Bacteria 4647
227 Ga0068865_100056963 3300006881 Bacteria 2725
228 Ga0075436_100000180 3300006914 Bacteria 39663
229 Ga0075436_100002076 3300006914 Bacteria 13824
230 Ga0075436_100039846 3300006914 Bacteria 3242
231 Ga0075436_100051773 3300006914 Bacteria 2833
232 Ga0075436_100057614 3300006914 Bacteria 2683
233 Ga0075436_100171485 3300006914 Bacteria 1532
234 Ga0097620_100000573 3300006931 Bacteria 36716
235 Ga0097620_100015326 3300006931 Bacteria 7700
236 Ga0097620_100037736 3300006931 Bacteria 4849
237 Ga0097620_100098803 3300006931 Bacteria 2973
238 Ga0097620_100252151 3300006931 Bacteria 1855
239 Ga0075435_100014691 3300007076 Bacteria 5867
240 Ga0075435_100020756 3300007076 Bacteria 5041
241 Ga0075435_100025070 3300007076 Bacteria 4638
242 Ga0099794_10055634 3300007265 Bacteria 1912
243 Ga0105240_10012427 3300009093 Bacteria 11755
244 Ga0105240_10014933 3300009093 Bacteria 10580
245 Ga0105240_10019314 3300009093 Bacteria 9108
246 Ga0105240_10053942 3300009093 Bacteria 5041
247 Ga0105240_10063496 3300009093 Bacteria 4594
248 Ga0105240_10078495 3300009093 Bacteria 4065
249 Ga0105245_10148304 3300009098 Bacteria 2215
250 Ga0105247_10001769 3300009101 Bacteria 15200
251 Ga0114129_10152262 3300009147 Bacteria 3164
252 Ga0105241_10006319 3300009174 Bacteria 8741
253 Ga0105241_10008758 3300009174 Bacteria 7436
254 Ga0105241_10040439 3300009174 Bacteria 3520
255 Ga0105242_10257131 3300009176 Bacteria 1576
256 Ga0105248_10003198 3300009177 Bacteria 18158
257 Ga0105248_10028470 3300009177 Bacteria 6224
258 Ga0105248_10104015 3300009177 Bacteria 3201
259 Ga0105237_10011633 3300009545 Bacteria 9314
260 Ga0105237_10018617 3300009545 Bacteria 7185
261 Ga0105237_10018696 3300009545 Bacteria 7165
262 Ga0105237_10151773 3300009545 Bacteria 2313
263 Ga0105237_10179622 3300009545 Bacteria 2117
264 Ga0105238_10000090 3300009551 Bacteria 102374
265 Ga0105238_10010307 3300009551 Bacteria 9377
266 Ga0105238_10130746 3300009551 Bacteria 2489
267 Ga0105238_10143360 3300009551 Bacteria 2365
268 Ga0105249_10090905 3300009553 Bacteria 2855
269 Ga0105239_10011260 3300010375 Bacteria 9977
270 Ga0105239_10054790 3300010375 Bacteria 4375
271 Ga0105246_10002416 3300011119 Bacteria 11268
272 Ga0157373_10006047 3300013100 Bacteria 9050
273 Ga0157373_10007569 3300013100 Bacteria 8071
274 Ga0157373_10014686 3300013100 Bacteria 5738
275 Ga0157373_10027469 3300013100 Bacteria 4106
276 Ga0157371_10006502 3300013102 Bacteria 9624
277 Ga0157371_10015018 3300013102 Bacteria 5822
278 Ga0157371_10081473 3300013102 Bacteria 2292
279 Ga0157371_10102390 3300013102 Unclassified 2031
280 Ga0157370_10019465 3300013104 Bacteria 6809
281 Ga0157370_10053233 3300013104 Bacteria 3861
282 Ga0157370_10073611 3300013104 Bacteria 3223
283 Ga0157369_10000102 3300013105 Bacteria 118470
284 Ga0157369_10016955 3300013105 Bacteria 8186
285 Ga0157369_10061675 3300013105 Bacteria 4041
286 Ga0157369_10109516 3300013105 Bacteria 2937
287 Ga0157369_10114311 3300013105 Bacteria 2867
288 Ga0157374_10000097 3300013296 Bacteria 81947
289 Ga0157374_10000567 3300013296 Bacteria 32753
290 Ga0157374_10006274 3300013296 Bacteria 10080
291 Ga0157374_10009761 3300013296 Bacteria 8242
292 Ga0157374_10014895 3300013296 Bacteria 6814
293 Ga0157374_10016300 3300013296 Bacteria 6528
294 Ga0157374_10028450 3300013296 Bacteria 5049
295 Ga0157374_10030974 3300013296 Bacteria 4858
296 Ga0157374_10058996 3300013296 Bacteria 3587
297 Ga0157378_10000104 3300013297 Bacteria 80068
298 Ga0157378_10000151 3300013297 Bacteria 65215
299 Ga0157378_10054277 3300013297 Bacteria 3568
300 Ga0157378_10171837 3300013297 Bacteria 2033
301 Ga0163162_10008499 3300013306 Bacteria 10011
302 Ga0163162_10014501 3300013306 Bacteria 7701
303 Ga0163162_10108280 3300013306 Bacteria 2875
304 Ga0163162_10145922 3300013306 Bacteria 2483
305 Ga0157372_10000242 3300013307 Bacteria 60460
306 Ga0157372_10001297 3300013307 Bacteria 27025
307 Ga0157372_10001548 3300013307 Bacteria 25035
308 Ga0157372_10004725 3300013307 Bacteria 14467
309 Ga0157372_10005138 3300013307 Bacteria 13911
310 Ga0157372_10020482 3300013307 Bacteria 7136
311 Ga0157372_10027137 3300013307 Bacteria 6233
312 Ga0157372_10032088 3300013307 Bacteria 5756
313 Ga0157372_10042625 3300013307 Bacteria 5021
314 Ga0157372_10090403 3300013307 Bacteria 3481
315 Ga0157372_10098252 3300013307 Bacteria 3340
316 Ga0157372_10120358 3300013307 Bacteria 3015
317 Ga0157372_10205722 3300013307 Bacteria 2281
318 Ga0157375_10003505 3300013308 Bacteria 13607
319 Ga0157375_10026260 3300013308 Bacteria 5424
320 Ga0163163_10000958 3300014325 Bacteria 24503
321 Ga0163163_10007378 3300014325 Bacteria 9702
322 Ga0163163_10040057 3300014325 Bacteria 4574
323 Ga0157380_10025245 3300014326 Bacteria 4505
324 Ga0182008_10010903 3300014497 Bacteria 4849
325 Ga0157377_10000467 3300014745 Bacteria 17434
326 Ga0157379_10000392 3300014968 Bacteria 35411
327 Ga0157379_10027588 3300014968 Bacteria 5056
328 Ga0157379_10219868 3300014968 Bacteria 1721
329 Ga0157376_10039099 3300014969 Bacteria 3865
330 Ga0157376_10040864 3300014969 Bacteria 3793
331 Ga0157376_10153511 3300014969 Bacteria 2079
332 Ga0182007_10000569 3300015262 Bacteria 21687
333 Ga0182007_10010052 3300015262 Bacteria 3764
334 Ga0163161_10003590 3300017792 Bacteria 10872
335 Ga0163161_10108815 3300017792 Bacteria 2070
336 Ga0224572_1004467 3300024225 Bacteria 2435
337 Ga0228598_1000094 3300024227 Bacteria 14552
338 Ga0207697_10017314 3300025315 Bacteria 2962
339 Ga0207656_10005884 3300025321 Bacteria 4372
340 Ga0207692_10012061 3300025898 Bacteria 3701
341 Ga0207692_10052806 3300025898 Bacteria 2067
342 Ga0207642_10019875 3300025899 Bacteria 2610
343 Ga0207710_10007130 3300025900 Bacteria 4742
344 Ga0207710_10010695 3300025900 Bacteria 3863
345 Ga0207688_10000372 3300025901 Bacteria 20907
346 Ga0207680_10037890 3300025903 Bacteria 2787
347 Ga0207680_10132419 3300025903 Bacteria 1645
348 Ga0207647_10001560 3300025904 Bacteria 17609
349 Ga0207647_10010323 3300025904 Bacteria 6596
350 Ga0207647_10022428 3300025904 Bacteria 4193
351 Ga0207685_10044913 3300025905 Bacteria 1673
352 Ga0207699_10005753 3300025906 Bacteria 5965
353 Ga0207699_10034947 3300025906 Bacteria 2856
354 Ga0207699_10085396 3300025906 Bacteria 1968
355 Ga0207645_10000051 3300025907 Bacteria 84255
356 Ga0207643_10000079 3300025908 Bacteria 63366
357 Ga0207643_10020192 3300025908 Bacteria 3655
358 Ga0207684_10003254 3300025910 Bacteria 15938
359 Ga0207684_10007388 3300025910 Bacteria 9897
360 Ga0207684_10066380 3300025910 Bacteria 3064
361 Ga0207707_10037045 3300025912 Bacteria 4262
362 Ga0207707_10039490 3300025912 Bacteria 4125
363 Ga0207707_10135047 3300025912 Bacteria 2157
364 Ga0207695_10000087 3300025913 Bacteria 276412
365 Ga0207695_10004625 3300025913 Bacteria 18666
366 Ga0207695_10016312 3300025913 Bacteria 8697
367 Ga0207695_10039989 3300025913 Bacteria 5034
368 Ga0207695_10145302 3300025913 Bacteria 2316
369 Ga0207671_10031668 3300025914 Bacteria 3940
370 Ga0207671_10150486 3300025914 Bacteria 1798
371 Ga0207693_10000090 3300025915 Bacteria 81069
372 Ga0207693_10000509 3300025915 Bacteria 35091
373 Ga0207693_10000781 3300025915 Bacteria 28462
374 Ga0207693_10001949 3300025915 Bacteria 18078
375 Ga0207693_10005269 3300025915 Bacteria 10816
376 Ga0207693_10028595 3300025915 Bacteria 4405
377 Ga0207693_10032372 3300025915 Bacteria 4127
378 Ga0207693_10056486 3300025915 Bacteria 3077
379 Ga0207663_10001683 3300025916 Bacteria 10393
380 Ga0207663_10005815 3300025916 Bacteria 6249
381 Ga0207663_10013934 3300025916 Bacteria 4387
382 Ga0207663_10024702 3300025916 Bacteria 3464
383 Ga0207663_10078245 3300025916 Bacteria 2155
384 Ga0207663_10110069 3300025916 Bacteria 1868
385 Ga0207660_10019649 3300025917 Bacteria 4520
386 Ga0207657_10000292 3300025919 Bacteria 53366
387 Ga0207657_10001771 3300025919 Bacteria 23316
388 Ga0207657_10014219 3300025919 Bacteria 7781
389 Ga0207657_10153902 3300025919 Bacteria 1871
390 Ga0207649_10000242 3300025920 Bacteria 44166
391 Ga0207649_10022414 3300025920 Bacteria 3648
392 Ga0207649_10058333 3300025920 Bacteria 2417
393 Ga0207649_10086021 3300025920 Bacteria 2048
394 Ga0207652_10007041 3300025921 Bacteria 9063
395 Ga0207652_10096469 3300025921 Bacteria 2605
396 Ga0207652_10140970 3300025921 Bacteria 2155
397 Ga0207652_10310238 3300025921 Bacteria 1424
398 Ga0207646_10008591 3300025922 Bacteria 10208
399 Ga0207646_10025219 3300025922 Bacteria 5441
400 Ga0207646_10028176 3300025922 Bacteria 5115
401 Ga0207646_10041906 3300025922 Bacteria 4114
402 Ga0207681_10084096 3300025923 Bacteria 2254
403 Ga0207694_10041764 3300025924 Bacteria 3535
404 Ga0207694_10043876 3300025924 Bacteria 3451
405 Ga0207694_10072718 3300025924 Bacteria 2688
406 Ga0207694_10096143 3300025924 Bacteria 2342
407 Ga0207650_10000090 3300025925 Bacteria 118973
408 Ga0207650_10005814 3300025925 Bacteria 8415
409 Ga0207659_10002035 3300025926 Bacteria 11997
410 Ga0207659_10016513 3300025926 Bacteria 4805
411 Ga0207687_10050001 3300025927 Bacteria 2909
412 Ga0207687_10056506 3300025927 Bacteria 2754
413 Ga0207700_10022946 3300025928 Bacteria 4291
414 Ga0207700_10027101 3300025928 Bacteria 4008
415 Ga0207700_10034937 3300025928 Bacteria 3615
416 Ga0207700_10164027 3300025928 Bacteria 1848
417 Ga0207700_10172632 3300025928 Bacteria 1805
418 Ga0207700_10179703 3300025928 Bacteria 1771
419 Ga0207664_10006502 3300025929 Bacteria 8045
420 Ga0207664_10017107 3300025929 Bacteria 5305
421 Ga0207664_10031030 3300025929 Bacteria 4085
422 Ga0207664_10035137 3300025929 Bacteria 3865
423 Ga0207664_10052405 3300025929 Bacteria 3227
424 Ga0207664_10063833 3300025929 Bacteria 2944
425 Ga0207644_10002582 3300025931 Bacteria 11652
426 Ga0207690_10034289 3300025932 Bacteria 3269
427 Ga0207690_10045769 3300025932 Bacteria 2893
428 Ga0207706_10001055 3300025933 Bacteria 28007
429 Ga0207706_10075648 3300025933 Bacteria 2961
430 Ga0207706_10147820 3300025933 Bacteria 2067
431 Ga0207686_10019244 3300025934 Bacteria 3880
432 Ga0207709_10024778 3300025935 Bacteria 3430
433 Ga0207670_10001693 3300025936 Bacteria 11493
434 Ga0207669_10007412 3300025937 Bacteria 5072
435 Ga0207669_10103315 3300025937 Bacteria 1890
436 Ga0207704_10014559 3300025938 Bacteria 3975
437 Ga0207704_10027568 3300025938 Bacteria 3137
438 Ga0207704_10171381 3300025938 Bacteria 1557
439 Ga0207665_10000004 3300025939 Bacteria 218220
440 Ga0207665_10000098 3300025939 Bacteria 56075
441 Ga0207665_10007075 3300025939 Bacteria 7428
442 Ga0207665_10022811 3300025939 Bacteria 4119
443 Ga0207665_10028713 3300025939 Bacteria 3676
444 Ga0207665_10038484 3300025939 Bacteria 3185
445 Ga0207691_10001343 3300025940 Bacteria 24540
446 Ga0207711_10001668 3300025941 Bacteria 20458
447 Ga0207711_10002838 3300025941 Bacteria 15224
448 Ga0207711_10065530 3300025941 Bacteria 3140
449 Ga0207689_10000304 3300025942 Bacteria 45071
450 Ga0207689_10001724 3300025942 Bacteria 20681
451 Ga0207689_10008930 3300025942 Bacteria 8690
452 Ga0207661_10025148 3300025944 Bacteria 4524
453 Ga0207661_10039057 3300025944 Bacteria 3724
454 Ga0207661_10044684 3300025944 Bacteria 3502
455 Ga0207661_10090261 3300025944 Bacteria 2551
456 Ga0207679_10000184 3300025945 Bacteria 51157
457 Ga0207679_10036272 3300025945 Bacteria 3495
458 Ga0207667_10000279 3300025949 Bacteria 70460
459 Ga0207667_10001744 3300025949 Bacteria 27383
460 Ga0207667_10020321 3300025949 Bacteria 7391
461 Ga0207667_10037265 3300025949 Bacteria 5199
462 Ga0207667_10042232 3300025949 Bacteria 4848
463 Ga0207667_10046887 3300025949 Bacteria 4576
464 Ga0207667_10049662 3300025949 Bacteria 4430
465 Ga0207651_10000675 3300025960 Bacteria 14582
466 Ga0207712_10148875 3300025961 Bacteria 1806
467 Ga0207640_10012858 3300025981 Bacteria 4781
468 Ga0207640_10014592 3300025981 Bacteria 4527
469 Ga0207640_10015694 3300025981 Bacteria 4389
470 Ga0207640_10056959 3300025981 Bacteria 2569
471 Ga0207658_10025494 3300025986 Bacteria 4140
472 Ga0207658_10035885 3300025986 Bacteria 3553
473 Ga0207658_10142539 3300025986 Bacteria 1941
474 Ga0207677_10001706 3300026023 Bacteria 11612
475 Ga0207677_10002752 3300026023 Bacteria 9281
476 Ga0207677_10015616 3300026023 Bacteria 4473
477 Ga0207703_10005260 3300026035 Bacteria 10438
478 Ga0207703_10007408 3300026035 Bacteria 8719
479 Ga0207703_10012716 3300026035 Bacteria 6562
480 Ga0207703_10013614 3300026035 Bacteria 6338
481 Ga0207639_10002894 3300026041 Bacteria 11538
482 Ga0207639_10074658 3300026041 Bacteria 2663
483 Ga0207639_10240017 3300026041 Bacteria 1575
484 Ga0207678_10000204 3300026067 Bacteria 52306
485 Ga0207678_10002279 3300026067 Bacteria 17365
486 Ga0207708_10169638 3300026075 Bacteria 1727
487 Ga0207702_10000704 3300026078 Bacteria 35989
488 Ga0207702_10000722 3300026078 Bacteria 35418
489 Ga0207702_10005927 3300026078 Bacteria 10617
490 Ga0207702_10007030 3300026078 Bacteria 9628
491 Ga0207702_10012343 3300026078 Bacteria 7112
492 Ga0207702_10123660 3300026078 Bacteria 2319
493 Ga0207641_10000894 3300026088 Bacteria 31042
494 Ga0207641_10013975 3300026088 Bacteria 6583
495 Ga0207641_10014075 3300026088 Bacteria 6558
496 Ga0207641_10060511 3300026088 Bacteria 3228
497 Ga0207641_10080208 3300026088 Bacteria 2831
498 Ga0207641_10091556 3300026088 Bacteria 2661
499 Ga0207648_10000757 3300026089 Bacteria 36296
500 Ga0207648_10000939 3300026089 Bacteria 32903
501 Ga0207648_10011406 3300026089 Bacteria 8373
502 Ga0207648_10035449 3300026089 Bacteria 4395
503 Ga0207648_10056588 3300026089 Bacteria 3422
504 Ga0207676_10000113 3300026095 Bacteria 73022
505 Ga0207676_10004935 3300026095 Bacteria 9456
506 Ga0207676_10013970 3300026095 Bacteria 5764
507 Ga0207674_10000076 3300026116 Bacteria 104404
508 Ga0207674_10008255 3300026116 Bacteria 12057
509 Ga0207674_10034615 3300026116 Bacteria 5279
510 Ga0207674_10140972 3300026116 Bacteria 2370
511 Ga0207674_10203346 3300026116 Bacteria 1930
512 Ga0207675_100008819 3300026118 Bacteria 9464
513 Ga0207675_100034470 3300026118 Bacteria 4720
514 Ga0207683_10001129 3300026121 Bacteria 24286
515 Ga0207683_10017222 3300026121 Bacteria 6154
516 Ga0207683_10108249 3300026121 Bacteria 2487
517 Ga0207698_10033252 3300026142 Bacteria 3745
518 Ga0207698_10086056 3300026142 Bacteria 2555
519 Ga0207698_10134361 3300026142 Bacteria 2120
520 Ga0207698_10187937 3300026142 Bacteria 1837
521 Ga0207698_10245226 3300026142 Bacteria 1635
522 Ga0207698_10263457 3300026142 Bacteria 1585
523 Ga0207428_10024628 3300027907 Bacteria 5053
524 Ga0265356_1000911 3300028017 Bacteria 4784
525 Ga0268266_10005373 3300028379 Bacteria 11969
526 Ga0268266_10236342 3300028379 Bacteria 1685
527 Ga0268265_10071554 3300028380 Bacteria 2701
528 Ga0268265_10147437 3300028380 Bacteria 1980
529 Ga0268264_10023806 3300028381 Bacteria 4996
530 Ga0265323_10000160 3300028653 Bacteria 40063
531 Ga0265338_10001801 3300028800 Bacteria 33703
532 Ga0265338_10004457 3300028800 Bacteria 18896
533 Ga0265338_10005643 3300028800 Bacteria 16245
534 Ga0265762_1000687 3300030760 Bacteria 5973
535 Ga0265762_1003342 3300030760 Bacteria 2868
536 Ga0265760_10000165 3300031090 Bacteria 17427
537 Ga0265760_10000453 3300031090 Bacteria 11586
538 Ga0265760_10001485 3300031090 Bacteria 6909
539 Ga0265330_10017181 3300031235 Bacteria 3335
540 Ga0265330_10043716 3300031235 Bacteria 1981
541 Ga0265328_10018493 3300031239 Bacteria 2686
542 Ga0265340_10036904 3300031247 Bacteria 2421
543 Ga0265340_10094671 3300031247 Bacteria 1393
544 Ga0265339_10017474 3300031249 Bacteria 4248
545 Ga0265339_10019916 3300031249 Bacteria 3927
546 Ga0265339_10020131 3300031249 Bacteria 3902
547 Ga0265339_10032384 3300031249 Bacteria 2948
548 Ga0265339_10036425 3300031249 Bacteria 2754
549 Ga0265316_10002924 3300031344 Bacteria 17483
550 Ga0265316_10015408 3300031344 Bacteria 6685
551 Ga0265316_10020126 3300031344 Bacteria 5687
552 Ga0265316_10037564 3300031344 Bacteria 3908
553 Ga0265316_10069449 3300031344 Bacteria 2719
554 Ga0307408_100124673 3300031548 Bacteria 2001
555 Ga0265313_10001659 3300031595 Bacteria 20615
556 Ga0265313_10050571 3300031595 Bacteria 1993
557 Ga0265314_10010248 3300031711 Bacteria 7839
558 Ga0265342_10005264 3300031712 Bacteria 9917
559 Ga0265342_10098382 3300031712 Bacteria 1670
560 Ga0316577_10027785 3300031733 Bacteria 3154
561 Ga0307414_10062666 3300032004 Bacteria 2640
562 Ga0373926_0004752 3300035083 Bacteria 4465
563 Ga0373926_0033842 3300035083 Bacteria 1808
564 Ga0373923_0010431 3300035111 Bacteria 3379
565 Ga0373936_0005762 3300035113 Bacteria 4669
566 Ga0373936_0020056 3300035113 Bacteria 2594
567 Ga0373936_0033894 3300035113 Bacteria 2026
568 Ga0373945_0030007 3300035116 Bacteria 1914
569 Ga0373953_0011230 3300035117 Bacteria 3139
570 Ga0373956_0054511 3300035119 Bacteria 1801
571 Ga0373943_0054261 3300035170 Bacteria 1982
572 Ga0373943_0094341 3300035170 Bacteria 1555
573 Ga0373946_0016468 3300035171 Bacteria 2817
574 Ga0373946_0086271 3300035171 Bacteria 1383
575 Ga0373955_0061180 3300035172 Bacteria 2079
576 Ga0373935_0002986 3300035692 Bacteria 9760
577 Ga0373935_0160899 3300035692 Bacteria 1530
578 Ga0373927_0003084 3300035695 Bacteria 12068
579 Ga0373927_0062591 3300035695 Bacteria 2406
580 Ga0373947_0001410 3300035725 Bacteria 14808
581 Ga0373947_0015195 3300035725 Bacteria 4420
582 Ga0373947_0033965 3300035725 Bacteria 3016
583 Ga0373947_0112227 3300035725 Bacteria 1724
584 Ga0373937_0012137 3300036401 Bacteria 7563
585 Ga0373937_0165739 3300036401 Bacteria 2072
586 Ga0316582_0111802 3300036647 Bacteria 1819
587 Ga0373925_0001030 3300037068 Bacteria 25248
588 Ga0373925_0060442 3300037068 Bacteria 2846
589 Ga0373925_0106880 3300037068 Bacteria 2158
590 Ga0395900_0275049 3300037418 Bacteria 1678
591 Ga0395905_0017369 3300037471 Bacteria 6832
592 Ga0395905_0024815 3300037471 Bacteria 5658
593 Ga0436360_0937468 3300039438 Bacteria 4208
594 Ga0436363_0917216 3300039450 Bacteria 6966
595 Ga0436362_0596532 3300039453 Bacteria 9112
596 Ga0439433_0012151 3300041999 Bacteria 1887
597 Ga0451577_0000614 3300042876 Bacteria 57427
598 Ga0451577_0001499 3300042876 Bacteria 30880
599 Ga0451577_0014025 3300042876 Bacteria 7478
600 Ga0453683_0001723 3300044673 Bacteria 18154
601 Ga0453683_0008052 3300044673 Bacteria 7096
602 Ga0453683_0009742 3300044673 Bacteria 6404
603 Ga0466963_0025457 3300044694 Bacteria 3774
604 Ga0466964_0017230 3300044706 Bacteria 2765
605 Ga0453684_0000698 3300044712 Bacteria 119496
606 Ga0453684_0001430 3300044712 Bacteria 68343
607 Ga0453684_0013126 3300044712 Bacteria 13516
608 Ga0453684_0095792 3300044712 Bacteria 3647
609 Ga0453684_0263671 3300044712 Bacteria 1972
610 Ga0466959_0027148 3300045049 Bacteria 4247
611 Ga0466959_0093972 3300045049 Bacteria 2152
612 Ga0451576_0009132 3300045051 Bacteria 11525
613 Ga0451576_0017290 3300045051 Bacteria 7935
614 Ga0451576_0144266 3300045051 Bacteria 2483
615 Ga0451576_0147555 3300045051 Bacteria 2453
616 Ga0451576_0191385 3300045051 Bacteria 2137
617 Ga0451576_0263506 3300045051 Bacteria 1802
618 Ga0466958_0040601 3300045836 Bacteria 2797
619 Ga0466967_0021811 3300045976 Bacteria 5212
620 Ga0466967_0032207 3300045976 Bacteria 4423
621 Ga0466967_0328254 3300045976 Bacteria 1477
622 Ga0495629_0013955 3300046459 Bacteria 5792
623 Ga0495580_0000074 3300046472 Bacteria 62279
624 Ga0495580_0000500 3300046472 Bacteria 32899
625 Ga0495580_0001161 3300046472 Bacteria 23149
626 Ga0495580_0001820 3300046472 Bacteria 18758
627 Ga0495580_0003174 3300046472 Bacteria 14086
628 Ga0495580_0004520 3300046472 Bacteria 11681
629 Ga0495580_0006865 3300046472 Bacteria 9207
630 Ga0495580_0012260 3300046472 Bacteria 6584
631 Ga0495580_0068734 3300046472 Bacteria 2476
632 Ga0495580_0078784 3300046472 Bacteria 2298
633 Ga0495580_0123373 3300046472 Bacteria 1798
634 Ga0495580_0123700 3300046472 Bacteria 1795
635 Ga0495582_0002088 3300046473 Bacteria 11175
636 Ga0495582_0002585 3300046473 Bacteria 10070
637 Ga0495664_0026024 3300046477 Bacteria 3407
638 Ga0495630_0093248 3300046517 Bacteria 2276
639 Ga0495665_0000423 3300046531 Bacteria 21589
640 Ga0495665_0049122 3300046531 Bacteria 2237
641 Ga0495658_0005498 3300046683 Bacteria 6229
642 Ga0495581_0067814 3300047315 Bacteria 2063
643 Ga0495674_0129701 3300047319 Bacteria 2125
644 Ga0495675_0007766 3300047444 Bacteria 6619
645 Ga0495675_0151295 3300047444 Bacteria 1434
646 Ga0495602_0067032 3300048088 Bacteria 3090
647 Ga0496101_0226882 3300048904 Bacteria 1451
648 Ga0496102_0000898 3300048905 Bacteria 28227
649 Ga0496102_0024993 3300048905 Bacteria 5314
650 Ga0496103_0021035 3300048906 Bacteria 3924
651 Ga0496104_0042845 3300048907 Bacteria 4250
652 Ga0496104_0167064 3300048907 Bacteria 2110
653 Ga0496106_0071670 3300048909 Bacteria 2649
654 Ga0496107_0013439 3300048910 Bacteria 5722
655 Ga0496108_0002118 3300048911 Bacteria 15901
656 Ga0496109_0000008 3300048912 Bacteria 245809
657 Ga0496110_0008075 3300048913 Bacteria 8450
658 Ga0496111_0005563 3300048914 Bacteria 8097
659 Ga0496112_0000334 3300048915 Bacteria 30562
660 Ga0496112_0007042 3300048915 Bacteria 9935
661 Ga0496112_0009415 3300048915 Bacteria 8800
662 Ga0496112_0025414 3300048915 Bacteria 5687
663 Ga0496112_0026776 3300048915 Bacteria 5555
664 Ga0496112_0049171 3300048915 Bacteria 4133
665 Ga0496112_0102175 3300048915 Bacteria 2836
666 Ga0496112_0114761 3300048915 Bacteria 2664
667 Ga0496112_0150098 3300048915 Bacteria 2298
668 Ga0496113_0006066 3300048916 Bacteria 7617
669 Ga0496113_0020133 3300048916 Bacteria 4684
670 Ga0496115_0030366 3300048918 Bacteria 4251
671 Ga0496115_0069801 3300048918 Bacteria 2847
672 Ga0501032_0001868 3300049569 Bacteria 16653
673 Ga0501033_0003638 3300049570 Bacteria 12567
674 Ga0501034_0232599 3300049571 Bacteria 1791
675 Ga0501036_0014296 3300049572 Bacteria 6605
676 Ga0501038_0000414 3300049574 Bacteria 36995
677 Ga0501043_0019722 3300049579 Bacteria 5295
678 Ga0501047_0035079 3300049581 Bacteria 4844
679 Ga0501071_0056562 3300049587 Bacteria 2834
680 Ga0501076_0215219 3300049592 Bacteria 1571
681 Ga0501201_000934 3300049651 Bacteria 2739
682 Ga0501202_002339 3300049652 Bacteria 3172
683 Ga0501207_000585 3300049654 Bacteria 4184
684 Ga0501208_007505 3300049655 Bacteria 1435
685 Ga0501217_000192 3300049661 Bacteria 9123
686 Ga0501224_000111 3300049664 Bacteria 8776
687 Ga0501235_000156 3300049669 Bacteria 11798
688 Ga0501242_003313 3300049674 Bacteria 1738
689 Ga0501243_002056 3300049675 Bacteria 2921
690 Ga0501221_007459 3300049704 Bacteria 1877
691 Ga0501225_0001675 3300049705 Bacteria 6921
692 Ga0501245_001455 3300049708 Bacteria 3067
693 Ga0501035_0002711 3300049822 Bacteria 17218
694 Ga0501035_0047031 3300049822 Bacteria 3876
695 Ga0501044_0001056 3300049823 Bacteria 33138
696 Ga0501044_0016466 3300049823 Bacteria 7935
697 Ga0501044_0056212 3300049823 Bacteria 4040
698 nmdc:mga00v17_3649_c1 3300050491 Bacteria 7954
699 nmdc:mga05p37_34297_c1 3300050507 Bacteria 6215
700 nmdc:mga06r32_1622_c1 3300050510 Bacteria 20305
701 nmdc:mga06r32_204140_c1 3300050510 Bacteria 1964
702 nmdc:mga0n895_116_c1 3300050512 Bacteria 47089
703 nmdc:mga0n895_268992_c1 3300050512 Bacteria 1729
704 nmdc:mga0n895_30276_c1 3300050512 Bacteria 5171
705 nmdc:mga0n895_5385_c1 3300050512 Bacteria 10680
706 nmdc:mga0rr50_19548_c1 3300050513 Bacteria 4575
707 nmdc:mga0rr50_2581_c1 3300050513 Bacteria 10257
708 nmdc:mga0rr50_51716_c1 3300050513 Bacteria 3050
709 nmdc:mga0rr50_7868_c1 3300050513 Bacteria 6610
710 nmdc:mga08x19_15225_c1 3300050514 Bacteria 4678
711 nmdc:mga08x19_176722_c1 3300050514 Bacteria 1456
712 nmdc:mga08x19_19909_c1 3300050514 Bacteria 4125
713 nmdc:mga08x19_27881_c1 3300050514 Bacteria 3534
714 nmdc:mga08x19_4570_c1 3300050514 Bacteria 8216
715 nmdc:mga0a205_130917_c1 3300050515 Bacteria 2409
716 nmdc:mga0a205_200984_c1 3300050515 Bacteria 1883
717 nmdc:mga0a205_5707_c1 3300050515 Bacteria 11214
718 2739612233 2739367655 Bacteria 4051151
719 2887377927 2887375801 Bacteria 5334027
720 2895516647 2895511927 Bacteria 6802080
721 8048749807 8048746797 Bacteria 3557226
722 Ga0207652_10006097
723 MBSR1b_contig_7733811
724 JGI24034J26672_10000892
725 rootH2_10014965
726 Ga0065712_10004189
727 Ga0065712_10016765
728 Ga0065715_10092986
729 Ga0070658_10083614
730 Ga0070658_10221785
731 Ga0070676_10008787
732 Ga0070683_100001910
733 Ga0070683_100015621
734 Ga0070683_100093302
735 Ga0070683_100133021
736 Ga0070670_100001939
737 Ga0070677_10011803
738 Ga0068869_100005267
739 Ga0068869_100011474
740 Ga0068869_100059867
741 Ga0068869_100061455
742 Ga0070666_10018525
743 Ga0070680_100026207
744 Ga0070682_100016758
745 Ga0068868_100000991
746 Ga0068868_100008904
747 Ga0068868_100019302
748 Ga0068868_100019411
749 Ga0068868_100026260
750 Ga0070660_100242763
751 Ga0070689_100001082
752 Ga0070689_100029955
753 Ga0070661_100010865
754 Ga0070692_10089125
755 Ga0070668_100046647
756 Ga0070668_100084268
757 Ga0070669_100066064
758 Ga0070675_100008528
759 Ga0070675_100021708
760 Ga0070671_100142141
761 Ga0070674_100002948
762 Ga0070674_100010250
763 Ga0070673_100028947
764 Ga0070673_100040856
765 Ga0070688_100000289
766 Ga0070688_100023744
767 Ga0070659_100002441
768 Ga0070659_100012571
769 Ga0070667_100019230
770 Ga0070667_100056955
771 Ga0070667_100064298
772 Ga0070709_10002435
773 Ga0070709_10006252
774 Ga0070709_10102098
775 Ga0070714_100001114
776 Ga0070714_100002389
777 Ga0070714_100011371
778 Ga0070714_100078862
779 Ga0070713_100023352
780 Ga0070713_100027439
781 Ga0070713_100056250
782 Ga0070713_100077822
783 Ga0070710_10022116
784 Ga0070710_10040012
785 Ga0070711_100042150
786 Ga0070711_100079707
787 Ga0070711_100212480
788 Ga0070700_100050944
789 Ga0070694_100000701
790 Ga0070708_100000443
791 Ga0070708_100004243
792 Ga0070708_100013479
793 Ga0070708_100021725
794 Ga0070708_100029327
795 Ga0070708_100186594
796 Ga0070663_100007577
797 Ga0070663_100061519
798 Ga0070662_100004251
799 Ga0070662_100016834
800 Ga0070662_100103594
801 Ga0070681_10000091
802 Ga0070681_10048708
803 Ga0070681_10132477
804 Ga0070681_10142530
805 Ga0068867_100002857
806 Ga0068867_100003152
807 Ga0068867_100035780
808 Ga0068867_100046263
809 Ga0070685_10002319
810 Ga0070685_10034550
811 Ga0070706_100000706
812 Ga0070706_100011053
813 Ga0070707_100043108
814 Ga0070698_100000638
815 Ga0070698_100009020
816 Ga0070698_100032703
817 Ga0070698_100037822
818 Ga0070699_100010924
819 Ga0070699_100015286
820 Ga0070699_100027894
821 Ga0070699_100088395
822 Ga0070699_100208974
823 Ga0070699_100232560
824 Ga0070679_100009934
825 Ga0070679_100011535
826 Ga0070679_100052462
827 Ga0070679_100100390
828 Ga0070679_100157010
829 Ga0070684_100001382
830 Ga0070684_100035220
831 Ga0070684_100065510
832 Ga0070684_100082412
833 Ga0070684_100119125
834 Ga0070684_100255357
835 Ga0070697_100000122
836 Ga0070697_100000190
837 Ga0070697_100001893
838 Ga0070697_100001942
839 Ga0070697_100074908
840 Ga0070697_100117006
841 Ga0068853_100011958
842 Ga0068853_100016719
843 Ga0068853_100026049
844 Ga0068853_100037904
845 Ga0068853_100064676
846 Ga0068853_100071082
847 Ga0068853_100220743
848 Ga0070672_100002640
849 Ga0070686_100010874
850 Ga0070686_100039308
851 Ga0070695_100139645
852 Ga0070696_100003116
853 Ga0070696_100116489
854 Ga0070665_100090717
855 Ga0068855_100001870
856 Ga0068855_100002676
857 Ga0068855_100005074
858 Ga0068855_100014684
859 Ga0068855_100036015
860 Ga0068855_100073434
861 Ga0070664_100000782
862 Ga0070664_100049327
863 Ga0070664_100290224
864 Ga0068857_100002750
865 Ga0068857_100013858
866 Ga0068857_100029847
867 Ga0068857_100043851
868 Ga0068857_100101724
869 Ga0068854_100008839
870 Ga0068854_100020111
871 Ga0068856_100000107
872 Ga0068856_100000900
873 Ga0068856_100003544
874 Ga0068856_100018743
875 Ga0068856_100026009
876 Ga0068856_100042739
877 Ga0068856_100049453
878 Ga0070702_100002886
879 Ga0070702_100007315
880 Ga0068852_100001821
881 Ga0068852_100004228
882 Ga0068852_100009113
883 Ga0068852_100032494
884 Ga0068852_100201084
885 Ga0068859_100000573
886 Ga0068859_100015326
887 Ga0068859_100037738
888 Ga0068859_100098794
889 Ga0068859_100252159
890 Ga0068864_100003555
891 Ga0068864_100003567
892 Ga0068864_100025817
893 Ga0068864_100170364
894 Ga0068866_10003201
895 Ga0068861_100002752
896 Ga0068861_100017888
897 Ga0068851_10002205
898 Ga0068851_10064732
899 Ga0068863_100014276
900 Ga0068863_100031732
901 Ga0068863_100036081
902 Ga0068863_100037763
903 Ga0068863_100053669
904 Ga0068863_100061157
905 Ga0068863_100068329
906 Ga0068858_100000430
907 Ga0068858_100000597
908 Ga0068858_100022034
909 Ga0068858_100047702
910 Ga0068858_100103475
911 Ga0068858_100165397
912 Ga0068860_100081440
913 Ga0068862_100013951
914 Ga0068862_100033898
915 Ga0070717_10006164
916 Ga0070717_10008636
917 Ga0070717_10015653
918 Ga0070717_10024547
919 Ga0070717_10044754
920 Ga0070717_10127596
921 Ga0070717_10200794
922 Ga0075364_10000724
923 Ga0070716_100000002
924 Ga0070716_100000080
925 Ga0070716_100015203
926 Ga0070712_100000087
927 Ga0070712_100000422
928 Ga0070712_100010552
929 Ga0070712_100010789
930 Ga0070712_100011697
931 Ga0070712_100074001
932 Ga0097621_100000223
933 Ga0097621_100000442
934 Ga0097621_100009274
935 Ga0097621_100013894
936 Ga0097621_100031884
937 Ga0097621_100111429
938 Ga0068871_100000231
939 Ga0068871_100035521
940 Ga0068871_100047477
941 Ga0068871_100053436
942 Ga0075430_100045650
943 Ga0075431_100072730
944 Ga0075434_100000037
945 Ga0075434_100017528
946 Ga0075434_100108192
947 Ga0068865_100017191
948 Ga0068865_100056963
949 Ga0075436_100000180
950 Ga0075436_100002076
951 Ga0075436_100039846
952 Ga0075436_100051773
953 Ga0075436_100057614
954 Ga0075436_100171485
955 Ga0097620_100000573
956 Ga0097620_100015326
957 Ga0097620_100037736
958 Ga0097620_100098803
959 Ga0097620_100252151
960 Ga0075435_100014691
961 Ga0075435_100020756
962 Ga0075435_100025070
963 Ga0099794_10055634
964 Ga0105240_10012427
965 Ga0105240_10014933
966 Ga0105240_10019314
967 Ga0105240_10053942
968 Ga0105240_10063496
969 Ga0105240_10078495
970 Ga0105245_10148304
971 Ga0105247_10001769
972 Ga0114129_10152262
973 Ga0105241_10006319
974 Ga0105241_10008758
975 Ga0105241_10040439
976 Ga0105242_10257131
977 Ga0105248_10003198
978 Ga0105248_10028470
979 Ga0105248_10104015
980 Ga0105237_10011633
981 Ga0105237_10018617
982 Ga0105237_10018696
983 Ga0105237_10151773
984 Ga0105237_10179622
985 Ga0105238_10000090
986 Ga0105238_10010307
987 Ga0105238_10130746
988 Ga0105238_10143360
989 Ga0105249_10090905
990 Ga0105239_10011260
991 Ga0105239_10054790
992 Ga0105246_10002416
993 Ga0157373_10006047
994 Ga0157373_10007569
995 Ga0157373_10014686
996 Ga0157373_10027469
997 Ga0157371_10006502
998 Ga0157371_10015018
999 Ga0157371_10081473
1000 Ga0157371_10102390
1001 Ga0157370_10019465
1002 Ga0157370_10053233
1003 Ga0157370_10073611
1004 Ga0157369_10000102
1005 Ga0157369_10016955
1006 Ga0157369_10061675
1007 Ga0157369_10109516
1008 Ga0157369_10114311
1009 Ga0157374_10000097
1010 Ga0157374_10000567
1011 Ga0157374_10006274
1012 Ga0157374_10009761
1013 Ga0157374_10014895
1014 Ga0157374_10016300
1015 Ga0157374_10028450
1016 Ga0157374_10030974
1017 Ga0157374_10058996
1018 Ga0157378_10000104
1019 Ga0157378_10000151
1020 Ga0157378_10054277
1021 Ga0157378_10171837
1022 Ga0163162_10008499
1023 Ga0163162_10014501
1024 Ga0163162_10108280
1025 Ga0163162_10145922
1026 Ga0157372_10000242
1027 Ga0157372_10001297
1028 Ga0157372_10001548
1029 Ga0157372_10004725
1030 Ga0157372_10005138
1031 Ga0157372_10020482
1032 Ga0157372_10027137
1033 Ga0157372_10032088
1034 Ga0157372_10042625
1035 Ga0157372_10090403
1036 Ga0157372_10098252
1037 Ga0157372_10120358
1038 Ga0157372_10205722
1039 Ga0157375_10003505
1040 Ga0157375_10026260
1041 Ga0163163_10000958
1042 Ga0163163_10007378
1043 Ga0163163_10040057
1044 Ga0157380_10025245
1045 Ga0182008_10010903
1046 Ga0157377_10000467
1047 Ga0157379_10000392
1048 Ga0157379_10027588
1049 Ga0157379_10219868
1050 Ga0157376_10039099
1051 Ga0157376_10040864
1052 Ga0157376_10153511
1053 Ga0182007_10000569
1054 Ga0182007_10010052
1055 Ga0163161_10003590
1056 Ga0163161_10108815
1057 Ga0224572_1004467
1058 Ga0228598_1000094
1059 Ga0207697_10017314
1060 Ga0207656_10005884
1061 Ga0207692_10012061
1062 Ga0207692_10052806
1063 Ga0207642_10019875
1064 Ga0207710_10007130
1065 Ga0207710_10010695
1066 Ga0207688_10000372
1067 Ga0207680_10037890
1068 Ga0207680_10132419
1069 Ga0207647_10001560
1070 Ga0207647_10010323
1071 Ga0207647_10022428
1072 Ga0207685_10044913
1073 Ga0207699_10005753
1074 Ga0207699_10034947
1075 Ga0207699_10085396
1076 Ga0207645_10000051
1077 Ga0207643_10000079
1078 Ga0207643_10020192
1079 Ga0207684_10003254
1080 Ga0207684_10007388
1081 Ga0207684_10066380
1082 Ga0207707_10037045
1083 Ga0207707_10039490
1084 Ga0207707_10135047
1085 Ga0207695_10000087
1086 Ga0207695_10004625
1087 Ga0207695_10016312
1088 Ga0207695_10039989
1089 Ga0207695_10145302
1090 Ga0207671_10031668
1091 Ga0207671_10150486
1092 Ga0207693_10000090
1093 Ga0207693_10000509
1094 Ga0207693_10000781
1095 Ga0207693_10001949
1096 Ga0207693_10005269
1097 Ga0207693_10028595
1098 Ga0207693_10032372
1099 Ga0207693_10056486
1100 Ga0207663_10001683
1101 Ga0207663_10005815
1102 Ga0207663_10013934
1103 Ga0207663_10024702
1104 Ga0207663_10078245
1105 Ga0207663_10110069
1106 Ga0207660_10019649
1107 Ga0207657_10000292
1108 Ga0207657_10001771
1109 Ga0207657_10014219
1110 Ga0207657_10153902
1111 Ga0207649_10000242
1112 Ga0207649_10022414
1113 Ga0207649_10058333
1114 Ga0207649_10086021
1115 Ga0207652_10007041
1116 Ga0207652_10096469
1117 Ga0207652_10140970
1118 Ga0207652_10310238
1119 Ga0207646_10008591
1120 Ga0207646_10025219
1121 Ga0207646_10028176
1122 Ga0207646_10041906
1123 Ga0207681_10084096
1124 Ga0207694_10041764
1125 Ga0207694_10043876
1126 Ga0207694_10072718
1127 Ga0207694_10096143
1128 Ga0207650_10000090
1129 Ga0207650_10005814
1130 Ga0207659_10002035
1131 Ga0207659_10016513
1132 Ga0207687_10050001
1133 Ga0207687_10056506
1134 Ga0207700_10022946
1135 Ga0207700_10027101
1136 Ga0207700_10034937
1137 Ga0207700_10164027
1138 Ga0207700_10172632
1139 Ga0207700_10179703
1140 Ga0207664_10006502
1141 Ga0207664_10017107
1142 Ga0207664_10031030
1143 Ga0207664_10035137
1144 Ga0207664_10052405
1145 Ga0207664_10063833
1146 Ga0207644_10002582
1147 Ga0207690_10034289
1148 Ga0207690_10045769
1149 Ga0207706_10001055
1150 Ga0207706_10075648
1151 Ga0207706_10147820
1152 Ga0207686_10019244
1153 Ga0207709_10024778
1154 Ga0207670_10001693
1155 Ga0207669_10007412
1156 Ga0207669_10103315
1157 Ga0207704_10014559
1158 Ga0207704_10027568
1159 Ga0207704_10171381
1160 Ga0207665_10000004
1161 Ga0207665_10000098
1162 Ga0207665_10007075
1163 Ga0207665_10022811
1164 Ga0207665_10028713
1165 Ga0207665_10038484
1166 Ga0207691_10001343
1167 Ga0207711_10001668
1168 Ga0207711_10002838
1169 Ga0207711_10065530
1170 Ga0207689_10000304
1171 Ga0207689_10001724
1172 Ga0207689_10008930
1173 Ga0207661_10025148
1174 Ga0207661_10039057
1175 Ga0207661_10044684
1176 Ga0207661_10090261
1177 Ga0207679_10000184
1178 Ga0207679_10036272
1179 Ga0207667_10000279
1180 Ga0207667_10001744
1181 Ga0207667_10020321
1182 Ga0207667_10037265
1183 Ga0207667_10042232
1184 Ga0207667_10046887
1185 Ga0207667_10049662
1186 Ga0207651_10000675
1187 Ga0207712_10148875
1188 Ga0207640_10012858
1189 Ga0207640_10014592
1190 Ga0207640_10015694
1191 Ga0207640_10056959
1192 Ga0207658_10025494
1193 Ga0207658_10035885
1194 Ga0207658_10142539
1195 Ga0207677_10001706
1196 Ga0207677_10002752
1197 Ga0207677_10015616
1198 Ga0207703_10005260
1199 Ga0207703_10007408
1200 Ga0207703_10012716
1201 Ga0207703_10013614
1202 Ga0207639_10002894
1203 Ga0207639_10074658
1204 Ga0207639_10240017
1205 Ga0207678_10000204
1206 Ga0207678_10002279
1207 Ga0207708_10169638
1208 Ga0207702_10000704
1209 Ga0207702_10000722
1210 Ga0207702_10005927
1211 Ga0207702_10007030
1212 Ga0207702_10012343
1213 Ga0207702_10123660
1214 Ga0207641_10000894
1215 Ga0207641_10013975
1216 Ga0207641_10014075
1217 Ga0207641_10060511
1218 Ga0207641_10080208
1219 Ga0207641_10091556
1220 Ga0207648_10000757
1221 Ga0207648_10000939
1222 Ga0207648_10011406
1223 Ga0207648_10035449
1224 Ga0207648_10056588
1225 Ga0207676_10000113
1226 Ga0207676_10004935
1227 Ga0207676_10013970
1228 Ga0207674_10000076
1229 Ga0207674_10008255
1230 Ga0207674_10034615
1231 Ga0207674_10140972
1232 Ga0207674_10203346
1233 Ga0207675_100008819
1234 Ga0207675_100034470
1235 Ga0207683_10001129
1236 Ga0207683_10017222
1237 Ga0207683_10108249
1238 Ga0207698_10033252
1239 Ga0207698_10086056
1240 Ga0207698_10134361
1241 Ga0207698_10187937
1242 Ga0207698_10245226
1243 Ga0207698_10263457
1244 Ga0207428_10024628
1245 Ga0265356_1000911
1246 Ga0268266_10005373
1247 Ga0268266_10236342
1248 Ga0268265_10071554
1249 Ga0268265_10147437
1250 Ga0268264_10023806
1251 Ga0265323_10000160
1252 Ga0265338_10001801
1253 Ga0265338_10004457
1254 Ga0265338_10005643
1255 Ga0265762_1000687
1256 Ga0265762_1003342
1257 Ga0265760_10000165
1258 Ga0265760_10000453
1259 Ga0265760_10001485
1260 Ga0265330_10017181
1261 Ga0265330_10043716
1262 Ga0265328_10018493
1263 Ga0265340_10036904
1264 Ga0265340_10094671
1265 Ga0265339_10017474
1266 Ga0265339_10019916
1267 Ga0265339_10020131
1268 Ga0265339_10032384
1269 Ga0265339_10036425
1270 Ga0265316_10002924
1271 Ga0265316_10015408
1272 Ga0265316_10020126
1273 Ga0265316_10037564
1274 Ga0265316_10069449
1275 Ga0307408_100124673
1276 Ga0265313_10001659
1277 Ga0265313_10050571
1278 Ga0265314_10010248
1279 Ga0265342_10005264
1280 Ga0265342_10098382
1281 Ga0316577_10027785
1282 Ga0307414_10062666
1283 Ga0373926_0004752
1284 Ga0373926_0033842
1285 Ga0373923_0010431
1286 Ga0373936_0005762
1287 Ga0373936_0020056
1288 Ga0373936_0033894
1289 Ga0373945_0030007
1290 Ga0373953_0011230
1291 Ga0373956_0054511
1292 Ga0373943_0054261
1293 Ga0373943_0094341
1294 Ga0373946_0016468
1295 Ga0373946_0086271
1296 Ga0373955_0061180
1297 Ga0373935_0002986
1298 Ga0373935_0160899
1299 Ga0373927_0003084
1300 Ga0373927_0062591
1301 Ga0373947_0001410
1302 Ga0373947_0015195
1303 Ga0373947_0033965
1304 Ga0373947_0112227
1305 Ga0373937_0012137
1306 Ga0373937_0165739
1307 Ga0316582_0111802
1308 Ga0373925_0001030
1309 Ga0373925_0060442
1310 Ga0373925_0106880
1311 Ga0395900_0275049
1312 Ga0395905_0017369
1313 Ga0395905_0024815
1314 Ga0436360_0937468
1315 Ga0436363_0917216
1316 Ga0436362_0596532
1317 Ga0439433_0012151
1318 Ga0451577_0000614
1319 Ga0451577_0001499
1320 Ga0451577_0014025
1321 Ga0453683_0001723
1322 Ga0453683_0008052
1323 Ga0453683_0009742
1324 Ga0466963_0025457
1325 Ga0466964_0017230
1326 Ga0453684_0000698
1327 Ga0453684_0001430
1328 Ga0453684_0013126
1329 Ga0453684_0095792
1330 Ga0453684_0263671
1331 Ga0466959_0027148
1332 Ga0466959_0093972
1333 Ga0451576_0009132
1334 Ga0451576_0017290
1335 Ga0451576_0144266
1336 Ga0451576_0147555
1337 Ga0451576_0191385
1338 Ga0451576_0263506
1339 Ga0466958_0040601
1340 Ga0466967_0021811
1341 Ga0466967_0032207
1342 Ga0466967_0328254
1343 Ga0495629_0013955
1344 Ga0495580_0000074
1345 Ga0495580_0000500
1346 Ga0495580_0001161
1347 Ga0495580_0001820
1348 Ga0495580_0003174
1349 Ga0495580_0004520
1350 Ga0495580_0006865
1351 Ga0495580_0012260
1352 Ga0495580_0068734
1353 Ga0495580_0078784
1354 Ga0495580_0123373
1355 Ga0495580_0123700
1356 Ga0495582_0002088
1357 Ga0495582_0002585
1358 Ga0495664_0026024
1359 Ga0495630_0093248
1360 Ga0495665_0000423
1361 Ga0495665_0049122
1362 Ga0495658_0005498
1363 Ga0495581_0067814
1364 Ga0495674_0129701
1365 Ga0495675_0007766
1366 Ga0495675_0151295
1367 Ga0495602_0067032
1368 Ga0496101_0226882
1369 Ga0496102_0000898
1370 Ga0496102_0024993
1371 Ga0496103_0021035
1372 Ga0496104_0042845
1373 Ga0496104_0167064
1374 Ga0496106_0071670
1375 Ga0496107_0013439
1376 Ga0496108_0002118
1377 Ga0496109_0000008
1378 Ga0496110_0008075
1379 Ga0496111_0005563
1380 Ga0496112_0000334
1381 Ga0496112_0007042
1382 Ga0496112_0009415
1383 Ga0496112_0025414
1384 Ga0496112_0026776
1385 Ga0496112_0049171
1386 Ga0496112_0102175
1387 Ga0496112_0114761
1388 Ga0496112_0150098
1389 Ga0496113_0006066
1390 Ga0496113_0020133
1391 Ga0496115_0030366
1392 Ga0496115_0069801
1393 Ga0501032_0001868
1394 Ga0501033_0003638
1395 Ga0501034_0232599
1396 Ga0501036_0014296
1397 Ga0501038_0000414
1398 Ga0501043_0019722
1399 Ga0501047_0035079
1400 Ga0501071_0056562
1401 Ga0501076_0215219
1402 Ga0501201_000934
1403 Ga0501202_002339
1404 Ga0501207_000585
1405 Ga0501208_007505
1406 Ga0501217_000192
1407 Ga0501224_000111
1408 Ga0501235_000156
1409 Ga0501242_003313
1410 Ga0501243_002056
1411 Ga0501221_007459
1412 Ga0501225_0001675
1413 Ga0501245_001455
1414 Ga0501035_0002711
1415 Ga0501035_0047031
1416 Ga0501044_0001056
1417 Ga0501044_0016466
1418 Ga0501044_0056212
1419 nmdc:mga00v17_3649_c1
1420 nmdc:mga05p37_34297_c1
1421 nmdc:mga06r32_1622_c1
1422 nmdc:mga06r32_204140_c1
1423 nmdc:mga0n895_116_c1
1424 nmdc:mga0n895_268992_c1
1425 nmdc:mga0n895_30276_c1
1426 nmdc:mga0n895_5385_c1
1427 nmdc:mga0rr50_19548_c1
1428 nmdc:mga0rr50_2581_c1
1429 nmdc:mga0rr50_51716_c1
1430 nmdc:mga0rr50_7868_c1
1431 nmdc:mga08x19_15225_c1
1432 nmdc:mga08x19_176722_c1
1433 nmdc:mga08x19_19909_c1
1434 nmdc:mga08x19_27881_c1
1435 nmdc:mga08x19_4570_c1
1436 nmdc:mga0a205_130917_c1
1437 nmdc:mga0a205_200984_c1
1438 nmdc:mga0a205_5707_c1
1439 2739612233
1440 2887377927
1441 2895516647
1442 8048749807

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03952

Enolase_N

Enolase, N-terminal domain

4

134

0.99

PF00113

Enolase_C

Enolase, C-terminal TIM barrel domain

139

428

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1iyx-assembly1.cif.gz_B crystal structure of enolase from enterococcus hirae 0.9875 3 426
4z1y-assembly1.cif.gz_A thermostable enolase from chloroflexus aurantiacus with substrate 2-phosphoglycerate 0.9872 4 425
5bof-assembly1.cif.gz_A crystal structure of staphylococcus aureus enolase 0.9858 1 426
4z17-assembly1.cif.gz_A thermostable enolase from chloroflexus aurantiacus 0.9855 2 423
4mks-assembly1.cif.gz_B crystal structure of enolase from lactobacillus gasseri 0.9852 4 426
ID Description Score Start End Superfamily
1w6tB01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.99 4 126 3.30.390.10
4z1yB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9761 128 423 3.20.20.120
1e9iD01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9733 4 134 3.30.390.10
1w6tB01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.966 4 126 3.30.390.10
4z1yB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.963 128 423 3.20.20.120
ID Description Score Start End GO Terms
AF-A0A645BCU2-F1-model_v4 phosphopyruvate hydratase (EC 4.2.1.11) 0.9974 312 425 GO:0000015
GO:0000287
GO:0004634
GO:0006096
AF-A0A435GK64-F1-model_v4 Enolase (EC 4.2.1.11) 0.9972 261 402 GO:0000015
GO:0000287
GO:0004634
GO:0005576
GO:0006096
AF-A0A7W0F465-F1-model_v4 Enolase (EC 4.2.1.11) 0.9969 301 412 GO:0000015
GO:0000287
GO:0004634
GO:0005576
GO:0006096
AF-A0A7X1KAC9-F1-model_v4 deleted 0.9968 313 414
AF-A0A3C1LGY7-F1-model_v4 Enolase (EC 4.2.1.11) 0.9966 81 418 GO:0000015
GO:0000287
GO:0004634
GO:0005576
GO:0006096

Map