F477333

General Info

Members Datasets Scaffolds Average Seq Length
720 490 395 415

Family's Representative Sequence

Representative Sequence 3300048928|Ga0496125_0000628|Ga0496125_0000628_23598_24863
Length 393
Sequence MTARPDPGSIELMETEEGSVPPPVAHRPKSGLARFLLGLSLMLIAFNLRPLFSSASALLPEIRAVLGLSATGASLLTTLPVVCLGLFSPLAPRLAQRIGTERTLLGVVVLLACIAVGNVLLPGLVKRDFPDKAALMTGLYTMTMCAGAAGAAGLTLPIEHALGGSLAAALAVWALPALVVSLLWLPQVVMSRGQARRAAVRVEGLWRDRLAWHVTLFMGLQSALAYCVFGWLVPILRERGLDGVTAGAVVSVSVMVQAVACLVAPHLAVRGRDQRLINVALCVVAGLLFAPLWSVWFWAALQGIGQGGLIAVALTVIVLRSPEPIVAAHLSGMAQCVGYLLAAIGPLVVGLIRGWTGSFAWSAALFVLLGLGAAVNGWFAGRALYVKARVVEA

Samples

Sample ID Description Type Environment
1 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
2 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
3 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
4 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
5 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
6 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
7 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
8 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
9 2512875024 Mesorhizobium loti R88b Isolate Nodule
10 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
11 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
12 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
13 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
14 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
15 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
16 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
17 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
18 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
19 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
20 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
21 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
22 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
23 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
24 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
25 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
26 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
27 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
28 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
29 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
30 2534681786 Brucella suis 92/29 Isolate Unclassified
31 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
32 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
33 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
34 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
35 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
36 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
37 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
38 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
39 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
40 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
41 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
42 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
43 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
44 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
45 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
46 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
47 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
48 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
49 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
50 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
51 2643221557 Ensifer sp. Root558 Isolate Unclassified
52 2643221599 Rhizobium sp. Root708 Isolate Unclassified
53 2643221610 Ensifer sp. Root74 Isolate Unclassified
54 2643221618 Ensifer sp. Root231 Isolate Unclassified
55 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
56 2643221626 Ensifer sp. Root31 Isolate Unclassified
57 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
58 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
59 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
60 2643221655 Ensifer sp. Root1252 Isolate Unclassified
61 2643221659 Ensifer sp. Root127 Isolate Unclassified
62 2643221668 Ensifer sp. Root423 Isolate Unclassified
63 2643221675 Ensifer sp. Root1298 Isolate Unclassified
64 2643221680 Ensifer sp. Root1312 Isolate Unclassified
65 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
66 2643221698 Ensifer sp. Root142 Isolate Unclassified
67 2643221712 Ensifer sp. Root258 Isolate Unclassified
68 2643221718 Rhizobium sp. Root268 Isolate Unclassified
69 2643221723 Ensifer sp. Root278 Isolate Unclassified
70 2643221726 Ensifer sp. Root954 Isolate Unclassified
71 2718217882 Rhizobium sp. N741 Isolate Nodule
72 2718217927 Rhizobium sp. N324 Isolate Nodule
73 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
74 2718218009 Rhizobium sp. N561 Isolate Nodule
75 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
76 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
77 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
78 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
79 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
80 2718218363 Rhizobium sp. N113 Isolate Nodule
81 2718218365 Rhizobium sp. N731 Isolate Nodule
82 2718218366 Rhizobium sp. N621 Isolate Nodule
83 2718218423 Rhizobium sp. N941 Isolate Nodule
84 2721755514 Rhizobium sp. N6212 Isolate Nodule
85 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
86 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
87 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
88 2721755809 Rhizobium sp. N541 Isolate Nodule
89 2721755810 Rhizobium sp. N871 Isolate Nodule
90 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
91 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
92 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
93 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
94 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
95 2728369365 Rhizobium sp. N1341 Isolate Nodule
96 2728369397 Rhizobium sp. N1314 Isolate Nodule
97 2738541293 Rhizobium sp. GV031 Isolate Unclassified
98 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
99 2738543024 Aminobacter sp. AP02 Isolate Unclassified
100 2751185800 Brucella pituitosa AA2 Isolate Unclassified
101 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
102 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
103 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
104 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
105 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
106 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
107 2791355256 Rhizobium sp. M10 Isolate Nodule
108 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
109 2791355260 Rhizobium sp. L9 Isolate Nodule
110 2791355261 Rhizobium sp. J15 Isolate Nodule
111 2791355262 Rhizobium sp. M1 Isolate Nodule
112 2791355263 Rhizobium chutanense C5 Isolate Nodule
113 2791355264 Rhizobium sp. S9 Isolate Nodule
114 2791355265 Rhizobium sp. H4 Isolate Nodule
115 2791355266 Rhizobium sp. L43 Isolate Nodule
116 2791355267 Rhizobium sp. L18 Isolate Nodule
117 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
118 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
119 2802429633 Rhizobium anhuiense J3 Isolate Nodule
120 2802429634 Rhizobium anhuiense S10 Isolate Nodule
121 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
122 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
123 2802429637 Rhizobium anhuiense C15 Isolate Nodule
124 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
125 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
126 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
127 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
128 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
129 2838048938 Rhizobium pisi 27/80 Isolate Nodule
130 2838061910 Rhizobium phaseoli L15 Isolate Nodule
131 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
132 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
133 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
134 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
135 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
136 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
137 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
138 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
139 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
140 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
141 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
142 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
143 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
144 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
145 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
146 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
147 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
148 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
149 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
150 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
151 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
152 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
153 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
154 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
155 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
156 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
157 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
158 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
159 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
160 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
161 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
162 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
163 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
164 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
165 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
166 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
167 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
168 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
169 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
170 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
171 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
172 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
173 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
174 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
175 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
176 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
177 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
178 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
179 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
180 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
181 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
182 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
183 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
184 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
185 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
186 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
187 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
188 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
189 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
190 2844163670 Ensifer sp. 1H6 Isolate Unclassified
191 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
192 2854911287 Brucella lupini LUP21 Isolate Unclassified
193 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
194 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
195 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
196 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
197 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
198 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
199 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
200 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
201 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
202 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
203 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
204 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
205 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
206 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
207 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
208 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
209 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
210 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
211 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
212 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
213 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
214 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
215 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
216 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
217 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
218 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
219 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
220 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
221 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
222 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
223 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
224 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
225 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
226 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
227 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
228 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
229 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
230 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
231 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
232 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
233 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
234 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
235 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
236 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
237 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
238 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
239 2933599457 Rhizobium phaseoli M3 Isolate Nodule
240 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
241 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
242 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
243 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
244 2936381700 Rhizobium chutanense C16 Isolate Unclassified
245 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
246 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
247 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
248 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
249 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
250 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
251 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
252 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
253 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
254 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
255 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
256 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
257 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
258 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
259 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
260 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
261 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
262 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
263 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
264 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
265 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
266 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
267 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
268 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
269 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
270 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
271 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
272 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
273 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
274 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
275 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
276 2996887358 Rhizobium sp. R711 Isolate Nodule
277 2996893221 Rhizobium sp. R635 Isolate Nodule
278 3004167301 Mesorhizobium loti 582 Isolate Unclassified
279 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
280 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
281 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
282 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
283 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
284 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
285 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
286 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
287 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
288 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
289 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
290 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
291 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
292 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
293 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
294 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
295 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
296 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
297 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
298 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
299 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
300 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
301 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
302 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
303 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
304 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
305 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
306 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
307 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
308 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
309 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
310 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
311 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
312 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
313 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
314 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
315 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
316 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
317 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
318 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
319 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
320 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
321 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
322 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
323 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
324 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
325 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
326 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
327 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
328 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
329 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
330 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
331 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
332 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
333 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
334 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
335 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
336 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
337 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
338 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
339 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
340 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
341 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
342 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
343 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
344 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
345 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
353 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
354 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
355 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
356 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
357 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
358 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
359 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
360 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
361 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
362 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
363 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
364 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
365 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
366 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
367 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
368 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
369 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
370 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
371 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
372 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
373 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
374 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
375 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
376 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
377 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
378 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
379 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
380 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
381 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
382 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
383 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
384 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
385 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
386 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
387 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
388 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
389 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
390 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
391 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
392 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
393 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
394 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
395 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
396 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
397 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
398 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
399 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
400 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
401 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
402 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
403 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
404 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
405 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
406 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
407 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
408 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
409 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
410 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
411 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
412 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
413 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
414 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
415 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
416 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
417 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
418 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
419 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
420 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
421 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
422 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
423 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
424 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
425 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
426 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
427 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
428 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
434 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
435 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
436 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
437 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
438 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
439 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
440 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
441 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
442 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
443 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
444 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
445 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
446 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
447 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
448 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
449 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
450 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
451 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
452 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
453 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
454 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
455 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
456 8005258706 Rhizobium sp. R693 Isolate Nodule
457 8005275841 Rhizobium sp. N4311 Isolate Nodule
458 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
459 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
460 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
461 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
462 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
463 8005321885 Rhizobium sp. R72 Isolate Nodule
464 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
465 8005382845 Rhizobium sp. R634 Isolate Nodule
466 8005395548 Rhizobium sp. R339 Isolate Nodule
467 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
468 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
469 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
470 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
471 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
472 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
473 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
474 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
475 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
476 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
477 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
478 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
479 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
480 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
481 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
482 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
483 8018176218 Rhizobium sp. N122 Isolate Nodule
484 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
485 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
486 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
487 8024501048 Rhizobium sp. H4 Isolate Nodule
488 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
489 8056382006 Rhizobium croatiense 13T Isolate Nodule
490 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 54.86
Metatranscriptomes 0
Isolates 45.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.31
Nodule 33.61
Rhizoplane 1.39
Rhizosphere 28.19
Stem 0
Stem Tuber 0
Unclassified 17.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1001756 3300002705 Bacteria 8650
2 JGI25162J39368_1000745 3300002737 Bacteria 22268
3 JGI25158J39367_1000011 3300002739 Bacteria 50391
4 JGI25157J39369_1000751 3300002741 Bacteria 17047
5 JGI25152J39213_1000599 3300002773 Bacteria 19380
6 JGI25152J39213_1001826 3300002773 Bacteria 8591
7 JGI25152J39213_1003276 3300002773 Bacteria 5600
8 JGI25152J39213_1011084 3300002773 Bacteria 2015
9 JGI25150J39212_1000133 3300002774 Bacteria 41648
10 JGI25159J45721_1000055 3300002987 Bacteria 56500
11 JGI25151J46595_10000407 3300003187 Bacteria 44348
12 JGI25151J46595_10002037 3300003187 Bacteria 12631
13 JGI25151J46595_10004080 3300003187 Bacteria 7829
14 JGI25151J46595_10009343 3300003187 Bacteria 4650
15 JGI25151J46595_10009345 3300003187 Bacteria 4650
16 JGI25151J46595_10033446 3300003187 Bacteria 1981
17 JGI25165J46597_1000062 3300003214 Bacteria 206459
18 JGI25165J46597_1000565 3300003214 Bacteria 33508
19 JGI25153J46596_10001632 3300003215 Bacteria 13301
20 JGI25153J46596_10005199 3300003215 Bacteria 6850
21 JGI25153J46596_10007022 3300003215 Bacteria 5608
22 JGI25153J46596_10013563 3300003215 Bacteria 3436
23 JGI25153J46596_10014457 3300003215 Bacteria 3279
24 JGI25160J50197_1000073 3300003354 Bacteria 104247
25 JGI25160J50197_1006341 3300003354 Bacteria 4803
26 JGI25160J50197_1006753 3300003354 Bacteria 4600
27 JGI25160J50197_1013477 3300003354 Bacteria 2785
28 JGI25161J50226_1000552 3300003374 Bacteria 15953
29 JGI25161J50226_1004331 3300003374 Bacteria 2997
30 Ga0055526_1002109 3300003771 Bacteria 13649
31 Ga0055526_1011147 3300003771 Bacteria 4090
32 Ga0055524_1000018 3300003775 Bacteria 234806
33 Ga0055524_1001554 3300003775 Bacteria 12930
34 Ga0055524_1002176 3300003775 Bacteria 10308
35 Ga0055524_1002855 3300003775 Bacteria 8663
36 Ga0055524_1022697 3300003775 Bacteria 2042
37 Ga0055524_1028612 3300003775 Bacteria 1666
38 Ga0055536_1001975 3300003781 Bacteria 11757
39 Ga0055528_1000564 3300003790 Bacteria 28157
40 Ga0055528_1000621 3300003790 Bacteria 26381
41 Ga0055528_1001023 3300003790 Bacteria 18517
42 Ga0055528_1002560 3300003790 Bacteria 9638
43 Ga0055540_1000181 3300003792 Bacteria 61906
44 Ga0055531_10001659 3300003794 Bacteria 16069
45 Ga0055543_1000073 3300004625 Bacteria 88583
46 Ga0055543_1000143 3300004625 Bacteria 59615
47 Ga0055543_1000359 3300004625 Bacteria 30667
48 Ga0065165_1000198 3300005262 Bacteria 104285
49 Ga0065165_1007245 3300005262 Bacteria 5517
50 Ga0065165_1035714 3300005262 Bacteria 1523
51 Ga0070670_100016926 3300005331 Bacteria 6258
52 Ga0070668_100077153 3300005347 Bacteria 2604
53 Ga0070663_100051366 3300005455 Bacteria 2936
54 Ga0068852_100035157 3300005616 Bacteria 4176
55 Ga0081455_10092265 3300005937 Bacteria 2450
56 Ga0075365_10000703 3300006038 Bacteria 13456
57 Ga0075363_100009792 3300006048 Bacteria 4516
58 Ga0075367_10009921 3300006178 Bacteria 4990
59 Ga0075367_10013663 3300006178 Bacteria 4373
60 Ga0075366_10026990 3300006195 Bacteria 3367
61 Ga0105251_10003772 3300009011 Bacteria 10831
62 Ga0105240_10000240 3300009093 Bacteria 109195
63 Ga0105240_10038269 3300009093 Bacteria 6154
64 Ga0105248_10133570 3300009177 Bacteria 2800
65 Ga0105237_10001540 3300009545 Bacteria 30112
66 Ga0105237_10004482 3300009545 Bacteria 16141
67 Ga0105238_10003702 3300009551 Bacteria 15217
68 Ga0123341_1000036 3300009765 Bacteria 61619
69 Ga0123342_1010346 3300009766 Bacteria 10744
70 Ga0123342_1027441 3300009766 Bacteria 3184
71 Ga0105239_10004313 3300010375 Bacteria 17054
72 Ga0105239_10006341 3300010375 Bacteria 13752
73 Ga0171463_1002 3300013249 Bacteria 1274851
74 Ga0182008_10092742 3300014497 Bacteria 1490
75 Ga0183363_1016 3300015690 Bacteria 67144
76 Ga0209436_100113 3300025208 Bacteria 39873
77 Ga0209437_100042 3300025233 Bacteria 444095
78 Ga0207425_1001952 3300025245 Bacteria 7748
79 Ga0207425_1004033 3300025245 Bacteria 4505
80 Ga0207425_1011354 3300025245 Bacteria 2130
81 Ga0209026_1000024 3300025250 Bacteria 355839
82 Ga0209677_100261 3300025253 Bacteria 35631
83 Ga0209759_1000057 3300025256 Bacteria 205181
84 Ga0209129_1000066 3300025258 Bacteria 226820
85 Ga0209129_1000308 3300025258 Bacteria 44371
86 Ga0209129_1001184 3300025258 Bacteria 15017
87 Ga0209129_1001258 3300025258 Bacteria 14534
88 Ga0209129_1001686 3300025258 Bacteria 11960
89 Ga0209129_1002211 3300025258 Bacteria 9762
90 Ga0209233_1000054 3300025261 Bacteria 439669
91 Ga0209233_1000129 3300025261 Bacteria 206511
92 Ga0209233_1000203 3300025261 Bacteria 118984
93 Ga0209673_1000024 3300025273 Bacteria 409632
94 Ga0209673_1000135 3300025273 Bacteria 160333
95 Ga0209673_1003504 3300025273 Bacteria 9204
96 Ga0209673_1003707 3300025273 Bacteria 8754
97 Ga0209673_1006070 3300025273 Bacteria 5932
98 Ga0209673_1006097 3300025273 Bacteria 5911
99 Ga0209673_1007708 3300025273 Bacteria 4904
100 Ga0209130_1000002 3300025284 Bacteria 722648
101 Ga0209130_1000153 3300025284 Bacteria 104299
102 Ga0209130_1004254 3300025284 Bacteria 5549
103 Ga0209675_1002129 3300025291 Bacteria 10441
104 Ga0209676_1001074 3300025292 Bacteria 30947
105 Ga0209025_1000235 3300025294 Bacteria 129981
106 Ga0209025_1000333 3300025294 Bacteria 104266
107 Ga0209025_1000377 3300025294 Bacteria 92728
108 Ga0209025_1000557 3300025294 Bacteria 69226
109 Ga0209025_1000919 3300025294 Bacteria 45324
110 Ga0209025_1005917 3300025294 Bacteria 9753
111 Ga0209025_1033921 3300025294 Bacteria 2346
112 Ga0209564_1000059 3300025295 Bacteria 328782
113 Ga0209564_1000138 3300025295 Bacteria 181512
114 Ga0209564_1000280 3300025295 Bacteria 104429
115 Ga0209564_1001614 3300025295 Bacteria 21891
116 Ga0209564_1011683 3300025295 Bacteria 3908
117 Ga0209564_1013640 3300025295 Bacteria 3432
118 Ga0209564_1014925 3300025295 Bacteria 3196
119 Ga0209758_1000788 3300025297 Bacteria 45324
120 Ga0209758_1001309 3300025297 Bacteria 30362
121 Ga0209758_1001640 3300025297 Bacteria 25413
122 Ga0209758_1001755 3300025297 Bacteria 24062
123 Ga0209758_1002788 3300025297 Bacteria 17090
124 Ga0209758_1010658 3300025297 Bacteria 5463
125 Ga0209758_1017141 3300025297 Bacteria 3630
126 Ga0209758_1047095 3300025297 Bacteria 1547
127 Ga0209050_1005821 3300025298 Bacteria 7560
128 Ga0209050_1016034 3300025298 Bacteria 3095
129 Ga0209256_1000032 3300025299 Bacteria 395041
130 Ga0209256_1000064 3300025299 Bacteria 250853
131 Ga0209256_1000667 3300025299 Bacteria 46381
132 Ga0209256_1001423 3300025299 Bacteria 24892
133 Ga0209256_1001823 3300025299 Bacteria 19960
134 Ga0209256_1005914 3300025299 Bacteria 6760
135 Ga0209256_1011177 3300025299 Bacteria 3628
136 Ga0207426_1000013 3300025302 Bacteria 721897
137 Ga0207426_1000280 3300025302 Bacteria 104299
138 Ga0207426_1000639 3300025302 Bacteria 43792
139 Ga0207426_1004269 3300025302 Bacteria 7081
140 Ga0209051_1000228 3300025303 Bacteria 94166
141 Ga0209051_1003586 3300025303 Bacteria 10096
142 Ga0209051_1020819 3300025303 Bacteria 2811
143 Ga0209257_1004075 3300025304 Bacteria 11719
144 Ga0209257_1007079 3300025304 Bacteria 6924
145 Ga0207695_10000118 3300025913 Bacteria 237085
146 Ga0207671_10000954 3300025914 Bacteria 35929
147 Ga0207650_10010837 3300025925 Bacteria 6264
148 Ga0207644_10013131 3300025931 Bacteria 5514
149 Ga0207668_10014150 3300025972 Bacteria 4934
150 Ga0207678_10051549 3300026067 Bacteria 3553
151 Ga0268266_10175533 3300028379 Bacteria 1948
152 Ga0307515_10052903 3300028794 Bacteria 6008
153 Ga0307513_10153874 3300031456 Bacteria 2203
154 Ga0307405_10000550 3300031731 Bacteria 14248
155 Ga0307406_10002809 3300031901 Bacteria 9495
156 Ga0307412_10000589 3300031911 Bacteria 21521
157 Ga0395900_0040567 3300037418 Bacteria 4797
158 Ga0395905_0089142 3300037471 Bacteria 2891
159 Ga0395905_0112739 3300037471 Bacteria 2554
160 Ga0439465_0000813 3300041413 Bacteria 9820
161 Ga0451798_0814783 3300041458 Bacteria 1527
162 Ga0451843_1425715 3300041509 Bacteria 2152
163 Ga0495617_030281 3300046452 Bacteria 1820
164 Ga0495590_0000013 3300046457 Bacteria 271977
165 Ga0495591_000109 3300046458 Bacteria 94877
166 Ga0495591_020613 3300046458 Bacteria 2173
167 Ga0495638_0000715 3300046460 Bacteria 35779
168 Ga0495650_0019909 3300046471 Bacteria 3286
169 Ga0495605_0001269 3300046474 Bacteria 16723
170 Ga0495605_0002031 3300046474 Bacteria 12766
171 Ga0495605_0002220 3300046474 Bacteria 12125
172 Ga0495605_0004941 3300046474 Bacteria 7791
173 Ga0495584_0000029 3300046491 Bacteria 105850
174 Ga0495584_0001997 3300046491 Bacteria 11733
175 Ga0495584_0014915 3300046491 Bacteria 3959
176 Ga0495585_0000221 3300046492 Bacteria 59316
177 Ga0495585_0003214 3300046492 Bacteria 11151
178 Ga0495585_0010743 3300046492 Bacteria 5438
179 Ga0495585_0027704 3300046492 Bacteria 3233
180 Ga0495596_0005935 3300046500 Bacteria 5696
181 Ga0495596_0043494 3300046500 Bacteria 1770
182 Ga0495607_0002120 3300046501 Bacteria 16568
183 Ga0495607_0027243 3300046501 Bacteria 3536
184 Ga0495607_0031869 3300046501 Bacteria 3224
185 Ga0495607_0038692 3300046501 Bacteria 2855
186 Ga0495583_0000378 3300046506 Bacteria 69104
187 Ga0495583_0001070 3300046506 Bacteria 30573
188 Ga0495583_0003300 3300046506 Bacteria 12506
189 Ga0495583_0004726 3300046506 Bacteria 9579
190 Ga0495583_0016803 3300046506 Bacteria 3913
191 Ga0495583_0016862 3300046506 Bacteria 3902
192 Ga0495583_0025213 3300046506 Bacteria 2974
193 Ga0495583_0046511 3300046506 Bacteria 2000
194 Ga0495606_0002081 3300046507 Bacteria 24424
195 Ga0495606_0019880 3300046507 Bacteria 4973
196 Ga0495606_0024866 3300046507 Bacteria 4303
197 Ga0495606_0042714 3300046507 Bacteria 3030
198 Ga0495606_0047527 3300046507 Bacteria 2828
199 Ga0495606_0054511 3300046507 Bacteria 2589
200 Ga0495606_0057260 3300046507 Bacteria 2511
201 Ga0495606_0070778 3300046507 Bacteria 2199
202 Ga0495606_0076203 3300046507 Bacteria 2097
203 Ga0495610_0000420 3300046512 Bacteria 43578
204 Ga0495610_0004903 3300046512 Bacteria 9722
205 Ga0495610_0012259 3300046512 Bacteria 5174
206 Ga0495610_0021412 3300046512 Bacteria 3557
207 Ga0495616_0000282 3300046513 Bacteria 41088
208 Ga0495616_0008218 3300046513 Bacteria 6196
209 Ga0495616_0041127 3300046513 Bacteria 2359
210 Ga0495620_0002917 3300046515 Bacteria 9822
211 Ga0495620_0018298 3300046515 Bacteria 3472
212 Ga0495631_0000737 3300046518 Bacteria 21033
213 Ga0495631_0002653 3300046518 Bacteria 9973
214 Ga0495631_0021948 3300046518 Bacteria 2970
215 Ga0495631_0030881 3300046518 Bacteria 2428
216 Ga0495632_0000530 3300046519 Bacteria 36061
217 Ga0495632_0003692 3300046519 Bacteria 10734
218 Ga0495632_0008173 3300046519 Bacteria 6463
219 Ga0495632_0014571 3300046519 Bacteria 4442
220 Ga0495632_0069664 3300046519 Bacteria 1693
221 Ga0495637_0000008 3300046520 Bacteria 404658
222 Ga0495637_0001375 3300046520 Bacteria 14567
223 Ga0495643_0009641 3300046522 Bacteria 5984
224 Ga0495643_0035915 3300046522 Bacteria 2726
225 Ga0495643_0042851 3300046522 Bacteria 2465
226 Ga0495643_0069041 3300046522 Bacteria 1858
227 Ga0495644_0013173 3300046523 Bacteria 3177
228 Ga0495648_0006040 3300046524 Bacteria 9940
229 Ga0495648_0044131 3300046524 Bacteria 2786
230 Ga0495648_0089069 3300046524 Bacteria 1733
231 Ga0495642_0002541 3300046528 Bacteria 7382
232 Ga0495642_0003697 3300046528 Bacteria 6002
233 Ga0495609_0004238 3300046538 Bacteria 7922
234 Ga0495609_0024659 3300046538 Bacteria 2758
235 Ga0495597_0015707 3300046542 Bacteria 3582
236 Ga0495622_0003965 3300046557 Bacteria 6910
237 Ga0495633_0000874 3300046558 Bacteria 26052
238 Ga0495633_0004611 3300046558 Bacteria 8684
239 Ga0495633_0028508 3300046558 Bacteria 2720
240 Ga0495656_0013478 3300046615 Bacteria 3044
241 Ga0495668_0005360 3300046616 Bacteria 8741
242 Ga0495668_0018397 3300046616 Bacteria 4037
243 Ga0495668_0032846 3300046616 Bacteria 2918
244 Ga0495668_0066684 3300046616 Bacteria 1980
245 Ga0495611_0001733 3300046648 Bacteria 10560
246 Ga0495611_0011346 3300046648 Bacteria 3777
247 Ga0495625_0013343 3300046660 Bacteria 6605
248 Ga0495625_0114440 3300046660 Bacteria 1841
249 Ga0495661_0000049 3300046665 Bacteria 144060
250 Ga0495661_0024065 3300046665 Bacteria 3944
251 Ga0495661_0144677 3300046665 Bacteria 1289
252 Ga0495588_0014780 3300046674 Bacteria 3744
253 Ga0495588_0033381 3300046674 Bacteria 2599
254 Ga0495669_0001448 3300046684 Bacteria 9794
255 Ga0495671_0076098 3300046692 Bacteria 1646
256 Ga0495649_0000071 3300046694 Bacteria 89386
257 Ga0495649_0002364 3300046694 Bacteria 13344
258 Ga0495649_0008289 3300046694 Bacteria 6257
259 Ga0495589_0001477 3300046794 Bacteria 13524
260 Ga0495589_0002349 3300046794 Bacteria 10618
261 Ga0495660_0001412 3300046810 Bacteria 16457
262 Ga0495660_0010951 3300046810 Bacteria 5271
263 Ga0495660_0026151 3300046810 Bacteria 3310
264 Ga0495604_0052769 3300047317 Bacteria 3146
265 Ga0495672_0000033 3300047320 Bacteria 291992
266 Ga0495672_0019867 3300047320 Bacteria 4418
267 Ga0495683_0000168 3300047323 Bacteria 63828
268 Ga0495683_0063750 3300047323 Bacteria 1820
269 Ga0495687_001452 3300047443 Bacteria 21757
270 Ga0495677_0000242 3300047445 Bacteria 24158
271 Ga0495677_0004949 3300047445 Bacteria 5080
272 Ga0495677_0009106 3300047445 Bacteria 3669
273 Ga0495679_011960 3300047446 Bacteria 3330
274 Ga0495679_018996 3300047446 Bacteria 2424
275 Ga0495679_032389 3300047446 Bacteria 1676
276 Ga0495685_000553 3300047447 Bacteria 11583
277 Ga0495681_0013510 3300047470 Bacteria 4732
278 Ga0495681_0028554 3300047470 Bacteria 2867
279 Ga0495686_0000654 3300047472 Bacteria 47357
280 Ga0495686_0009274 3300047472 Bacteria 7107
281 Ga0495686_0011547 3300047472 Bacteria 6220
282 Ga0495626_0002361 3300048091 Bacteria 13240
283 Ga0495626_0002442 3300048091 Bacteria 12899
284 Ga0495626_0003408 3300048091 Bacteria 10220
285 Ga0495626_0004742 3300048091 Bacteria 8219
286 Ga0495626_0012827 3300048091 Bacteria 4375
287 Ga0495626_0031146 3300048091 Bacteria 2568
288 Ga0495626_0048539 3300048091 Bacteria 1969
289 Ga0496100_0030967 3300048903 Bacteria 3322
290 Ga0496100_0043917 3300048903 Bacteria 2860
291 Ga0496101_0066028 3300048904 Bacteria 2638
292 Ga0496101_0206808 3300048904 Bacteria 1519
293 Ga0496102_0028537 3300048905 Bacteria 4985
294 Ga0496103_0007645 3300048906 Bacteria 6429
295 Ga0496109_0024987 3300048912 Bacteria 5318
296 Ga0496113_0023233 3300048916 Bacteria 4396
297 Ga0496116_0004348 3300048919 Bacteria 13548
298 Ga0496116_0005337 3300048919 Bacteria 11976
299 Ga0496116_0011026 3300048919 Bacteria 7519
300 Ga0496116_0025867 3300048919 Bacteria 4305
301 Ga0496116_0025989 3300048919 Bacteria 4291
302 Ga0496116_0027115 3300048919 Bacteria 4174
303 Ga0496116_0028682 3300048919 Bacteria 4027
304 Ga0496116_0043722 3300048919 Bacteria 3049
305 Ga0496117_0001380 3300048920 Bacteria 35320
306 Ga0496117_0001790 3300048920 Bacteria 29267
307 Ga0496117_0005361 3300048920 Bacteria 13507
308 Ga0496117_0011328 3300048920 Bacteria 7994
309 Ga0496117_0016642 3300048920 Bacteria 6190
310 Ga0496117_0036747 3300048920 Bacteria 3660
311 Ga0496118_0005583 3300048921 Bacteria 14229
312 Ga0496118_0008765 3300048921 Bacteria 10372
313 Ga0496118_0015493 3300048921 Bacteria 7054
314 Ga0496118_0020926 3300048921 Bacteria 5783
315 Ga0496118_0057424 3300048921 Bacteria 2917
316 Ga0496119_0031929 3300048922 Bacteria 3518
317 Ga0496119_0041748 3300048922 Bacteria 2917
318 Ga0496119_0051173 3300048922 Bacteria 2541
319 Ga0496119_0098476 3300048922 Bacteria 1646
320 Ga0496120_0008346 3300048923 Bacteria 7536
321 Ga0496121_0000001 3300048924 Bacteria 1830318
322 Ga0496121_0000897 3300048924 Bacteria 53790
323 Ga0496121_0003845 3300048924 Bacteria 20886
324 Ga0496121_0003993 3300048924 Bacteria 20349
325 Ga0496121_0024884 3300048924 Bacteria 5707
326 Ga0496122_0000321 3300048925 Bacteria 105353
327 Ga0496122_0001753 3300048925 Bacteria 33345
328 Ga0496122_0005948 3300048925 Bacteria 14284
329 Ga0496122_0012997 3300048925 Bacteria 8207
330 Ga0496122_0019043 3300048925 Bacteria 6297
331 Ga0496122_0026877 3300048925 Bacteria 4942
332 Ga0496122_0028565 3300048925 Bacteria 4727
333 Ga0496122_0099530 3300048925 Bacteria 1948
334 Ga0496122_0124217 3300048925 Bacteria 1656
335 Ga0496123_0000454 3300048926 Bacteria 72735
336 Ga0496123_0003014 3300048926 Bacteria 19454
337 Ga0496123_0003705 3300048926 Bacteria 16808
338 Ga0496123_0009997 3300048926 Bacteria 8453
339 Ga0496123_0029238 3300048926 Bacteria 4063
340 Ga0496123_0044505 3300048926 Bacteria 3035
341 Ga0496123_0098177 3300048926 Bacteria 1713
342 Ga0496123_0103705 3300048926 Bacteria 1646
343 Ga0496124_0000558 3300048927 Bacteria 63070
344 Ga0496124_0001760 3300048927 Bacteria 30205
345 Ga0496124_0013038 3300048927 Bacteria 8145
346 Ga0496124_0017056 3300048927 Bacteria 6867
347 Ga0496124_0044517 3300048927 Bacteria 3807
348 Ga0496124_0068102 3300048927 Bacteria 2960
349 Ga0496124_0110958 3300048927 Bacteria 2207
350 Ga0496124_0181628 3300048927 Bacteria 1618
351 Ga0496125_0000001 3300048928 Bacteria 1766138
352 Ga0496125_0000628 3300048928 Bacteria 59302
353 Ga0496125_0004347 3300048928 Bacteria 16436
354 Ga0496125_0007832 3300048928 Bacteria 11292
355 Ga0496125_0008046 3300048928 Bacteria 11130
356 Ga0496126_0000378 3300048929 Bacteria 92187
357 Ga0496126_0037048 3300048929 Bacteria 4555
358 Ga0496126_0050621 3300048929 Bacteria 3784
359 Ga0496126_0203304 3300048929 Bacteria 1671
360 Ga0495678_000024 3300049459 Bacteria 229034
361 Ga0495678_000061 3300049459 Bacteria 142649
362 Ga0495678_004320 3300049459 Bacteria 8277
363 Ga0495678_043663 3300049459 Bacteria 1778
364 Ga0495678_050131 3300049459 Bacteria 1620
365 Ga0495682_0000130 3300049460 Bacteria 65523
366 Ga0495682_0003743 3300049460 Bacteria 6693
367 Ga0501032_0036346 3300049569 Bacteria 3362
368 Ga0501032_0131638 3300049569 Bacteria 1650
369 Ga0501034_0097061 3300049571 Bacteria 2943
370 Ga0501038_0096048 3300049574 Bacteria 2475
371 Ga0501043_0039403 3300049579 Bacteria 3713
372 Ga0501046_0039504 3300049580 Bacteria 3778
373 Ga0501044_0027986 3300049823 Bacteria 5949
374 nmdc:mga03683_47521_c1 3300050489 Bacteria 1781
375 nmdc:mga00v17_3351_c1 3300050491 Bacteria 8270
376 nmdc:mga00v17_8548_c1 3300050491 Bacteria 5510
377 nmdc:mga0k408_14414_c1 3300050493 Bacteria 4355
378 Ga0495655_0014937 3300053083 Bacteria 1640
379 Ga0495619_0071860 3300053085 Bacteria 2316
380 Ga0500569_000477 3300053109 Bacteria 6620
381 Ga0500569_015641 3300053109 Bacteria 1904
382 Ga0500608_013911 3300053122 Bacteria 3578
383 Ga0500618_000926 3300053125 Bacteria 15086
384 Ga0500618_004870 3300053125 Bacteria 4185
385 Ga0500658_0006961 3300053134 Bacteria 4185
386 Ga0500658_0009055 3300053134 Bacteria 3675
387 Ga0500568_0001236 3300053139 Bacteria 16971
388 Ga0500568_0003011 3300053139 Bacteria 9633
389 Ga0500590_002185 3300053148 Bacteria 8531
390 Ga0500616_0000503 3300053153 Bacteria 49936
391 Ga0500620_045515 3300053155 Bacteria 1455
392 Ga0500622_0003044 3300053156 Bacteria 11581
393 Ga0500633_0000526 3300053160 Bacteria 6171
394 Ga0500633_0028604 3300053160 Bacteria 1776
395 Ga0501082_0031127 3300060353 Bacteria 4599

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300002773 JGI25152J39213_1003276 JGI25152J39213_10032762 333
2 3300003215 JGI25153J46596_10007022 JGI25153J46596_100070222 333
3 3300025245 Ga0207425_1001952 Ga0207425_10019527 333
4 3300025258 Ga0209129_1001686 Ga0209129_10016864 333
5 3300025297 Ga0209758_1001640 Ga0209758_100164017 333
6 3300037471 Ga0395905_0112739 Ga0395905_0112739_1067_2266 335
7 3300049569 Ga0501032_0131638 Ga0501032_0131638_175_1467 335
8 3300049580 Ga0501046_0039504 Ga0501046_0039504_1912_3204 335
9 3300060353 Ga0501082_0031127 Ga0501082_0031127_386_1678 335
10 3300046506 Ga0495583_0016803 Ga0495583_0016803_2774_3895 340
11 3300053134 Ga0500658_0006961 Ga0500658_0006961_566_1852 340
12 3300053139 Ga0500568_0001236 Ga0500568_0001236_3672_4958 340
13 3300053155 Ga0500620_045515 Ga0500620_045515_35_1321 340
14 3300053160 Ga0500633_0000526 Ga0500633_0000526_3499_4785 340
15 3300003215 JGI25153J46596_10005199 JGI25153J46596_100051997 341
16 3300025245 Ga0207425_1011354 Ga0207425_10113542 341
17 3300025258 Ga0209129_1002211 Ga0209129_10022113 341
18 3300025294 Ga0209025_1005917 Ga0209025_10059179 341
19 3300025297 Ga0209758_1001755 Ga0209758_100175516 341
20 3300002773 JGI25152J39213_1000599 JGI25152J39213_10005994 342
21 3300003215 JGI25153J46596_10001632 JGI25153J46596_1000163210 342
22 3300003771 Ga0055526_1002109 Ga0055526_10021096 342
23 3300003775 Ga0055524_1002176 Ga0055524_10021767 342
24 3300003790 Ga0055528_1002560 Ga0055528_10025606 342
25 3300025258 Ga0209129_1001258 Ga0209129_100125814 342
26 3300025273 Ga0209673_1007708 Ga0209673_10077081 342
27 3300025295 Ga0209564_1001614 Ga0209564_10016144 342
28 3300025297 Ga0209758_1001309 Ga0209758_100130927 342
29 3300025303 Ga0209051_1003586 Ga0209051_10035864 342
30 3300041509 Ga0451843_1425715 Ga0451843_1425715_967_2115 344
31 3300047317 Ga0495604_0052769 Ga0495604_0052769_2036_3136 350
32 3300046458 Ga0495591_000109 Ga0495591_000109_8250_9479 351
33 3300046492 Ga0495585_0010743 Ga0495585_0010743_3508_4737 351
34 3300046501 Ga0495607_0002120 Ga0495607_0002120_3508_4737 351
35 3300046512 Ga0495610_0004903 Ga0495610_0004903_4332_5561 351
36 3300046519 Ga0495632_0003692 Ga0495632_0003692_1295_2524 351
37 3300046520 Ga0495637_0000008 Ga0495637_0000008_91562_92791 351
38 3300046538 Ga0495609_0024659 Ga0495609_0024659_123_1352 351
39 3300046558 Ga0495633_0000874 Ga0495633_0000874_18244_19473 351
40 3300046665 Ga0495661_0144677 Ga0495661_0144677_19_1248 351
41 3300047320 Ga0495672_0000033 Ga0495672_0000033_175293_176522 351
42 3300047323 Ga0495683_0000168 Ga0495683_0000168_38847_40076 351
43 3300047446 Ga0495679_018996 Ga0495679_018996_147_1376 351
44 3300047470 Ga0495681_0028554 Ga0495681_0028554_344_1573 351
45 3300048904 Ga0496101_0206808 Ga0496101_0206808_10_1113 351
46 3300046518 Ga0495631_0030881 Ga0495631_0030881_1219_2409 355
47 3300053109 Ga0500569_015641 Ga0500569_015641_36_1226 355
48 3300041458 Ga0451798_0814783 Ga0451798_0814783_35_1225 356
49 3300046457 Ga0495590_0000013 Ga0495590_0000013_178802_180001 356
50 3300046474 Ga0495605_0004941 Ga0495605_0004941_2607_3806 356
51 3300046491 Ga0495584_0000029 Ga0495584_0000029_23854_25053 356
52 3300046518 Ga0495631_0000737 Ga0495631_0000737_11438_12637 356
53 3300046648 Ga0495611_0001733 Ga0495611_0001733_2279_3478 356
54 3300047445 Ga0495677_0004949 Ga0495677_0004949_2512_3711 356
55 3300048091 Ga0495626_0003408 Ga0495626_0003408_7825_9024 356
56 3300046506 Ga0495583_0046511 Ga0495583_0046511_44_1177 358
57 3300047445 Ga0495677_0000242 Ga0495677_0000242_9807_11006 358
58 3300003775 Ga0055524_1000018 Ga0055524_1000018179 359
59 3300025291 Ga0209675_1002129 Ga0209675_10021293 359
60 3300025295 Ga0209564_1000059 Ga0209564_10000595 359
61 3300025299 Ga0209256_1000032 Ga0209256_1000032182 359
62 3300046506 Ga0495583_0003300 Ga0495583_0003300_10450_11664 359
63 3300046513 Ga0495616_0041127 Ga0495616_0041127_601_1815 359
64 3300046522 Ga0495643_0069041 Ga0495643_0069041_251_1465 359
65 3300046616 Ga0495668_0066684 Ga0495668_0066684_331_1545 359
66 3300046694 Ga0495649_0000071 Ga0495649_0000071_49480_50694 359
67 3300046794 Ga0495589_0001477 Ga0495589_0001477_9115_10329 359
68 3300049459 Ga0495678_000024 Ga0495678_000024_117278_118492 359
69 3300048904 Ga0496101_0066028 Ga0496101_0066028_608_1795 361
70 3300047446 Ga0495679_032389 Ga0495679_032389_358_1566 362
71 3300046474 Ga0495605_0001269 Ga0495605_0001269_6969_8177 364
72 3300046491 Ga0495584_0001997 Ga0495584_0001997_7362_8570 364
73 3300046501 Ga0495607_0038692 Ga0495607_0038692_358_1566 364
74 3300046506 Ga0495583_0000378 Ga0495583_0000378_13022_14230 364
75 3300046507 Ga0495606_0076203 Ga0495606_0076203_846_2054 364
76 3300046518 Ga0495631_0002653 Ga0495631_0002653_5439_6647 364
77 3300046519 Ga0495632_0000530 Ga0495632_0000530_16780_17988 364
78 3300046528 Ga0495642_0003697 Ga0495642_0003697_3083_4291 364
79 3300046538 Ga0495609_0004238 Ga0495609_0004238_5812_7020 364
80 3300046558 Ga0495633_0004611 Ga0495633_0004611_4146_5354 364
81 3300046615 Ga0495656_0013478 Ga0495656_0013478_1500_2708 364
82 3300046648 Ga0495611_0011346 Ga0495611_0011346_1365_2573 364
83 3300046794 Ga0495589_0002349 Ga0495589_0002349_3149_4357 364
84 3300046810 Ga0495660_0010951 Ga0495660_0010951_1485_2693 364
85 3300047445 Ga0495677_0009106 Ga0495677_0009106_1172_2380 364
86 3300048091 Ga0495626_0004742 Ga0495626_0004742_2689_3897 364
87 3300048928 Ga0496125_0000628 Ga0496125_0000628_23598_24863 364
88 3300049459 Ga0495678_004320 Ga0495678_004320_6320_7528 364
89 3300002739 JGI25158J39367_1000011 JGI25158J39367_100001138 365
90 3300003354 JGI25160J50197_1006753 JGI25160J50197_10067534 365
91 3300004625 Ga0055543_1000073 Ga0055543_100007340 365
92 3300005262 Ga0065165_1035714 Ga0065165_10357141 365
93 3300025208 Ga0209436_100113 Ga0209436_1001134 365
94 3300025284 Ga0209130_1000002 Ga0209130_1000002443 365
95 3300025302 Ga0207426_1000013 Ga0207426_1000013443 365
96 3300046665 Ga0495661_0000049 Ga0495661_0000049_31338_32525 365
97 3300048912 Ga0496109_0024987 Ga0496109_0024987_2776_3963 365
98 3300048925 Ga0496122_0001753 Ga0496122_0001753_23025_24212 365
99 3300048926 Ga0496123_0003705 Ga0496123_0003705_5222_6409 365
100 3300048928 Ga0496125_0004347 Ga0496125_0004347_5028_6215 365
101 3300053160 Ga0500633_0028604 Ga0500633_0028604_33_1226 365
102 3300046474 Ga0495605_0002220 Ga0495605_0002220_8918_10111 366
103 3300048091 Ga0495626_0002361 Ga0495626_0002361_7477_8670 366
104 3300048927 Ga0496124_0068102 Ga0496124_0068102_175_1386 366
105 3300049574 Ga0501038_0096048 Ga0501038_0096048_678_1880 366
106 3300048903 Ga0496100_0030967 Ga0496100_0030967_91_1278 367
107 3300049579 Ga0501043_0039403 Ga0501043_0039403_2048_3325 368
108 3300047472 Ga0495686_0009274 Ga0495686_0009274_1470_2630 369
109 3300048925 Ga0496122_0000321 Ga0496122_0000321_33505_34770 369
110 3300048926 Ga0496123_0000454 Ga0496123_0000454_70579_71844 369
111 3300048927 Ga0496124_0000558 Ga0496124_0000558_39093_40358 369
112 3300048929 Ga0496126_0000378 Ga0496126_0000378_69389_70654 369
113 3300003187 JGI25151J46595_10004080 JGI25151J46595_100040806 370
114 3300025294 Ga0209025_1000377 Ga0209025_100037723 370
115 3300048091 Ga0495626_0002442 Ga0495626_0002442_3302_4510 370
116 3300048920 Ga0496117_0001790 Ga0496117_0001790_16392_17657 370
117 3300002737 JGI25162J39368_1000745 JGI25162J39368_100074513 371
118 3300003214 JGI25165J46597_1000565 JGI25165J46597_100056511 371
119 3300025233 Ga0209437_100042 Ga0209437_100042397 371
120 3300025261 Ga0209233_1000054 Ga0209233_1000054264 371
121 3300005616 Ga0068852_100035157 Ga0068852_1000351575 372
122 3300049571 Ga0501034_0097061 Ga0501034_0097061_1079_2356 372
123 3300053122 Ga0500608_013911 Ga0500608_013911_2359_3525 372
124 3300009093 Ga0105240_10000240 Ga0105240_1000024056 373
125 3300009545 Ga0105237_10001540 Ga0105237_100015405 373
126 3300010375 Ga0105239_10006341 Ga0105239_1000634113 373
127 3300014497 Ga0182008_10092742 Ga0182008_100927422 373
128 3300025253 Ga0209677_100261 Ga0209677_10026115 373
129 3300025261 Ga0209233_1000203 Ga0209233_100020363 373
130 3300025913 Ga0207695_10000118 Ga0207695_1000011857 373
131 3300025914 Ga0207671_10000954 Ga0207671_1000095413 373
132 3300048903 Ga0496100_0043917 Ga0496100_0043917_748_2022 373
133 3300048905 Ga0496102_0028537 Ga0496102_0028537_552_1826 373
134 3300048906 Ga0496103_0007645 Ga0496103_0007645_3984_5258 373
135 3300048920 Ga0496117_0001380 Ga0496117_0001380_3450_4724 373
136 3300048920 Ga0496117_0011328 Ga0496117_0011328_2753_4084 373
137 3300048921 Ga0496118_0015493 Ga0496118_0015493_3450_4724 373
138 3300048922 Ga0496119_0031929 Ga0496119_0031929_226_1500 373
139 3300048923 Ga0496120_0008346 Ga0496120_0008346_3231_4505 373
140 3300048924 Ga0496121_0003845 Ga0496121_0003845_8545_9819 373
141 3300048925 Ga0496122_0028565 Ga0496122_0028565_3237_4511 373
142 3300048926 Ga0496123_0098177 Ga0496123_0098177_214_1488 373
143 3300048927 Ga0496124_0044517 Ga0496124_0044517_55_1329 373
144 3300003187 JGI25151J46595_10002037 JGI25151J46595_100020373 375
145 3300003187 JGI25151J46595_10009345 JGI25151J46595_100093452 375
146 3300003354 JGI25160J50197_1006341 JGI25160J50197_10063412 375
147 3300003374 JGI25161J50226_1004331 JGI25161J50226_10043312 375
148 3300003775 Ga0055524_1002855 Ga0055524_10028552 375
149 3300004625 Ga0055543_1000359 Ga0055543_10003592 375
150 3300006048 Ga0075363_100009792 Ga0075363_1000097922 375
151 3300006178 Ga0075367_10013663 Ga0075367_100136632 375
152 3300006195 Ga0075366_10026990 Ga0075366_100269903 375
153 3300025245 Ga0207425_1004033 Ga0207425_10040332 375
154 3300025258 Ga0209129_1001184 Ga0209129_10011847 375
155 3300025273 Ga0209673_1003504 Ga0209673_10035048 375
156 3300025294 Ga0209025_1000235 Ga0209025_100023574 375
157 3300025295 Ga0209564_1014925 Ga0209564_10149252 375
158 3300025297 Ga0209758_1002788 Ga0209758_10027888 375
159 3300025299 Ga0209256_1005914 Ga0209256_10059144 375
160 3300025302 Ga0207426_1000639 Ga0207426_10006399 375
161 3300025303 Ga0209051_1020819 Ga0209051_10208192 375
162 3300050489 nmdc:mga03683_47521_c1 nmdc:mga03683_47521_c1_195_1487 375
163 3300050493 nmdc:mga0k408_14414_c1 nmdc:mga0k408_14414_c1_1785_3077 375
164 3300009765 Ga0123341_1000036 Ga0123341_100003652 376
165 3300009766 Ga0123342_1027441 Ga0123342_10274412 376
166 3300047446 Ga0495679_011960 Ga0495679_011960_2019_3233 376
167 iso_pu_bacteria 639633055 639646223 376
168 3300002773 JGI25152J39213_1011084 JGI25152J39213_10110842 377
169 3300003187 JGI25151J46595_10009343 JGI25151J46595_100093434 377
170 3300003792 Ga0055540_1000181 Ga0055540_100018121 377
171 3300025258 Ga0209129_1000066 Ga0209129_100006623 377
172 3300025273 Ga0209673_1003707 Ga0209673_10037074 377
173 3300025294 Ga0209025_1000557 Ga0209025_100055771 377
174 3300025298 Ga0209050_1005821 Ga0209050_10058211 377
175 3300025303 Ga0209051_1000228 Ga0209051_100022878 377
176 3300025304 Ga0209257_1007079 Ga0209257_10070794 377
177 3300048929 Ga0496126_0050621 Ga0496126_0050621_823_2112 377
178 3300003215 JGI25153J46596_10013563 JGI25153J46596_100135633 378
179 3300025273 Ga0209673_1006070 Ga0209673_10060704 378
180 3300025297 Ga0209758_1017141 Ga0209758_10171412 378
181 3300041413 Ga0439465_0000813 Ga0439465_0000813_2101_3390 378
182 3300046492 Ga0495585_0027704 Ga0495585_0027704_1292_2584 378
183 3300046501 Ga0495607_0027243 Ga0495607_0027243_696_1988 378
184 3300046507 Ga0495606_0019880 Ga0495606_0019880_1755_3047 378
185 3300046519 Ga0495632_0014571 Ga0495632_0014571_2986_4278 378
186 3300046519 Ga0495632_0069664 Ga0495632_0069664_348_1640 378
187 3300046524 Ga0495648_0044131 Ga0495648_0044131_1211_2503 378
188 3300046542 Ga0495597_0015707 Ga0495597_0015707_1619_2911 378
189 3300046558 Ga0495633_0028508 Ga0495633_0028508_792_2084 378
190 3300046616 Ga0495668_0018397 Ga0495668_0018397_308_1600 378
191 3300046660 Ga0495625_0114440 Ga0495625_0114440_292_1584 378
192 3300049459 Ga0495678_050131 Ga0495678_050131_311_1603 378
193 3300053083 Ga0495655_0014937 Ga0495655_0014937_62_1354 378
194 3300053134 Ga0500658_0009055 Ga0500658_0009055_1276_2568 378
195 3300046522 Ga0495643_0009641 Ga0495643_0009641_3857_5065 380
196 3300046694 Ga0495649_0002364 Ga0495649_0002364_12079_13287 380
197 3300046810 Ga0495660_0026151 Ga0495660_0026151_1517_2746 380
198 3300048091 Ga0495626_0012827 Ga0495626_0012827_1556_2764 380
199 3300048091 Ga0495626_0031146 Ga0495626_0031146_1077_2285 380
200 3300046512 Ga0495610_0012259 Ga0495610_0012259_126_1412 381
201 3300048919 Ga0496116_0025867 Ga0496116_0025867_1731_3017 381
202 3300048920 Ga0496117_0036747 Ga0496117_0036747_969_2255 381
203 3300048921 Ga0496118_0008765 Ga0496118_0008765_3035_4321 381
204 3300048925 Ga0496122_0019043 Ga0496122_0019043_1725_3011 381
205 3300048926 Ga0496123_0044505 Ga0496123_0044505_652_1938 381
206 3300048928 Ga0496125_0008046 Ga0496125_0008046_6916_8202 381
207 3300053156 Ga0500622_0003044 Ga0500622_0003044_6481_7767 381
208 3300003775 Ga0055524_1022697 Ga0055524_10226972 383
209 3300005347 Ga0070668_100077153 Ga0070668_1000771532 383
210 3300025273 Ga0209673_1006097 Ga0209673_10060975 383
211 3300025295 Ga0209564_1011683 Ga0209564_10116832 383
212 3300025299 Ga0209256_1011177 Ga0209256_10111772 383
213 3300025931 Ga0207644_10013131 Ga0207644_100131312 383
214 3300025972 Ga0207668_10014150 Ga0207668_100141504 383
215 3300046458 Ga0495591_020613 Ga0495591_020613_662_1885 383
216 3300046500 Ga0495596_0005935 Ga0495596_0005935_1351_2574 383
217 3300046500 Ga0495596_0043494 Ga0495596_0043494_30_1247 383
218 3300046506 Ga0495583_0001070 Ga0495583_0001070_4913_6136 383
219 3300046507 Ga0495606_0024866 Ga0495606_0024866_168_1391 383
220 3300046512 Ga0495610_0021412 Ga0495610_0021412_2210_3433 383
221 3300046520 Ga0495637_0001375 Ga0495637_0001375_790_2013 383
222 3300046524 Ga0495648_0006040 Ga0495648_0006040_5708_6931 383
223 3300046528 Ga0495642_0002541 Ga0495642_0002541_1850_3073 383
224 3300046616 Ga0495668_0005360 Ga0495668_0005360_7320_8543 383
225 3300046665 Ga0495661_0024065 Ga0495661_0024065_1851_3074 383
226 3300046684 Ga0495669_0001448 Ga0495669_0001448_8076_9299 383
227 3300046692 Ga0495671_0076098 Ga0495671_0076098_183_1400 383
228 3300046694 Ga0495649_0008289 Ga0495649_0008289_2508_3779 383
229 3300046810 Ga0495660_0001412 Ga0495660_0001412_3406_4629 383
230 3300047323 Ga0495683_0063750 Ga0495683_0063750_494_1717 383
231 3300047443 Ga0495687_001452 Ga0495687_001452_10100_11317 383
232 3300047447 Ga0495685_000553 Ga0495685_000553_6398_7621 383
233 3300047470 Ga0495681_0013510 Ga0495681_0013510_3199_4416 383
234 3300048922 Ga0496119_0041748 Ga0496119_0041748_824_2116 383
235 3300049459 Ga0495678_043663 Ga0495678_043663_261_1484 383
236 3300049460 Ga0495682_0003743 Ga0495682_0003743_4501_5724 383
237 iso_pu_bacteria 2977915119 2977917501 383
238 3300002773 JGI25152J39213_1001826 JGI25152J39213_10018262 384
239 3300005262 Ga0065165_1007245 Ga0065165_10072454 384
240 3300005455 Ga0070663_100051366 Ga0070663_1000513663 384
241 3300009011 Ga0105251_10003772 Ga0105251_100037729 384
242 3300009177 Ga0105248_10133570 Ga0105248_101335702 384
243 3300025284 Ga0209130_1004254 Ga0209130_10042542 384
244 3300026067 Ga0207678_10051549 Ga0207678_100515493 384
245 3300046491 Ga0495584_0014915 Ga0495584_0014915_159_1397 384
246 3300046492 Ga0495585_0000221 Ga0495585_0000221_53721_54959 384
247 3300048926 Ga0496123_0103705 Ga0496123_0103705_126_1415 384
248 3300048927 Ga0496124_0110958 Ga0496124_0110958_429_1721 384
249 3300003775 Ga0055524_1028612 Ga0055524_10286121 385
250 3300003790 Ga0055528_1000564 Ga0055528_100056421 385
251 3300025273 Ga0209673_1000135 Ga0209673_1000135123 385
252 3300025295 Ga0209564_1000138 Ga0209564_1000138105 385
253 3300025299 Ga0209256_1001423 Ga0209256_100142314 385
254 3300046471 Ga0495650_0019909 Ga0495650_0019909_1045_2337 385
255 3300046506 Ga0495583_0004726 Ga0495583_0004726_2723_4003 385
256 3300046507 Ga0495606_0042714 Ga0495606_0042714_612_1904 385
257 3300003354 JGI25160J50197_1013477 JGI25160J50197_10134771 386
258 3300025302 Ga0207426_1004269 Ga0207426_10042694 386
259 3300046452 Ga0495617_030281 Ga0495617_030281_453_1739 386
260 3300046460 Ga0495638_0000715 Ga0495638_0000715_13679_14965 386
261 3300046474 Ga0495605_0002031 Ga0495605_0002031_3346_4632 386
262 3300046501 Ga0495607_0031869 Ga0495607_0031869_1800_3086 386
263 3300046513 Ga0495616_0008218 Ga0495616_0008218_500_1786 386
264 3300046522 Ga0495643_0042851 Ga0495643_0042851_525_1811 386
265 3300046660 Ga0495625_0013343 Ga0495625_0013343_5180_6466 386
266 3300047320 Ga0495672_0019867 Ga0495672_0019867_80_1366 386
267 3300049569 Ga0501032_0036346 Ga0501032_0036346_1244_2536 386
268 3300049823 Ga0501044_0027986 Ga0501044_0027986_3218_4510 386
269 3300053109 Ga0500569_000477 Ga0500569_000477_1030_2316 386
270 3300053139 Ga0500568_0003011 Ga0500568_0003011_7788_9074 386
271 3300053153 Ga0500616_0000503 Ga0500616_0000503_1703_2989 386
272 iso_pu_bacteria 2937980651 2937988164 386
273 3300005331 Ga0070670_100016926 Ga0070670_1000169262 387
274 3300006178 Ga0075367_10009921 Ga0075367_100099212 387
275 3300025297 Ga0209758_1047095 Ga0209758_10470952 387
276 3300025925 Ga0207650_10010837 Ga0207650_100108376 387
277 3300028794 Ga0307515_10052903 Ga0307515_100529033 387
278 3300048924 Ga0496121_0000001 Ga0496121_0000001_1142632_1143963 387
279 3300048928 Ga0496125_0000001 Ga0496125_0000001_1303246_1304577 387
280 3300050491 nmdc:mga00v17_3351_c1 nmdc:mga00v17_3351_c1_6642_7955 387
281 3300025294 Ga0209025_1033921 Ga0209025_10339212 388
282 3300048919 Ga0496116_0043722 Ga0496116_0043722_656_1948 388
283 3300048921 Ga0496118_0005583 Ga0496118_0005583_11157_12449 388
284 3300046492 Ga0495585_0003214 Ga0495585_0003214_1329_2621 389
285 3300046506 Ga0495583_0016862 Ga0495583_0016862_1151_2425 389
286 3300046507 Ga0495606_0070778 Ga0495606_0070778_672_1964 389
287 3300046515 Ga0495620_0002917 Ga0495620_0002917_8404_9696 389
288 3300046616 Ga0495668_0032846 Ga0495668_0032846_686_1978 389
289 3300046506 Ga0495583_0025213 Ga0495583_0025213_361_1638 390
290 3300046507 Ga0495606_0054511 Ga0495606_0054511_40_1317 390
291 3300046513 Ga0495616_0000282 Ga0495616_0000282_29671_30948 390
292 3300046518 Ga0495631_0021948 Ga0495631_0021948_981_2273 390
293 3300046523 Ga0495644_0013173 Ga0495644_0013173_783_2060 390
294 3300046674 Ga0495588_0033381 Ga0495588_0033381_784_2076 390
295 3300048091 Ga0495626_0048539 Ga0495626_0048539_173_1450 390
296 3300048925 Ga0496122_0124217 Ga0496122_0124217_32_1321 390
297 3300049459 Ga0495678_000061 Ga0495678_000061_112380_113657 390
298 3300049460 Ga0495682_0000130 Ga0495682_0000130_53903_55180 390
299 iso_pu_bacteria 2643221637 2644209168 390
300 iso_pu_bacteria 2643221718 2644652642 390
301 iso_pu_bacteria 2891373044 2891374777 390
302 iso_pu_bacteria 2989349275 2989351941 390
303 3300048919 Ga0496116_0025989 Ga0496116_0025989_954_2285 391
304 3300048926 Ga0496123_0009997 Ga0496123_0009997_2693_4024 391
305 3300048927 Ga0496124_0017056 Ga0496124_0017056_210_1541 391
306 3300048929 Ga0496126_0203304 Ga0496126_0203304_120_1451 391
307 3300050491 nmdc:mga00v17_8548_c1 nmdc:mga00v17_8548_c1_3416_4747 391
308 iso_pu_bacteria 2842482326 2842485598 391
309 iso_pu_bacteria 2854911287 2854916039 391
310 iso_pu_bacteria 2582581316 2585332694 392
311 iso_pu_bacteria 2617270742 2617381291 392
312 iso_pu_bacteria 2919408235 2919413367 392
313 iso_pu_bacteria 2961136820 2961140762 392
314 iso_pu_bacteria 3005416602 3005422188 392
315 iso_pu_bacteria 8005314921 8005321467 392
316 iso_pu_bacteria 8005484373 8005489789 392
317 iso_pu_bacteria 8005645114 8005650661 392
318 iso_pu_bacteria 8005682033 8005683645 392
319 iso_pu_bacteria 2585427527 2585535410 393
320 iso_pu_bacteria 2585427530 2585556797 393
321 iso_pu_bacteria 2615840626 2616308067 393
322 iso_pu_bacteria 2751185800 2753358881 393
323 iso_pu_bacteria 2758568016 2758641115 393
324 iso_pu_bacteria 2775507049 2776915160 393
325 iso_pu_bacteria 2818991453 2819640996 393
326 iso_pu_bacteria 2894652903 2894654043 393
327 3300053125 Ga0500618_000926 Ga0500618_000926_10950_12221 394
328 iso_pu_bacteria 2509276033 2509444433 394
329 iso_pu_bacteria 2534681786 2535484317 394
330 iso_pu_bacteria 2791355259 2793314069 394
331 iso_pu_bacteria 2839993093 2839995207 394
332 iso_pu_bacteria 2840764183 2840765665 394
333 iso_pu_bacteria 2904578770 2904583299 394
334 iso_pu_bacteria 2915650412 2915651380 394
335 iso_pu_bacteria 2511231027 2511392391 395
336 iso_pu_bacteria 2513237144 2513911367 395
337 iso_pu_bacteria 2513237146 2513924437 395
338 iso_pu_bacteria 2599185170 2599419601 395
339 iso_pu_bacteria 2615840624 2616293804 395
340 iso_pu_bacteria 2643221599 2644004563 395
341 iso_pu_bacteria 2718217882 2719183486 395
342 iso_pu_bacteria 2718218009 2719734203 395
343 iso_pu_bacteria 2718218363 2721149598 395
344 iso_pu_bacteria 2718218365 2721161000 395
345 iso_pu_bacteria 2718218366 2721166435 395
346 iso_pu_bacteria 2721755514 2722842605 395
347 iso_pu_bacteria 2721755810 2724046959 395
348 iso_pu_bacteria 2728369365 2730166721 395
349 iso_pu_bacteria 2728369397 2730300632 395
350 iso_pu_bacteria 2791355260 2793322357 395
351 iso_pu_bacteria 2791355263 2793341184 395
352 iso_pu_bacteria 2791355264 2793349524 395
353 iso_pu_bacteria 2791355266 2793358371 395
354 iso_pu_bacteria 2838022645 2838026363 395
355 iso_pu_bacteria 2838035591 2838039864 395
356 iso_pu_bacteria 2838042994 2838044716 395
357 iso_pu_bacteria 2838661181 2838664148 395
358 iso_pu_bacteria 2838680041 2838680174 395
359 iso_pu_bacteria 2838694306 2838695795 395
360 iso_pu_bacteria 2838707686 2838709170 395
361 iso_pu_bacteria 2842077413 2842079594 395
362 iso_pu_bacteria 2842118031 2842120212 395
363 iso_pu_bacteria 2842198810 2842202124 395
364 iso_pu_bacteria 2842237096 2842238581 395
365 iso_pu_bacteria 2842291075 2842293255 395
366 iso_pu_bacteria 2842370503 2842370636 395
367 iso_pu_bacteria 2842377471 2842379652 395
368 iso_pu_bacteria 2842384541 2842386723 395
369 iso_pu_bacteria 2933016740 2933023501 395
370 iso_pu_bacteria 2935894831 2935896315 395
371 iso_pu_bacteria 2936381700 2936385701 395
372 iso_pu_bacteria 2996893221 2996897748 395
373 iso_pu_bacteria 3005409236 3005410783 395
374 iso_pu_bacteria 3005452660 3005456516 395
375 iso_pu_bacteria 8005289223 8005291498 395
376 iso_pu_bacteria 8005301065 8005305622 395
377 iso_pu_bacteria 8005688590 8005692624 395
378 iso_pu_bacteria 8018127388 8018132712 395
379 3300048922 Ga0496119_0098476 Ga0496119_0098476_106_1410 396
380 3300048925 Ga0496122_0099530 Ga0496122_0099530_412_1716 396
381 iso_pu_bacteria 2509276021 2509388847 396
382 iso_pu_bacteria 2510065019 2510135822 396
383 iso_pu_bacteria 2510461076 2510897305 396
384 iso_pu_bacteria 2510917028 2511185765 396
385 iso_pu_bacteria 2510917030 2511194114 396
386 iso_pu_bacteria 2513237084 2513570988 396
387 iso_pu_bacteria 2513237085 2513574809 396
388 iso_pu_bacteria 2513237088 2513595376 396
389 iso_pu_bacteria 2513237093 2513634060 396
390 iso_pu_bacteria 2513237103 2513707428 396
391 iso_pu_bacteria 2513237138 2513866520 396
392 iso_pu_bacteria 2513237162 2514022188 396
393 iso_pu_bacteria 2515075009 2515115031 396
394 iso_pu_bacteria 2515154113 2515633923 396
395 iso_pu_bacteria 2515154114 2515641258 396
396 iso_pu_bacteria 2515154116 2515659737 396
397 iso_pu_bacteria 2515154134 2515740995 396
398 iso_pu_bacteria 2516653077 2517038617 396
399 iso_pu_bacteria 2516653085 2517078873 396
400 iso_pu_bacteria 2517093000 2517097660 396
401 iso_pu_bacteria 2517287029 2517409092 396
402 iso_pu_bacteria 2534681796 2535514720 396
403 iso_pu_bacteria 2582581294 2585201133 396
404 iso_pu_bacteria 2582581298 2585223406 396
405 iso_pu_bacteria 2582581299 2585232422 396
406 iso_pu_bacteria 2582581304 2585256264 396
407 iso_pu_bacteria 2582581867 2585398942 396
408 iso_pu_bacteria 2585427526 2585523794 396
409 iso_pu_bacteria 2585427528 2585541809 396
410 iso_pu_bacteria 2585427529 2585545998 396
411 iso_pu_bacteria 2585427590 2585818937 396
412 iso_pu_bacteria 2585427593 2585840543 396
413 iso_pu_bacteria 2643221634 2644196926 396
414 iso_pu_bacteria 2643221643 2644237530 396
415 iso_pu_bacteria 2718217927 2719388230 396
416 iso_pu_bacteria 2718217997 2719667850 396
417 iso_pu_bacteria 2718218199 2720494270 396
418 iso_pu_bacteria 2718218232 2720615733 396
419 iso_pu_bacteria 2718218233 2720622518 396
420 iso_pu_bacteria 2718218235 2720633888 396
421 iso_pu_bacteria 2718218269 2720777572 396
422 iso_pu_bacteria 2718218423 2721401867 396
423 iso_pu_bacteria 2721755556 2723029172 396
424 iso_pu_bacteria 2721755684 2723562807 396
425 iso_pu_bacteria 2721755685 2723569479 396
426 iso_pu_bacteria 2721755809 2724040681 396
427 iso_pu_bacteria 2721755819 2724092179 396
428 iso_pu_bacteria 2721755822 2724106744 396
429 iso_pu_bacteria 2721755823 2724112552 396
430 iso_pu_bacteria 2724679232 2725946607 396
431 iso_pu_bacteria 2728369352 2730110108 396
432 iso_pu_bacteria 2738541333 2739038876 396
433 iso_pu_bacteria 2765235942 2766063309 396
434 iso_pu_bacteria 2791355256 2793296759 396
435 iso_pu_bacteria 2791355261 2793328938 396
436 iso_pu_bacteria 2791355262 2793336746 396
437 iso_pu_bacteria 2791355265 2793352626 396
438 iso_pu_bacteria 2791355267 2793365482 396
439 iso_pu_bacteria 2802429605 2805928220 396
440 iso_pu_bacteria 2802429606 2805935571 396
441 iso_pu_bacteria 2802429633 2806046622 396
442 iso_pu_bacteria 2802429634 2806051383 396
443 iso_pu_bacteria 2802429635 2806059372 396
444 iso_pu_bacteria 2802429636 2806066665 396
445 iso_pu_bacteria 2802429637 2806073722 396
446 iso_pu_bacteria 2838016132 2838020670 396
447 iso_pu_bacteria 2838048938 2838053175 396
448 iso_pu_bacteria 2838061910 2838065810 396
449 iso_pu_bacteria 2838068647 2838070678 396
450 iso_pu_bacteria 2838668709 2838674932 396
451 iso_pu_bacteria 2838686498 2838689695 396
452 iso_pu_bacteria 2838701080 2838707263 396
453 iso_pu_bacteria 2838729681 2838731610 396
454 iso_pu_bacteria 2838742623 2838744551 396
455 iso_pu_bacteria 2841851746 2841853091 396
456 iso_pu_bacteria 2841864319 2841868963 396
457 iso_pu_bacteria 2842110456 2842112593 396
458 iso_pu_bacteria 2842146304 2842151940 396
459 iso_pu_bacteria 2842156927 2842160418 396
460 iso_pu_bacteria 2842163707 2842165602 396
461 iso_pu_bacteria 2842180545 2842183916 396
462 iso_pu_bacteria 2842192696 2842196229 396
463 iso_pu_bacteria 2842205361 2842209063 396
464 iso_pu_bacteria 2842217011 2842219267 396
465 iso_pu_bacteria 2842229732 2842231497 396
466 iso_pu_bacteria 2842243621 2842246033 396
467 iso_pu_bacteria 2842250916 2842257106 396
468 iso_pu_bacteria 2842257432 2842260411 396
469 iso_pu_bacteria 2842264693 2842268302 396
470 iso_pu_bacteria 2842271015 2842273821 396
471 iso_pu_bacteria 2842278818 2842282247 396
472 iso_pu_bacteria 2842285085 2842286426 396
473 iso_pu_bacteria 2842304105 2842308951 396
474 iso_pu_bacteria 2842311132 2842312375 396
475 iso_pu_bacteria 2842317721 2842321953 396
476 iso_pu_bacteria 2842341865 2842344495 396
477 iso_pu_bacteria 2842363717 2842367535 396
478 iso_pu_bacteria 2842395702 2842397696 396
479 iso_pu_bacteria 2842402390 2842404021 396
480 iso_pu_bacteria 2842409023 2842410276 396
481 iso_pu_bacteria 2842415677 2842416924 396
482 iso_pu_bacteria 2842422224 2842424293 396
483 iso_pu_bacteria 2842428310 2842432274 396
484 iso_pu_bacteria 2842434925 2842438578 396
485 iso_pu_bacteria 2842441272 2842445208 396
486 iso_pu_bacteria 2842447887 2842452796 396
487 iso_pu_bacteria 2842462802 2842466391 396
488 iso_pu_bacteria 2842469257 2842473211 396
489 iso_pu_bacteria 2842489311 2842494681 396
490 iso_pu_bacteria 2842495871 2842499859 396
491 iso_pu_bacteria 2842871566 2842874755 396
492 iso_pu_bacteria 2844454524 2844456442 396
493 iso_pu_bacteria 2857516855 2857522038 396
494 iso_pu_bacteria 2919100787 2919101716 396
495 iso_pu_bacteria 2923556063 2923556330 396
496 iso_pu_bacteria 2933570622 2933575395 396
497 iso_pu_bacteria 2933586486 2933588518 396
498 iso_pu_bacteria 2933599457 2933601482 396
499 iso_pu_bacteria 2935901341 2935902479 396
500 iso_pu_bacteria 2936367885 2936369363 396
501 iso_pu_bacteria 2936375103 2936380059 396
502 iso_pu_bacteria 2996887358 2996888134 396
503 iso_pu_bacteria 3005445848 3005450229 396
504 iso_pu_bacteria 8005258706 8005261314 396
505 iso_pu_bacteria 8005275841 8005278436 396
506 iso_pu_bacteria 8005282627 8005283020 396
507 iso_pu_bacteria 8005307578 8005310404 396
508 iso_pu_bacteria 8005321885 8005322661 396
509 iso_pu_bacteria 8005376324 8005377871 396
510 iso_pu_bacteria 8005382845 8005385165 396
511 iso_pu_bacteria 8005395548 8005399755 396
512 iso_pu_bacteria 8005430974 8005433251 396
513 iso_pu_bacteria 8005460587 8005465728 396
514 iso_pu_bacteria 8005497431 8005498265 396
515 iso_pu_bacteria 8005542996 8005543390 396
516 iso_pu_bacteria 8005556819 8005560172 396
517 iso_pu_bacteria 8005563573 8005564373 396
518 iso_pu_bacteria 8005570704 8005573925 396
519 iso_pu_bacteria 8005619151 8005619455 396
520 iso_pu_bacteria 8005668836 8005669674 396
521 iso_pu_bacteria 8005695170 8005699701 396
522 iso_pu_bacteria 8018163183 8018167445 396
523 iso_pu_bacteria 8018176218 8018181913 396
524 iso_pu_bacteria 8023680758 8023684690 396
525 iso_pu_bacteria 8024479707 8024479849 396
526 iso_pu_bacteria 8024501048 8024506472 396
527 iso_pu_bacteria 8056375014 8056376073 396
528 iso_pu_bacteria 8056382006 8056384182 396
529 iso_pu_bacteria 8057874678 8057879036 396
530 3300005937 Ga0081455_10092265 Ga0081455_100922652 397
531 iso_pu_bacteria 2585427594 2585843863 397
532 iso_pu_bacteria 2643221689 2644498280 397
533 iso_pu_bacteria 2738541293 2738800935 397
534 iso_pu_bacteria 2738543024 2739308242 397
535 iso_pu_bacteria 2928521798 2928523083 397
536 iso_pu_bacteria 2954011201 2954013552 397
537 iso_pu_bacteria 8024486573 8024491717 397
538 iso_pu_bacteria 2529292951 2530648207 398
539 iso_pu_bacteria 2775506902 2776269930 398
540 iso_pu_bacteria 2775506904 2776281047 398
541 iso_pu_bacteria 2899803654 2899804058 398
542 3300003790 Ga0055528_1000621 Ga0055528_10006214 399
543 3300003790 Ga0055528_1001023 Ga0055528_100102316 399
544 3300025273 Ga0209673_1000024 Ga0209673_1000024235 399
545 3300025295 Ga0209564_1013640 Ga0209564_10136403 399
546 3300025299 Ga0209256_1000667 Ga0209256_100066710 399
547 iso_pu_bacteria 2599185352 2600197302 399
548 3300006038 Ga0075365_10000703 Ga0075365_100007039 400
549 3300009766 Ga0123342_1010346 Ga0123342_10103464 400
550 3300025297 Ga0209758_1010658 Ga0209758_10106583 400
551 3300046507 Ga0495606_0047527 Ga0495606_0047527_1368_2660 400
552 3300046507 Ga0495606_0057260 Ga0495606_0057260_112_1398 400
553 3300046512 Ga0495610_0000420 Ga0495610_0000420_8423_9715 400
554 3300046515 Ga0495620_0018298 Ga0495620_0018298_2133_3425 400
555 3300046519 Ga0495632_0008173 Ga0495632_0008173_4045_5337 400
556 3300046522 Ga0495643_0035915 Ga0495643_0035915_540_1832 400
557 3300047472 Ga0495686_0011547 Ga0495686_0011547_1723_3015 400
558 3300048927 Ga0496124_0181628 Ga0496124_0181628_153_1445 400
559 3300053125 Ga0500618_004870 Ga0500618_004870_2256_3548 400
560 iso_pu_bacteria 2929138655 2929139769 400
561 3300002774 JGI25150J39212_1000133 JGI25150J39212_100013318 401
562 3300003187 JGI25151J46595_10000407 JGI25151J46595_1000040724 401
563 3300003214 JGI25165J46597_1000062 JGI25165J46597_1000062188 401
564 3300003215 JGI25153J46596_10014457 JGI25153J46596_100144572 401
565 3300025258 Ga0209129_1000308 Ga0209129_100030824 401
566 3300025261 Ga0209233_1000129 Ga0209233_10001295 401
567 3300025294 Ga0209025_1000919 Ga0209025_100091919 401
568 3300025297 Ga0209758_1000788 Ga0209758_100078819 401
569 3300031456 Ga0307513_10153874 Ga0307513_101538742 401
570 3300031731 Ga0307405_10000550 Ga0307405_100005502 401
571 3300031901 Ga0307406_10002809 Ga0307406_100028092 401
572 3300031911 Ga0307412_10000589 Ga0307412_1000058917 401
573 3300046507 Ga0495606_0002081 Ga0495606_0002081_19803_21098 401
574 3300046524 Ga0495648_0089069 Ga0495648_0089069_282_1577 401
575 3300046557 Ga0495622_0003965 Ga0495622_0003965_3995_5290 401
576 3300046674 Ga0495588_0014780 Ga0495588_0014780_213_1508 401
577 3300047472 Ga0495686_0000654 Ga0495686_0000654_2519_3814 401
578 3300048916 Ga0496113_0023233 Ga0496113_0023233_977_2272 401
579 3300048919 Ga0496116_0004348 Ga0496116_0004348_1911_3206 401
580 3300048919 Ga0496116_0005337 Ga0496116_0005337_1515_2810 401
581 3300048919 Ga0496116_0011026 Ga0496116_0011026_4954_6249 401
582 3300048919 Ga0496116_0027115 Ga0496116_0027115_2075_3370 401
583 3300048919 Ga0496116_0028682 Ga0496116_0028682_822_2117 401
584 3300048920 Ga0496117_0005361 Ga0496117_0005361_1874_3169 401
585 3300048920 Ga0496117_0016642 Ga0496117_0016642_3424_4719 401
586 3300048921 Ga0496118_0020926 Ga0496118_0020926_1224_2519 401
587 3300048921 Ga0496118_0057424 Ga0496118_0057424_538_1833 401
588 3300048922 Ga0496119_0051173 Ga0496119_0051173_125_1420 401
589 3300048924 Ga0496121_0003993 Ga0496121_0003993_10036_11331 401
590 3300048924 Ga0496121_0024884 Ga0496121_0024884_1681_2976 401
591 3300048925 Ga0496122_0005948 Ga0496122_0005948_9722_11017 401
592 3300048925 Ga0496122_0012997 Ga0496122_0012997_870_2165 401
593 3300048925 Ga0496122_0026877 Ga0496122_0026877_2778_4073 401
594 3300048926 Ga0496123_0003014 Ga0496123_0003014_1911_3206 401
595 3300048926 Ga0496123_0029238 Ga0496123_0029238_1911_3206 401
596 3300048927 Ga0496124_0001760 Ga0496124_0001760_12883_14178 401
597 3300048927 Ga0496124_0013038 Ga0496124_0013038_6043_7338 401
598 3300048928 Ga0496125_0007832 Ga0496125_0007832_9046_10341 401
599 3300048929 Ga0496126_0037048 Ga0496126_0037048_1145_2440 401
600 3300053085 Ga0495619_0071860 Ga0495619_0071860_913_2208 401
601 3300053148 Ga0500590_002185 Ga0500590_002185_830_2125 401
602 iso_pu_bacteria 2509276018 2509367556 401
603 iso_pu_bacteria 2844009547 2844014021 401
604 iso_pu_bacteria 2856328259 2856331372 401
605 iso_pu_bacteria 2869242130 2869249184 401
606 iso_pu_bacteria 2869249662 2869255002 401
607 iso_pu_bacteria 2869256925 2869264086 401
608 iso_pu_bacteria 2869264136 2869265932 401
609 iso_pu_bacteria 2869271264 2869272415 401
610 iso_pu_bacteria 2871459585 2871463210 401
611 iso_pu_bacteria 2874116593 2874123194 401
612 iso_pu_bacteria 2874162495 2874164363 401
613 iso_pu_bacteria 2876386047 2876392453 401
614 iso_pu_bacteria 2876399893 2876405919 401
615 iso_pu_bacteria 2876406927 2876407223 401
616 iso_pu_bacteria 2876420981 2876427520 401
617 iso_pu_bacteria 2878774303 2878777377 401
618 iso_pu_bacteria 2878781027 2878788431 401
619 iso_pu_bacteria 2906363423 2906370634 401
620 iso_pu_bacteria 2906370794 2906371660 401
621 iso_pu_bacteria 2906386501 2906390593 401
622 iso_pu_bacteria 2906393657 2906395354 401
623 iso_pu_bacteria 2906401398 2906401802 401
624 iso_pu_bacteria 2906408224 2906412189 401
625 iso_pu_bacteria 2922151315 2922151393 401
626 iso_pu_bacteria 2922172374 2922174524 401
627 iso_pu_bacteria 2922178524 2922184959 401
628 iso_pu_bacteria 2924733363 2924739443 401
629 iso_pu_bacteria 2924741084 2924744379 401
630 iso_pu_bacteria 2924748358 2924753965 401
631 iso_pu_bacteria 2937861824 2937863422 401
632 iso_pu_bacteria 2958137437 2958144052 401
633 iso_pu_bacteria 2958158011 2958163159 401
634 iso_pu_bacteria 2961183825 2961184596 401
635 iso_pu_bacteria 2965025482 2965026430 401
636 iso_pu_bacteria 2965040258 2965041617 401
637 iso_pu_bacteria 2965047637 2965053317 401
638 iso_pu_bacteria 2965089291 2965091129 401
639 iso_pu_bacteria 2965110997 2965113905 401
640 iso_pu_bacteria 2970510686 2970517696 401
641 iso_pu_bacteria 2970532167 2970533002 401
642 iso_pu_bacteria 2970547951 2970549355 401
643 iso_pu_bacteria 2970627176 2970633621 401
644 iso_pu_bacteria 2977851361 2977857088 401
645 iso_pu_bacteria 2977907340 2977913487 401
646 iso_pu_bacteria 2977935797 2977941368 401
647 iso_pu_bacteria 2977950692 2977951192 401
648 iso_pu_bacteria 2979764755 2979770983 401
649 iso_pu_bacteria 2979772303 2979773772 401
650 iso_pu_bacteria 2987645492 2987651376 401
651 iso_pu_bacteria 3004248173 3004253287 401
652 iso_pu_bacteria 649633066 649873233 401
653 iso_pu_bacteria 8004300914 8004306642 401
654 iso_pu_bacteria 8004727605 8004731935 401
655 3300048924 Ga0496121_0000897 Ga0496121_0000897_8534_9859 402
656 iso_pu_bacteria 2643221557 2643804955 402
657 iso_pu_bacteria 2643221610 2644065799 402
658 iso_pu_bacteria 2643221618 2644104427 402
659 iso_pu_bacteria 2643221626 2644147477 402
660 iso_pu_bacteria 2643221655 2644313420 402
661 iso_pu_bacteria 2643221659 2644331575 402
662 iso_pu_bacteria 2643221668 2644376906 402
663 iso_pu_bacteria 2643221675 2644417691 402
664 iso_pu_bacteria 2643221680 2644453795 402
665 iso_pu_bacteria 2643221698 2644541739 402
666 iso_pu_bacteria 2643221712 2644613045 402
667 iso_pu_bacteria 2643221723 2644677685 402
668 iso_pu_bacteria 2643221726 2644688430 402
669 iso_pu_bacteria 2844163670 2844168937 402
670 iso_pu_bacteria 2871451962 2871452242 402
671 iso_pu_bacteria 2874109183 2874116175 402
672 iso_pu_bacteria 2903513507 2903516464 402
673 iso_pu_bacteria 2920822456 2920826865 402
674 iso_pu_bacteria 2941499720 2941504171 402
675 iso_pu_bacteria 2958064165 2958067700 402
676 iso_pu_bacteria 2970489779 2970495618 402
677 iso_pu_bacteria 2977898635 2977901936 402
678 iso_pu_bacteria 2996386984 2996389937 402
679 iso_pu_bacteria 3004232784 3004235098 402
680 iso_pu_bacteria 8004312739 8004317204 402
681 iso_pu_bacteria 2756170246 2756675967 403
682 iso_pu_bacteria 2871466892 2871468382 403
683 iso_pu_bacteria 2970619444 2970619572 403
684 iso_pu_bacteria 3004167301 3004169205 403
685 iso_pu_bacteria 8002285264 8002288790 403
686 iso_pu_bacteria 2512875024 2512959023 404
687 iso_pu_bacteria 2513237164 2514038302 404
688 iso_pu_bacteria 2643221623 2644129146 404
689 3300002987 JGI25159J45721_1000055 JGI25159J45721_100005510 406
690 3300003187 JGI25151J46595_10033446 JGI25151J46595_100334462 406
691 3300003354 JGI25160J50197_1000073 JGI25160J50197_100007392 406
692 3300003374 JGI25161J50226_1000552 JGI25161J50226_10005526 406
693 3300003771 Ga0055526_1011147 Ga0055526_10111472 406
694 3300003775 Ga0055524_1001554 Ga0055524_100155412 406
695 3300003781 Ga0055536_1001975 Ga0055536_10019753 406
696 3300003794 Ga0055531_10001659 Ga0055531_1000165910 406
697 3300004625 Ga0055543_1000143 Ga0055543_100014311 406
698 3300005262 Ga0065165_1000198 Ga0065165_100019892 406
699 3300013249 Ga0171463_1002 Ga0171463_1002101 406
700 3300015690 Ga0183363_1016 Ga0183363_101654 406
701 3300025284 Ga0209130_1000153 Ga0209130_100015389 406
702 3300025292 Ga0209676_1001074 Ga0209676_100107411 406
703 3300025294 Ga0209025_1000333 Ga0209025_100033389 406
704 3300025295 Ga0209564_1000280 Ga0209564_100028089 406
705 3300025298 Ga0209050_1016034 Ga0209050_10160342 406
706 3300025299 Ga0209256_1000064 Ga0209256_1000064114 406
707 3300025299 Ga0209256_1001823 Ga0209256_100182310 406
708 3300025302 Ga0207426_1000280 Ga0207426_100028089 406
709 3300025304 Ga0209257_1004075 Ga0209257_10040753 406
710 3300037418 Ga0395900_0040567 Ga0395900_0040567_1583_2878 406
711 3300002705 JGI25156J39149_1001756 JGI25156J39149_10017562 408
712 3300002741 JGI25157J39369_1000751 JGI25157J39369_100075116 408
713 3300009093 Ga0105240_10038269 Ga0105240_100382694 408
714 3300009545 Ga0105237_10004482 Ga0105237_100044829 408
715 3300009551 Ga0105238_10003702 Ga0105238_1000370212 408
716 3300010375 Ga0105239_10004313 Ga0105239_1000431312 408
717 3300025250 Ga0209026_1000024 Ga0209026_100002496 408
718 3300025256 Ga0209759_1000057 Ga0209759_1000057194 408
719 3300028379 Ga0268266_10175533 Ga0268266_101755331 408
720 3300037471 Ga0395905_0089142 Ga0395905_0089142_751_2058 408

Structural Annotation

Top 5 Hits

ID Description Score Start End
8jtc-assembly1.cif.gz_A human vmat2 complex with reserpine 0.8512 33 389
6kkk-assembly3.cif.gz_C crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation (h115a mutant) 0.8409 30 391
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.8288 35 391
7da5-assembly1.cif.gz_A cryo-em structure of the human mct1 d309n mutant in complex with basigin-2 in the inward-open conformation. 0.8277 34 389
6euq-assembly1.cif.gz_A mdfa(q131r/l339e) 0.81 34 387
ID Description Score Start End Superfamily
af_P76242_7_383_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9315 28 389 1.20.1250.20
af_P17583_1_184_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9243 37 221 1.20.1250.20
af_P17583_1_184_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9148 37 221 1.20.1250.20
af_P0AA80_9_209_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.908 33 208 1.20.1250.20
af_Q54W37_27_219_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9003 33 207 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A317KX19-F1-model_v4 MFS transporter 0.9516 28 389 GO:0005886
GO:0022857
AF-T0C469-F1-model_v4 deleted 0.9421 31 214
AF-A0A0L8MD32-F1-model_v4 Transporter 0.9327 29 388 GO:0016020
GO:0022857
AF-A0A839UDC1-F1-model_v4 CP family cyanate transporter-like MFS transporter 0.9304 36 389 GO:0016020
GO:0022857
AF-A0A7L7MEU8-F1-model_v4 MFS transporter 0.9163 28 389 GO:0016020
GO:0022857

Feature Viewer

pLDDT pTM Quality
80.97 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map