F477331

General Info

Members Datasets Scaffolds Average Seq Length
720 477 473 221

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0029609|Ga0496121_0029609_3883_4614
Length 243
Sequence MATTIMDTTMIITIPTTDSTLPEGGDLQALLRLMAWLSPAFPVGSFAYSGGLERAVHDGLVGDAAGLGEWISTLLRHGTAWNDAVLAAEAHRAFDDAAQLADVAELAEALAGSRERHQETMLLGEAFLSVAAAWPHPVFSLLSPKTAYPVAVGAVAGGHRIGCEKMLAAFLHALVSQAVSSGIRLGVAGQKDGVAILARLEVDISDIARRASRSSLDDLGSATVQADIASVRHETQATRLFRS

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
5 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
6 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
7 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
8 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
9 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
10 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
11 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
12 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
13 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
14 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
15 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
16 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
17 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
18 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
19 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
20 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
21 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
22 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
23 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
24 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
25 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
26 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
27 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
28 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
29 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
30 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
31 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
32 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
33 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
34 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
35 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
36 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
37 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
38 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
39 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
40 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
41 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
42 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
43 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
44 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
45 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
46 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
47 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
48 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
49 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
50 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
51 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
52 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
53 2643221568 Rhizobium sp. Root564 Isolate Unclassified
54 2643221582 Rhizobium sp. Root651 Isolate Unclassified
55 2643221599 Rhizobium sp. Root708 Isolate Unclassified
56 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
57 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
58 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
59 2718217882 Rhizobium sp. N741 Isolate Nodule
60 2718217927 Rhizobium sp. N324 Isolate Nodule
61 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
62 2718218009 Rhizobium sp. N561 Isolate Nodule
63 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
64 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
65 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
66 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
67 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
68 2718218363 Rhizobium sp. N113 Isolate Nodule
69 2718218365 Rhizobium sp. N731 Isolate Nodule
70 2718218366 Rhizobium sp. N621 Isolate Nodule
71 2718218423 Rhizobium sp. N941 Isolate Nodule
72 2721755514 Rhizobium sp. N6212 Isolate Nodule
73 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
74 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
75 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
76 2721755809 Rhizobium sp. N541 Isolate Nodule
77 2721755810 Rhizobium sp. N871 Isolate Nodule
78 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
79 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
80 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
81 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
82 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
83 2728369365 Rhizobium sp. N1341 Isolate Nodule
84 2728369397 Rhizobium sp. N1314 Isolate Nodule
85 2738541293 Rhizobium sp. GV031 Isolate Unclassified
86 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
87 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
88 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
89 2791355256 Rhizobium sp. M10 Isolate Nodule
90 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
91 2791355260 Rhizobium sp. L9 Isolate Nodule
92 2791355261 Rhizobium sp. J15 Isolate Nodule
93 2791355262 Rhizobium sp. M1 Isolate Nodule
94 2791355263 Rhizobium chutanense C5 Isolate Nodule
95 2791355264 Rhizobium sp. S9 Isolate Nodule
96 2791355265 Rhizobium sp. H4 Isolate Nodule
97 2791355266 Rhizobium sp. L43 Isolate Nodule
98 2791355267 Rhizobium sp. L18 Isolate Nodule
99 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
100 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
101 2802429633 Rhizobium anhuiense J3 Isolate Nodule
102 2802429634 Rhizobium anhuiense S10 Isolate Nodule
103 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
104 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
105 2802429637 Rhizobium anhuiense C15 Isolate Nodule
106 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
107 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
108 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
109 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
110 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
111 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
112 2838048938 Rhizobium pisi 27/80 Isolate Nodule
113 2838061910 Rhizobium phaseoli L15 Isolate Nodule
114 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
115 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
116 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
117 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
118 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
119 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
120 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
121 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
122 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
123 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
124 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
125 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
126 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
127 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
128 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
129 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
130 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
131 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
132 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
133 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
134 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
135 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
136 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
137 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
138 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
139 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
140 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
141 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
142 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
143 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
144 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
145 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
146 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
147 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
148 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
149 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
150 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
151 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
152 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
153 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
154 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
155 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
156 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
157 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
158 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
159 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
160 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
161 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
162 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
163 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
164 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
165 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
166 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
167 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
168 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
169 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
170 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
171 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
172 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
173 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
174 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
175 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
176 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
177 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
178 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
179 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
180 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
181 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
182 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
183 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
184 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
185 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
186 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
187 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
188 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
189 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
190 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
191 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
192 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
193 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
194 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
195 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
196 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
197 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
198 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
199 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
200 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
201 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
202 2933599457 Rhizobium phaseoli M3 Isolate Nodule
203 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
204 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
205 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
206 2936381700 Rhizobium chutanense C16 Isolate Unclassified
207 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
208 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
209 2996887358 Rhizobium sp. R711 Isolate Nodule
210 2996893221 Rhizobium sp. R635 Isolate Nodule
211 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
212 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
213 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
214 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
215 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
216 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
217 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
218 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
219 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
220 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
221 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
222 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
223 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
224 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
225 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
226 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
227 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
228 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
229 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
230 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
231 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
232 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
233 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
234 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
235 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
236 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
237 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
238 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
239 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
240 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
241 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
242 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
243 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
244 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
245 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
246 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
247 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
248 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
249 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
250 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
251 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
252 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
253 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
254 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
255 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
256 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
257 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
258 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
259 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
260 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
261 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
262 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
263 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
264 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
265 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
266 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
267 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
268 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
269 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
270 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
271 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
273 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
274 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
275 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
276 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
277 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
278 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
279 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
280 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
281 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
282 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
283 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
284 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
285 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
286 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
287 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
288 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
289 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
290 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
291 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
292 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
300 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
301 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
302 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
304 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
305 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
306 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
307 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
308 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
309 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
310 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
311 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
312 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
313 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
314 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
315 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
316 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
317 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
318 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
319 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
320 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
321 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
322 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
323 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
324 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
325 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
326 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
327 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
328 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
329 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
330 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
331 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
332 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
333 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
334 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
335 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
336 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
337 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
338 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
339 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
340 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
341 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
342 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
343 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
344 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
345 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
346 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
347 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
348 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
349 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
350 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
351 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
352 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
353 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
354 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
355 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
356 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
357 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
358 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
359 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
360 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
361 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
362 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
363 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
364 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
365 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
366 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
367 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
368 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
369 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
370 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
371 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
372 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
373 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
374 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
375 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
376 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
377 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
378 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
379 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
380 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
381 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
382 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
383 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
384 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
385 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
386 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
387 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
388 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
389 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
390 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
391 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
392 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
393 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
394 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
395 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
396 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
397 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
398 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
399 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
400 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
401 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
402 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
403 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
404 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
405 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
406 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
409 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
410 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
411 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
412 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
413 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
414 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
415 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
416 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
417 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
418 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
419 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
420 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
421 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
422 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
423 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
424 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
425 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
426 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
427 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
428 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
429 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
430 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
431 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
432 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
433 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
434 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
435 3300053152 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere Metagenome Endosphere
436 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
437 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
438 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
439 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
440 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
441 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
442 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
443 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
444 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
445 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
446 8005258706 Rhizobium sp. R693 Isolate Nodule
447 8005275841 Rhizobium sp. N4311 Isolate Nodule
448 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
449 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
450 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
451 8005321885 Rhizobium sp. R72 Isolate Nodule
452 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
453 8005382845 Rhizobium sp. R634 Isolate Nodule
454 8005395548 Rhizobium sp. R339 Isolate Nodule
455 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
456 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
457 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
458 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
459 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
460 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
461 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
462 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
463 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
464 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
465 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
466 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
467 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
468 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
469 8018176218 Rhizobium sp. N122 Isolate Nodule
470 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
471 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
472 8024501048 Rhizobium sp. H4 Isolate Nodule
473 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
474 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
475 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
476 8056382006 Rhizobium croatiense 13T Isolate Nodule
477 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 65.28
Metatranscriptomes 0.28
Isolates 34.44

Biome Distribution

Category Percentage (%)
Aerial Root 0.14
Bulb 0
Endosphere 24.44
Nodule 25.97
Rhizoplane 2.36
Rhizosphere 25.56
Stem 0
Stem Tuber 0
Unclassified 21.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000220 3300001979 Bacteria 24157
2 JGI25155J39150_1000066 3300002704 Bacteria 69429
3 JGI25156J39149_1000075 3300002705 Bacteria 76505
4 JGI25162J39368_1000149 3300002737 Bacteria 76227
5 JGI25154J39366_1000075 3300002738 Bacteria 91249
6 JGI25158J39367_1000924 3300002739 Bacteria 5478
7 JGI25157J39369_1000051 3300002741 Bacteria 111770
8 JGI25157J39369_1000077 3300002741 Bacteria 86251
9 JGI25152J39213_1003477 3300002773 Bacteria 5357
10 JGI25152J39213_1004457 3300002773 Bacteria 4408
11 JGI25152J39213_1005057 3300002773 Bacteria 3969
12 JGI25152J39213_1010756 3300002773 Bacteria 2069
13 JGI25152J39213_1012615 3300002773 Bacteria 1800
14 JGI25152J39213_1019713 3300002773 Bacteria 1220
15 JGI25150J39212_1000091 3300002774 Bacteria 52487
16 JGI25159J45721_1000108 3300002987 Bacteria 39183
17 JGI25159J45721_1009532 3300002987 Bacteria 2554
18 JGI25151J46595_10000027 3300003187 Bacteria 208739
19 JGI25151J46595_10000737 3300003187 Bacteria 26948
20 JGI25151J46595_10002713 3300003187 Bacteria 10338
21 JGI25151J46595_10003152 3300003187 Bacteria 9266
22 JGI25151J46595_10008201 3300003187 Bacteria 5045
23 JGI25165J46597_1000781 3300003214 Bacteria 24238
24 JGI25165J46597_1001844 3300003214 Bacteria 8789
25 JGI25153J46596_10006055 3300003215 Bacteria 6214
26 JGI25153J46596_10025633 3300003215 Bacteria 2103
27 JGI25153J46596_10026205 3300003215 Bacteria 2069
28 JGI25153J46596_10032025 3300003215 Bacteria 1760
29 rootH1_10000491 3300003316 Bacteria 1982
30 rootH1_10000491 3300003323 Bacteria 18631
31 rootH1_10000492 3300003316 Bacteria 2697
32 rootH2_10065851 3300003320 Bacteria 1438
33 rootL2_10069708 3300003322 Bacteria 6238
34 rootH1_10089023 3300003323 Bacteria 1182
35 rootH1_10147282 3300003323 Bacteria 3621
36 JGI25160J50197_1000001 3300003354 Bacteria 782301
37 JGI25160J50197_1000766 3300003354 Bacteria 17317
38 JGI25160J50197_1005979 3300003354 Bacteria 4994
39 JGI25160J50197_1042491 3300003354 Bacteria 1033
40 JGI25160J50197_1042520 3300003354 Bacteria 1033
41 JGI25161J50226_1000001 3300003374 Bacteria 655036
42 JGI25161J50226_1000163 3300003374 Bacteria 46470
43 JGI25161J50226_1001467 3300003374 Bacteria 7059
44 Ga0006562J51391_1161272 3300003578 Bacteria 810
45 Ga0055526_1001847 3300003771 Bacteria 14659
46 Ga0055526_1003775 3300003771 Bacteria 9445
47 Ga0055524_1001962 3300003775 Bacteria 11047
48 Ga0055524_1002479 3300003775 Bacteria 9480
49 Ga0055524_1006370 3300003775 Bacteria 5121
50 Ga0055524_1016289 3300003775 Bacteria 2673
51 Ga0055528_1001291 3300003790 Bacteria 15733
52 Ga0055528_1001315 3300003790 Bacteria 15543
53 Ga0055528_1004820 3300003790 Bacteria 6416
54 Ga0055540_1000483 3300003792 Bacteria 30602
55 Ga0055540_1007277 3300003792 Bacteria 4216
56 Ga0055540_1009779 3300003792 Bacteria 3268
57 Ga0055540_1012556 3300003792 Bacteria 2649
58 Ga0055543_1000007 3300004625 Bacteria 204042
59 Ga0055543_1000108 3300004625 Bacteria 71519
60 Ga0055543_1000220 3300004625 Bacteria 45860
61 Ga0065165_1000008 3300005262 Bacteria 334429
62 Ga0065165_1010003 3300005262 Bacteria 4169
63 Ga0065165_1045051 3300005262 Bacteria 1287
64 Ga0070670_100006743 3300005331 Bacteria 9734
65 Ga0070663_100095516 3300005455 Bacteria 2210
66 Ga0070665_100071341 3300005548 Bacteria 3480
67 Ga0070665_100363096 3300005548 Bacteria 1454
68 Ga0070665_101046759 3300005548 Bacteria 828
69 Ga0068855_100223595 3300005563 Bacteria 2110
70 Ga0068856_100018348 3300005614 Bacteria 6782
71 Ga0068852_100050243 3300005616 Bacteria 3572
72 Ga0068851_10215264 3300005834 Bacteria 1077
73 Ga0075365_10002545 3300006038 Bacteria 8990
74 Ga0075368_10016715 3300006042 Bacteria 2737
75 Ga0075363_100024716 3300006048 Bacteria 3056
76 Ga0075363_100286327 3300006048 Bacteria 954
77 Ga0075363_100311845 3300006048 Bacteria 914
78 Ga0075362_10001438 3300006177 Bacteria 7606
79 Ga0075367_10019538 3300006178 Bacteria 3758
80 Ga0075369_10013658 3300006186 Bacteria 3230
81 Ga0075369_10105239 3300006186 Bacteria 1268
82 Ga0075369_10132833 3300006186 Bacteria 1132
83 Ga0075366_10008481 3300006195 Bacteria 5716
84 Ga0075370_10000296 3300006353 Bacteria 17852
85 Ga0099826_10000404 3300006948 Bacteria 20366
86 Ga0099826_10010403 3300006948 Bacteria 6968
87 Ga0105244_10225682 3300009036 Bacteria 878
88 Ga0105240_10000014 3300009093 Bacteria 482033
89 Ga0105248_10235320 3300009177 Bacteria 2062
90 Ga0105237_10000685 3300009545 Bacteria 46922
91 Ga0105249_10821368 3300009553 Bacteria 994
92 Ga0123341_1000018 3300009765 Bacteria 81421
93 Ga0123342_1030001 3300009766 Bacteria 2771
94 Ga0105239_10001960 3300010375 Bacteria 26777
95 Ga0157371_10009685 3300013102 Bacteria 7565
96 Ga0157370_10000015 3300013104 Bacteria 185771
97 Ga0157369_10253917 3300013105 Bacteria 1835
98 Ga0157369_10960494 3300013105 Bacteria 876
99 Ga0182007_10001042 3300015262 Bacteria 15186
100 Ga0209435_100005 3300025206 Bacteria 573745
101 Ga0209436_100272 3300025208 Bacteria 23718
102 Ga0209563_108717 3300025230 Bacteria 1581
103 Ga0209437_100058 3300025233 Bacteria 357279
104 Ga0209437_100060 3300025233 Bacteria 355034
105 Ga0207425_1000043 3300025245 Bacteria 208791
106 Ga0207425_1000495 3300025245 Bacteria 24691
107 Ga0207425_1010927 3300025245 Bacteria 2190
108 Ga0207425_1015964 3300025245 Bacteria 1675
109 Ga0207425_1018478 3300025245 Bacteria 1512
110 Ga0209646_1000011 3300025246 Bacteria 573745
111 Ga0209646_1006128 3300025246 Bacteria 2037
112 Ga0209026_1000008 3300025250 Bacteria 573745
113 Ga0209677_100493 3300025253 Bacteria 22233
114 Ga0209148_1005477 3300025254 Bacteria 2905
115 Ga0209759_1000004 3300025256 Bacteria 573745
116 Ga0209759_1026858 3300025256 Bacteria 1199
117 Ga0209129_1000072 3300025258 Bacteria 208805
118 Ga0209129_1000128 3300025258 Bacteria 130420
119 Ga0209129_1000702 3300025258 Bacteria 21824
120 Ga0209129_1000810 3300025258 Bacteria 19737
121 Ga0209129_1001196 3300025258 Bacteria 14949
122 Ga0209129_1001400 3300025258 Bacteria 13490
123 Ga0209233_1000137 3300025261 Bacteria 200314
124 Ga0209233_1000149 3300025261 Bacteria 181183
125 Ga0209233_1000160 3300025261 Bacteria 159035
126 Ga0209673_1000125 3300025273 Bacteria 168465
127 Ga0209673_1000256 3300025273 Bacteria 100514
128 Ga0209673_1001106 3300025273 Bacteria 30133
129 Ga0209673_1001124 3300025273 Bacteria 29604
130 Ga0209673_1003529 3300025273 Bacteria 9154
131 Ga0209673_1003945 3300025273 Bacteria 8289
132 Ga0209130_1000003 3300025284 Bacteria 677988
133 Ga0209130_1000023 3300025284 Bacteria 359355
134 Ga0209130_1018831 3300025284 Bacteria 1613
135 Ga0209130_1026880 3300025284 Bacteria 1229
136 Ga0209675_1037288 3300025291 Bacteria 1094
137 Ga0209676_1017938 3300025292 Bacteria 2484
138 Ga0209676_1023533 3300025292 Bacteria 2014
139 Ga0209025_1000120 3300025294 Bacteria 208791
140 Ga0209025_1000154 3300025294 Bacteria 170288
141 Ga0209025_1000451 3300025294 Bacteria 80470
142 Ga0209025_1000537 3300025294 Bacteria 71838
143 Ga0209025_1001251 3300025294 Bacteria 35202
144 Ga0209025_1004713 3300025294 Bacteria 11638
145 Ga0209025_1009663 3300025294 Bacteria 6675
146 Ga0209025_1010434 3300025294 Bacteria 6292
147 Ga0209025_1107509 3300025294 Unclassified 865
148 Ga0209564_1000259 3300025295 Bacteria 112570
149 Ga0209564_1000778 3300025295 Bacteria 44316
150 Ga0209564_1002794 3300025295 Bacteria 13027
151 Ga0209564_1012596 3300025295 Bacteria 3673
152 Ga0209564_1013716 3300025295 Bacteria 3418
153 Ga0209564_1017225 3300025295 Bacteria 2828
154 Ga0209758_1000111 3300025297 Bacteria 208790
155 Ga0209758_1000666 3300025297 Bacteria 51353
156 Ga0209758_1001689 3300025297 Bacteria 24856
157 Ga0209758_1001847 3300025297 Bacteria 23247
158 Ga0209758_1001921 3300025297 Bacteria 22607
159 Ga0209758_1013196 3300025297 Bacteria 4536
160 Ga0209758_1053509 3300025297 Bacteria 1386
161 Ga0209758_1105598 3300025297 Bacteria 790
162 Ga0209256_1000283 3300025299 Bacteria 89387
163 Ga0209256_1000669 3300025299 Bacteria 46351
164 Ga0209256_1001412 3300025299 Bacteria 24978
165 Ga0209256_1004538 3300025299 Bacteria 8646
166 Ga0209256_1007919 3300025299 Bacteria 5076
167 Ga0209256_1010497 3300025299 Bacteria 3865
168 Ga0207426_1000011 3300025302 Bacteria 791203
169 Ga0207426_1000087 3300025302 Bacteria 288870
170 Ga0207426_1000208 3300025302 Bacteria 140385
171 Ga0207426_1001853 3300025302 Bacteria 15526
172 Ga0209051_1000434 3300025303 Bacteria 56673
173 Ga0209051_1002537 3300025303 Bacteria 12902
174 Ga0209051_1011437 3300025303 Bacteria 4380
175 Ga0209051_1011745 3300025303 Bacteria 4298
176 Ga0209051_1018130 3300025303 Bacteria 3123
177 Ga0209051_1046682 3300025303 Bacteria 1487
178 Ga0209051_1076025 3300025303 Bacteria 989
179 Ga0209257_1008463 3300025304 Bacteria 5837
180 Ga0207680_10299891 3300025903 Bacteria 1120
181 Ga0207695_10000037 3300025913 Bacteria 476303
182 Ga0207671_10000080 3300025914 Bacteria 148567
183 Ga0207650_10001249 3300025925 Bacteria 18464
184 Ga0207709_10873955 3300025935 Bacteria 729
185 Ga0207678_10793202 3300026067 Bacteria 836
186 Ga0207698_10151060 3300026142 Bacteria 2016
187 Ga0209371_1001488 3300027312 Bacteria 15631
188 Ga0209371_1002322 3300027312 Bacteria 10818
189 Ga0209371_1031306 3300027312 Bacteria 1156
190 Ga0209282_1005835 3300027666 Bacteria 7604
191 Ga0209282_1008576 3300027666 Bacteria 6455
192 Ga0209813_10028992 3300027866 Bacteria 1618
193 Ga0268266_10115318 3300028379 Bacteria 2385
194 Ga0268266_10220485 3300028379 Bacteria 1743
195 Ga0307515_10016158 3300028794 Bacteria 13688
196 Ga0268256_1002674 3300030500 Bacteria 8788
197 Ga0268256_1035540 3300030500 Bacteria 1157
198 Ga0316181_1077312 3300030744 Bacteria 3042
199 Ga0307513_10017820 3300031456 Bacteria 8507
200 Ga0307405_10006331 3300031731 Bacteria 5814
201 Ga0307410_10422158 3300031852 Bacteria 1082
202 Ga0307406_10012688 3300031901 Bacteria 4806
203 Ga0307412_10011713 3300031911 Bacteria 5087
204 Ga0439439_0005679 3300041406 Bacteria 2859
205 Ga0439465_0006683 3300041413 Bacteria 3663
206 Ga0451787_506157 3300041441 Bacteria 797
207 Ga0451791_1385197 3300041451 Bacteria 913
208 Ga0451795_1336264 3300041456 Bacteria 1225
209 Ga0451807_0807317 3300041486 Bacteria 1358
210 Ga0451833_1409442 3300041491 Bacteria 2415
211 Ga0451837_0356305 3300041494 Bacteria 2045
212 Ga0451837_1426596 3300041494 Bacteria 1991
213 Ga0451839_0519812 3300041496 Bacteria 2332
214 Ga0451841_0067188 3300041498 Bacteria 4263
215 Ga0451841_0886176 3300041498 Bacteria 858
216 Ga0451845_0941672 3300041501 Bacteria 810
217 Ga0451847_0391898 3300041503 Bacteria 1452
218 Ga0451849_0478376 3300041505 Bacteria 1069
219 Ga0451849_0644493 3300041505 Bacteria 1082
220 Ga0451851_0359614 3300041507 Bacteria 1394
221 Ga0451851_0362762 3300041507 Bacteria 2644
222 Ga0451851_0997622 3300041507 Bacteria 1165
223 Ga0451854_31556 3300041510 Bacteria 942
224 Ga0451855_0123925 3300041511 Bacteria 1032
225 Ga0451853_2441200 3300041512 Bacteria 3266
226 Ga0439432_122620 3300042006 Bacteria 769
227 Ga0439449_0014977 3300042007 Bacteria 2914
228 Ga0439449_0091240 3300042007 Bacteria 1125
229 Ga0466963_0067613 3300044694 Bacteria 2398
230 Ga0466970_0038631 3300044765 Bacteria 2532
231 Ga0466957_0036296 3300044842 Bacteria 2962
232 Ga0466959_0256697 3300045049 Bacteria 1204
233 Ga0466958_0103078 3300045836 Bacteria 1776
234 Ga0466967_0376794 3300045976 Bacteria 1377
235 Ga0495617_156741 3300046452 Bacteria 723
236 Ga0495627_076257 3300046453 Bacteria 975
237 Ga0495592_0185871 3300046454 Bacteria 1412
238 Ga0495629_0011633 3300046459 Bacteria 6389
239 Ga0495638_0002684 3300046460 Bacteria 14329
240 Ga0495651_0426252 3300046462 Bacteria 861
241 Ga0495650_0041528 3300046471 Bacteria 1966
242 Ga0495650_0076648 3300046471 Bacteria 1299
243 Ga0495650_0093763 3300046471 Bacteria 1138
244 Ga0495582_0350850 3300046473 Bacteria 850
245 Ga0495605_0024293 3300046474 Bacteria 3173
246 Ga0495605_0065354 3300046474 Bacteria 1730
247 Ga0495605_0142592 3300046474 Bacteria 1074
248 Ga0495605_0171700 3300046474 Bacteria 957
249 Ga0495585_0010500 3300046492 Bacteria 5508
250 Ga0495585_0016828 3300046492 Bacteria 4236
251 Ga0495585_0042594 3300046492 Bacteria 2542
252 Ga0495596_0025969 3300046500 Bacteria 2363
253 Ga0495607_0036345 3300046501 Bacteria 2968
254 Ga0495607_0090988 3300046501 Bacteria 1653
255 Ga0495583_0008644 3300046506 Bacteria 6196
256 Ga0495583_0017563 3300046506 Bacteria 3794
257 Ga0495583_0076224 3300046506 Bacteria 1465
258 Ga0495606_0005913 3300046507 Bacteria 11499
259 Ga0495606_0014480 3300046507 Bacteria 6150
260 Ga0495606_0090605 3300046507 Bacteria 1882
261 Ga0495606_0177706 3300046507 Bacteria 1230
262 Ga0495606_0200008 3300046507 Bacteria 1139
263 Ga0495606_0219110 3300046507 Bacteria 1073
264 Ga0495610_0011881 3300046512 Bacteria 5287
265 Ga0495610_0133978 3300046512 Bacteria 1073
266 Ga0495616_0076540 3300046513 Bacteria 1608
267 Ga0495618_0337425 3300046514 Bacteria 931
268 Ga0495620_0019701 3300046515 Bacteria 3311
269 Ga0495620_0109817 3300046515 Bacteria 1094
270 Ga0495631_0002418 3300046518 Bacteria 10535
271 Ga0495631_0026930 3300046518 Bacteria 2635
272 Ga0495632_0011295 3300046519 Bacteria 5220
273 Ga0495632_0011535 3300046519 Bacteria 5151
274 Ga0495632_0106936 3300046519 Bacteria 1315
275 Ga0495643_0042539 3300046522 Bacteria 2475
276 Ga0495643_0047962 3300046522 Bacteria 2311
277 Ga0495648_0028085 3300046524 Bacteria 3752
278 Ga0495648_0029443 3300046524 Bacteria 3645
279 Ga0495648_0177648 3300046524 Bacteria 1085
280 Ga0495652_0500993 3300046529 Unclassified 842
281 Ga0495609_0013402 3300046538 Bacteria 3872
282 Ga0495609_0044374 3300046538 Bacteria 1994
283 Ga0495609_0230008 3300046538 Bacteria 768
284 Ga0495597_0021425 3300046542 Bacteria 3005
285 Ga0495633_0033410 3300046558 Bacteria 2481
286 Ga0495668_0011366 3300046616 Bacteria 5335
287 Ga0495668_0126107 3300046616 Bacteria 1401
288 Ga0495611_0015171 3300046648 Bacteria 3293
289 Ga0495611_0150621 3300046648 Bacteria 1086
290 Ga0495625_0014370 3300046660 Bacteria 6323
291 Ga0495625_0093902 3300046660 Bacteria 2070
292 Ga0495625_0223977 3300046660 Bacteria 1231
293 Ga0495625_0295102 3300046660 Bacteria 1039
294 Ga0495635_0095787 3300046663 Bacteria 2029
295 Ga0495661_0052942 3300046665 Bacteria 2443
296 Ga0495661_0230471 3300046665 Bacteria 955
297 Ga0495657_0130399 3300046675 Bacteria 1575
298 Ga0495670_0007974 3300046691 Bacteria 5207
299 Ga0495670_0044321 3300046691 Bacteria 2221
300 Ga0495670_0081383 3300046691 Bacteria 1650
301 Ga0495671_0078571 3300046692 Bacteria 1618
302 Ga0495671_0088405 3300046692 Bacteria 1517
303 Ga0495649_0030912 3300046694 Bacteria 2955
304 Ga0495660_0011239 3300046810 Bacteria 5197
305 Ga0495660_0075985 3300046810 Bacteria 1771
306 Ga0495604_0009351 3300047317 Bacteria 7757
307 Ga0495636_0020118 3300047318 Bacteria 2688
308 Ga0495672_0029103 3300047320 Bacteria 3484
309 Ga0495687_089111 3300047443 Bacteria 1186
310 Ga0495673_0057849 3300047469 Bacteria 1673
311 Ga0495673_0179321 3300047469 Bacteria 803
312 Ga0495681_0014458 3300047470 Bacteria 4522
313 Ga0495681_0172625 3300047470 Bacteria 893
314 Ga0495686_0007362 3300047472 Bacteria 8257
315 Ga0495686_0019073 3300047472 Bacteria 4587
316 Ga0495686_0041073 3300047472 Bacteria 2947
317 Ga0495686_0041530 3300047472 Bacteria 2928
318 Ga0495686_0050670 3300047472 Bacteria 2608
319 Ga0495615_0022829 3300048090 Bacteria 1427
320 Ga0495626_0034213 3300048091 Bacteria 2432
321 Ga0496100_0258121 3300048903 Bacteria 1291
322 Ga0496101_0041771 3300048904 Bacteria 3272
323 Ga0496102_0010148 3300048905 Bacteria 8098
324 Ga0496102_0394871 3300048905 Bacteria 1301
325 Ga0496103_0039134 3300048906 Bacteria 2913
326 Ga0496104_0465704 3300048907 Bacteria 1175
327 Ga0496106_0002856 3300048909 Bacteria 12826
328 Ga0496107_0082556 3300048910 Bacteria 2344
329 Ga0496110_0427473 3300048913 Bacteria 1207
330 Ga0496111_0016074 3300048914 Bacteria 5152
331 Ga0496113_0422117 3300048916 Bacteria 1071
332 Ga0496116_0000105 3300048919 Bacteria 192704
333 Ga0496116_0006284 3300048919 Bacteria 10823
334 Ga0496116_0006925 3300048919 Bacteria 10165
335 Ga0496116_0007875 3300048919 Bacteria 9349
336 Ga0496116_0040555 3300048919 Bacteria 3205
337 Ga0496116_0067855 3300048919 Bacteria 2276
338 Ga0496116_0068104 3300048919 Bacteria 2269
339 Ga0496116_0202769 3300048919 Bacteria 1036
340 Ga0496116_0227398 3300048919 Bacteria 949
341 Ga0496117_0006083 3300048920 Bacteria 12375
342 Ga0496117_0016743 3300048920 Bacteria 6162
343 Ga0496117_0039280 3300048920 Bacteria 3495
344 Ga0496117_0095099 3300048920 Bacteria 1905
345 Ga0496117_0123208 3300048920 Bacteria 1588
346 Ga0496117_0227723 3300048920 Bacteria 1032
347 Ga0496117_0251453 3300048920 Bacteria 964
348 Ga0496118_0006836 3300048921 Bacteria 12375
349 Ga0496118_0014507 3300048921 Bacteria 7372
350 Ga0496118_0021462 3300048921 Bacteria 5681
351 Ga0496118_0022693 3300048921 Bacteria 5476
352 Ga0496118_0047537 3300048921 Bacteria 3324
353 Ga0496118_0154264 3300048921 Bacteria 1432
354 Ga0496118_0187056 3300048921 Bacteria 1243
355 Ga0496119_0009897 3300048922 Bacteria 8096
356 Ga0496119_0010784 3300048922 Bacteria 7652
357 Ga0496119_0033843 3300048922 Bacteria 3379
358 Ga0496119_0041128 3300048922 Bacteria 2948
359 Ga0496119_0071226 3300048922 Bacteria 2036
360 Ga0496119_0121878 3300048922 Bacteria 1432
361 Ga0496119_0248144 3300048922 Bacteria 899
362 Ga0496120_0014163 3300048923 Bacteria 5323
363 Ga0496120_0141752 3300048923 Bacteria 1219
364 Ga0496121_0007360 3300048924 Bacteria 13307
365 Ga0496121_0011993 3300048924 Bacteria 9528
366 Ga0496121_0029609 3300048924 Bacteria 5056
367 Ga0496121_0032437 3300048924 Bacteria 4746
368 Ga0496121_0035631 3300048924 Bacteria 4454
369 Ga0496121_0043024 3300048924 Bacteria 3917
370 Ga0496121_0044299 3300048924 Bacteria 3840
371 Ga0496121_0071182 3300048924 Bacteria 2798
372 Ga0496121_0105311 3300048924 Bacteria 2165
373 Ga0496121_0210834 3300048924 Bacteria 1376
374 Ga0496121_0295766 3300048924 Bacteria 1101
375 Ga0496121_0449160 3300048924 Bacteria 831
376 Ga0496122_0008642 3300048925 Bacteria 10929
377 Ga0496122_0015649 3300048925 Bacteria 7236
378 Ga0496122_0023906 3300048925 Bacteria 5365
379 Ga0496122_0027756 3300048925 Bacteria 4828
380 Ga0496122_0042701 3300048925 Bacteria 3563
381 Ga0496122_0059616 3300048925 Bacteria 2816
382 Ga0496122_0077289 3300048925 Bacteria 2338
383 Ga0496122_0090298 3300048925 Bacteria 2091
384 Ga0496122_0203860 3300048925 Bacteria 1153
385 Ga0496123_0004716 3300048926 Bacteria 14106
386 Ga0496123_0011311 3300048926 Bacteria 7753
387 Ga0496123_0012772 3300048926 Bacteria 7122
388 Ga0496123_0019400 3300048926 Bacteria 5361
389 Ga0496123_0054424 3300048926 Bacteria 2634
390 Ga0496123_0062112 3300048926 Bacteria 2396
391 Ga0496123_0137730 3300048926 Bacteria 1340
392 Ga0496123_0154024 3300048926 Bacteria 1235
393 Ga0496124_0000067 3300048927 Bacteria 222576
394 Ga0496124_0006891 3300048927 Bacteria 12213
395 Ga0496124_0019469 3300048927 Bacteria 6315
396 Ga0496124_0029118 3300048927 Bacteria 4926
397 Ga0496124_0032066 3300048927 Bacteria 4646
398 Ga0496124_0034333 3300048927 Bacteria 4453
399 Ga0496124_0047233 3300048927 Bacteria 3684
400 Ga0496124_0103540 3300048927 Bacteria 2302
401 Ga0496124_0120303 3300048927 Bacteria 2099
402 Ga0496124_0209505 3300048927 Bacteria 1476
403 Ga0496124_0228705 3300048927 Bacteria 1392
404 Ga0496124_0336646 3300048927 Bacteria 1074
405 Ga0496125_0005400 3300048928 Bacteria 14237
406 Ga0496125_0021764 3300048928 Bacteria 5966
407 Ga0496125_0048793 3300048928 Bacteria 3526
408 Ga0496125_0055340 3300048928 Bacteria 3233
409 Ga0496125_0056696 3300048928 Bacteria 3179
410 Ga0496125_0149009 3300048928 Bacteria 1611
411 Ga0496125_0192010 3300048928 Bacteria 1347
412 Ga0496125_0222756 3300048928 Bacteria 1214
413 Ga0496125_0239791 3300048928 Bacteria 1152
414 Ga0496125_0258921 3300048928 Bacteria 1092
415 Ga0496126_0000780 3300048929 Bacteria 57510
416 Ga0496126_0074643 3300048929 Bacteria 3011
417 Ga0496126_0198482 3300048929 Bacteria 1695
418 Ga0496126_0366645 3300048929 Bacteria 1175
419 Ga0495678_019113 3300049459 Bacteria 3066
420 Ga0495678_046186 3300049459 Bacteria 1713
421 Ga0495678_051013 3300049459 Bacteria 1601
422 Ga0495682_0058279 3300049460 Bacteria 1397
423 Ga0501032_0020538 3300049569 Bacteria 4597
424 Ga0501033_0010894 3300049570 Bacteria 6971
425 Ga0501043_0147614 3300049579 Bacteria 1841
426 Ga0501048_0212229 3300049582 Bacteria 1373
427 Ga0501068_0065208 3300049584 Bacteria 2217
428 Ga0501073_0263175 3300049589 Bacteria 1190
429 Ga0501074_0465720 3300049590 Bacteria 896
430 Ga0501083_0154344 3300049744 Bacteria 1503
431 Ga0501035_0004474 3300049822 Bacteria 13266
432 Ga0501035_0246602 3300049822 Bacteria 1518
433 Ga0501035_0367112 3300049822 Bacteria 1202
434 nmdc:mga03683_60837_c1 3300050489 Bacteria 1596
435 nmdc:mga03n38_55256_c1 3300050490 Bacteria 1788
436 nmdc:mga0yw44_42139_c1 3300050492 Bacteria 2721
437 nmdc:mga0k408_15622_c1 3300050493 Bacteria 2640
438 nmdc:mga06z11_63609_c1 3300050494 Bacteria 1931
439 nmdc:mga04h51_39772_c1 3300050495 Bacteria 1529
440 nmdc:mga07m45_31638_c1 3300050496 Bacteria 2933
441 nmdc:mga0sz30_126726_c1 3300050516 Bacteria 1124
442 nmdc:mga0sz30_28639_c1 3300050516 Bacteria 2293
443 nmdc:mga0sz30_7809_c1 3300050516 Bacteria 3093
444 Ga0500644_0141598 3300053088 Bacteria 956
445 Ga0500557_009931 3300053105 Bacteria 2357
446 Ga0500562_028625 3300053108 Bacteria 1465
447 Ga0500569_001416 3300053109 Bacteria 4514
448 Ga0500569_020295 3300053109 Bacteria 1741
449 Ga0500572_009765 3300053111 Bacteria 2276
450 Ga0500594_0002866 3300053118 Bacteria 3760
451 Ga0500607_098475 3300053121 Bacteria 1457
452 Ga0500614_071210 3300053123 Bacteria 955
453 Ga0500618_048414 3300053125 Bacteria 965
454 Ga0500658_0005723 3300053134 Bacteria 4628
455 Ga0500658_0285960 3300053134 Bacteria 758
456 Ga0500659_0113461 3300053135 Bacteria 1391
457 Ga0500561_0093855 3300053137 Bacteria 891
458 Ga0500568_0004394 3300053139 Bacteria 7544
459 Ga0500568_0009417 3300053139 Bacteria 4644
460 Ga0500590_031710 3300053148 Bacteria 2740
461 Ga0500606_084255 3300053152 Bacteria 1076
462 Ga0500616_0020975 3300053153 Bacteria 3667
463 Ga0500622_0001357 3300053156 Bacteria 19789
464 Ga0500622_0231734 3300053156 Bacteria 822
465 Ga0500624_001660 3300053157 Bacteria 3344
466 Ga0500627_0052792 3300053158 Bacteria 1775
467 Ga0500633_0000319 3300053160 Bacteria 7134
468 Ga0500634_0000243 3300053161 Bacteria 17768
469 Ga0500636_0000374 3300053177 Bacteria 24550
470 Ga0500636_0000443 3300053177 Bacteria 22859
471 Ga0500636_0170806 3300053177 Bacteria 1176
472 Ga0500636_0244814 3300053177 Bacteria 918
473 Ga0500596_024697 3300053735 Bacteria 915

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300002773 JGI25152J39213_1010756 JGI25152J39213_10107562 192
2 3300003187 JGI25151J46595_10008201 JGI25151J46595_100082016 192
3 3300003215 JGI25153J46596_10026205 JGI25153J46596_100262052 192
4 3300025245 Ga0207425_1015964 Ga0207425_10159641 192
5 3300025258 Ga0209129_1001400 Ga0209129_10014002 192
6 3300025294 Ga0209025_1001251 Ga0209025_10012512 192
7 3300025297 Ga0209758_1001847 Ga0209758_10018479 192
8 3300049569 Ga0501032_0020538 Ga0501032_0020538_1290_1961 192
9 3300049579 Ga0501043_0147614 Ga0501043_0147614_501_1172 192
10 3300049589 Ga0501073_0263175 Ga0501073_0263175_222_893 192
11 3300049570 Ga0501033_0010894 Ga0501033_0010894_3218_3922 194
12 3300049822 Ga0501035_0004474 Ga0501035_0004474_2796_3500 194
13 3300048925 Ga0496122_0023906 Ga0496122_0023906_3127_3750 195
14 3300047472 Ga0495686_0050670 Ga0495686_0050670_359_1093 197
15 3300048909 Ga0496106_0002856 Ga0496106_0002856_3595_4266 198
16 3300053121 Ga0500607_098475 Ga0500607_098475_27_659 198
17 3300053139 Ga0500568_0004394 Ga0500568_0004394_4241_4912 198
18 3300053160 Ga0500633_0000319 Ga0500633_0000319_2484_3155 198
19 3300053134 Ga0500658_0005723 Ga0500658_0005723_3463_4134 199
20 3300049582 Ga0501048_0212229 Ga0501048_0212229_603_1274 200
21 3300049584 Ga0501068_0065208 Ga0501068_0065208_1109_1780 200
22 3300049590 Ga0501074_0465720 Ga0501074_0465720_115_786 200
23 3300049744 Ga0501083_0154344 Ga0501083_0154344_518_1189 200
24 3300049822 Ga0501035_0367112 Ga0501035_0367112_17_688 200
25 3300009765 Ga0123341_1000018 Ga0123341_100001843 202
26 3300006186 Ga0075369_10132833 Ga0075369_101328332 203
27 3300048921 Ga0496118_0022693 Ga0496118_0022693_1488_2159 203
28 3300048925 Ga0496122_0042701 Ga0496122_0042701_2812_3483 203
29 3300048926 Ga0496123_0012772 Ga0496123_0012772_3393_4064 203
30 3300048928 Ga0496125_0056696 Ga0496125_0056696_236_907 203
31 3300050516 nmdc:mga0sz30_28639_c1 nmdc:mga0sz30_28639_c1_1293_1964 203
32 3300002773 JGI25152J39213_1003477 JGI25152J39213_10034773 204
33 3300003354 JGI25160J50197_1005979 JGI25160J50197_10059792 204
34 3300003775 Ga0055524_1006370 Ga0055524_10063705 204
35 3300005455 Ga0070663_100095516 Ga0070663_1000955163 204
36 3300005548 Ga0070665_101046759 Ga0070665_1010467591 204
37 3300009553 Ga0105249_10821368 Ga0105249_108213682 204
38 3300025294 Ga0209025_1004713 Ga0209025_10047134 204
39 3300025295 Ga0209564_1017225 Ga0209564_10172253 204
40 3300025299 Ga0209256_1004538 Ga0209256_100453810 204
41 3300025302 Ga0207426_1001853 Ga0207426_100185313 204
42 3300025903 Ga0207680_10299891 Ga0207680_102998912 204
43 3300026067 Ga0207678_10793202 Ga0207678_107932021 204
44 3300041505 Ga0451849_0644493 Ga0451849_0644493_310_981 204
45 3300048919 Ga0496116_0227398 Ga0496116_0227398_156_827 204
46 3300048924 Ga0496121_0071182 Ga0496121_0071182_271_942 204
47 3300048925 Ga0496122_0077289 Ga0496122_0077289_485_1156 204
48 3300048928 Ga0496125_0021764 Ga0496125_0021764_1753_2424 204
49 3300048929 Ga0496126_0198482 Ga0496126_0198482_725_1396 204
50 3300053156 Ga0500622_0001357 Ga0500622_0001357_9218_9889 205
51 3300047472 Ga0495686_0041530 Ga0495686_0041530_1834_2505 206
52 iso_pu_bacteria 8054460903 8054463248 206
53 3300002773 JGI25152J39213_1004457 JGI25152J39213_10044575 207
54 3300003215 JGI25153J46596_10006055 JGI25153J46596_100060552 207
55 3300003323 rootH1_10089023 rootH1_100890231 207
56 3300003354 JGI25160J50197_1042520 JGI25160J50197_10425202 207
57 3300003771 Ga0055526_1001847 Ga0055526_10018477 207
58 3300003792 Ga0055540_1007277 Ga0055540_10072774 207
59 3300005548 Ga0070665_100071341 Ga0070665_1000713414 207
60 3300025230 Ga0209563_108717 Ga0209563_1087172 207
61 3300025245 Ga0207425_1018478 Ga0207425_10184782 207
62 3300025258 Ga0209129_1001196 Ga0209129_10011962 207
63 3300025273 Ga0209673_1003529 Ga0209673_10035293 207
64 3300025295 Ga0209564_1002794 Ga0209564_10027944 207
65 3300025297 Ga0209758_1000666 Ga0209758_10006667 207
66 3300025299 Ga0209256_1007919 Ga0209256_10079195 207
67 3300025303 Ga0209051_1011437 Ga0209051_10114373 207
68 3300025304 Ga0209257_1008463 Ga0209257_10084635 207
69 3300028379 Ga0268266_10115318 Ga0268266_101153183 207
70 iso_pu_bacteria 2509276021 2509390148 207
71 iso_pu_bacteria 2509276033 2509447565 207
72 iso_pu_bacteria 2510065019 2510134395 207
73 iso_pu_bacteria 2510461076 2510895819 207
74 iso_pu_bacteria 2510917028 2511182679 207
75 iso_pu_bacteria 2510917030 2511195286 207
76 iso_pu_bacteria 2513237084 2513567493 207
77 iso_pu_bacteria 2513237093 2513632026 207
78 iso_pu_bacteria 2513237103 2513712503 207
79 iso_pu_bacteria 2513237138 2513867891 207
80 iso_pu_bacteria 2513237144 2513910618 207
81 iso_pu_bacteria 2513237146 2513928064 207
82 iso_pu_bacteria 2513237162 2514017874 207
83 iso_pu_bacteria 2515075009 2515113557 207
84 iso_pu_bacteria 2515154113 2515635271 207
85 iso_pu_bacteria 2515154114 2515643823 207
86 iso_pu_bacteria 2515154116 2515654911 207
87 iso_pu_bacteria 2516653077 2517037173 207
88 iso_pu_bacteria 2516653085 2517077511 207
89 iso_pu_bacteria 2517093000 2517096281 207
90 iso_pu_bacteria 2517287029 2517408140 207
91 iso_pu_bacteria 2529292951 2530646361 207
92 iso_pu_bacteria 2534681796 2535517263 207
93 iso_pu_bacteria 2537561587 2537873897 207
94 iso_pu_bacteria 2582581294 2585205076 207
95 iso_pu_bacteria 2582581298 2585225228 207
96 iso_pu_bacteria 2582581299 2585230705 207
97 iso_pu_bacteria 2582581304 2585259144 207
98 iso_pu_bacteria 2582581867 2585404577 207
99 iso_pu_bacteria 2585427526 2585524940 207
100 iso_pu_bacteria 2585427528 2585542757 207
101 iso_pu_bacteria 2585427529 2585547784 207
102 iso_pu_bacteria 2585427590 2585824885 207
103 iso_pu_bacteria 2585427593 2585841399 207
104 iso_pu_bacteria 2585427594 2585847730 207
105 iso_pu_bacteria 2599185170 2599421072 207
106 iso_pu_bacteria 2599185210 2599601949 207
107 iso_pu_bacteria 2617270742 2617384862 207
108 iso_pu_bacteria 2643221568 2643856461 207
109 iso_pu_bacteria 2643221582 2643920059 207
110 iso_pu_bacteria 2643221634 2644196690 207
111 iso_pu_bacteria 2643221643 2644237921 207
112 iso_pu_bacteria 2718217882 2719182273 207
113 iso_pu_bacteria 2718217927 2719386864 207
114 iso_pu_bacteria 2718217997 2719666600 207
115 iso_pu_bacteria 2718218009 2719732989 207
116 iso_pu_bacteria 2718218199 2720493020 207
117 iso_pu_bacteria 2718218232 2720614499 207
118 iso_pu_bacteria 2718218233 2720621273 207
119 iso_pu_bacteria 2718218235 2720632599 207
120 iso_pu_bacteria 2718218269 2720776323 207
121 iso_pu_bacteria 2718218363 2721148386 207
122 iso_pu_bacteria 2718218365 2721159772 207
123 iso_pu_bacteria 2718218366 2721165200 207
124 iso_pu_bacteria 2718218423 2721400587 207
125 iso_pu_bacteria 2721755514 2722841370 207
126 iso_pu_bacteria 2721755556 2723027912 207
127 iso_pu_bacteria 2721755684 2723561542 207
128 iso_pu_bacteria 2721755685 2723568171 207
129 iso_pu_bacteria 2721755809 2724039400 207
130 iso_pu_bacteria 2721755810 2724045745 207
131 iso_pu_bacteria 2721755819 2724090930 207
132 iso_pu_bacteria 2721755822 2724105436 207
133 iso_pu_bacteria 2721755823 2724111261 207
134 iso_pu_bacteria 2724679232 2725949236 207
135 iso_pu_bacteria 2728369352 2730108848 207
136 iso_pu_bacteria 2728369365 2730165508 207
137 iso_pu_bacteria 2728369397 2730299404 207
138 iso_pu_bacteria 2738541293 2738805450 207
139 iso_pu_bacteria 2738541333 2739033262 207
140 iso_pu_bacteria 2765235942 2766066310 207
141 iso_pu_bacteria 2791355256 2793293989 207
142 iso_pu_bacteria 2791355259 2793314335 207
143 iso_pu_bacteria 2791355260 2793323824 207
144 iso_pu_bacteria 2791355261 2793329728 207
145 iso_pu_bacteria 2791355262 2793335084 207
146 iso_pu_bacteria 2791355263 2793342328 207
147 iso_pu_bacteria 2791355264 2793349696 207
148 iso_pu_bacteria 2791355265 2793355347 207
149 iso_pu_bacteria 2791355266 2793363037 207
150 iso_pu_bacteria 2791355267 2793369906 207
151 iso_pu_bacteria 2802429605 2805929564 207
152 iso_pu_bacteria 2802429606 2805936869 207
153 iso_pu_bacteria 2802429633 2806047496 207
154 iso_pu_bacteria 2802429634 2806055154 207
155 iso_pu_bacteria 2802429635 2806063036 207
156 iso_pu_bacteria 2802429636 2806069771 207
157 iso_pu_bacteria 2802429637 2806075700 207
158 iso_pu_bacteria 2838016132 2838019909 207
159 iso_pu_bacteria 2838035591 2838041436 207
160 iso_pu_bacteria 2838042994 2838045641 207
161 iso_pu_bacteria 2838048938 2838052718 207
162 iso_pu_bacteria 2838061910 2838064975 207
163 iso_pu_bacteria 2838068647 2838069702 207
164 iso_pu_bacteria 2838661181 2838665827 207
165 iso_pu_bacteria 2838668709 2838671796 207
166 iso_pu_bacteria 2838675328 2838675487 207
167 iso_pu_bacteria 2838680041 2838683001 207
168 iso_pu_bacteria 2838686498 2838686611 207
169 iso_pu_bacteria 2838694306 2838698056 207
170 iso_pu_bacteria 2838701080 2838704475 207
171 iso_pu_bacteria 2838707686 2838711170 207
172 iso_pu_bacteria 2838714209 2838714368 207
173 iso_pu_bacteria 2838719591 2838721830 207
174 iso_pu_bacteria 2838724970 2838725129 207
175 iso_pu_bacteria 2838729681 2838734853 207
176 iso_pu_bacteria 2838742623 2838747468 207
177 iso_pu_bacteria 2841846520 2841848813 207
178 iso_pu_bacteria 2841851746 2841854440 207
179 iso_pu_bacteria 2841859092 2841862485 207
180 iso_pu_bacteria 2841864319 2841867413 207
181 iso_pu_bacteria 2842077413 2842079346 207
182 iso_pu_bacteria 2842110456 2842115549 207
183 iso_pu_bacteria 2842118031 2842118144 207
184 iso_pu_bacteria 2842124991 2842125156 207
185 iso_pu_bacteria 2842130223 2842130382 207
186 iso_pu_bacteria 2842146304 2842149693 207
187 iso_pu_bacteria 2842152218 2842154448 207
188 iso_pu_bacteria 2842156927 2842158541 207
189 iso_pu_bacteria 2842170452 2842170611 207
190 iso_pu_bacteria 2842175837 2842178068 207
191 iso_pu_bacteria 2842180545 2842182155 207
192 iso_pu_bacteria 2842187318 2842187477 207
193 iso_pu_bacteria 2842192696 2842195604 207
194 iso_pu_bacteria 2842205361 2842210927 207
195 iso_pu_bacteria 2842211629 2842211788 207
196 iso_pu_bacteria 2842217011 2842218388 207
197 iso_pu_bacteria 2842224351 2842226592 207
198 iso_pu_bacteria 2842229732 2842229845 207
199 iso_pu_bacteria 2842237096 2842240057 207
200 iso_pu_bacteria 2842243621 2842243734 207
201 iso_pu_bacteria 2842250916 2842254140 207
202 iso_pu_bacteria 2842257432 2842258181 207
203 iso_pu_bacteria 2842264693 2842268933 207
204 iso_pu_bacteria 2842271015 2842271851 207
205 iso_pu_bacteria 2842278818 2842284380 207
206 iso_pu_bacteria 2842291075 2842293008 207
207 iso_pu_bacteria 2842304105 2842305464 207
208 iso_pu_bacteria 2842311132 2842314186 207
209 iso_pu_bacteria 2842317721 2842319991 207
210 iso_pu_bacteria 2842341865 2842347615 207
211 iso_pu_bacteria 2842363717 2842368735 207
212 iso_pu_bacteria 2842370503 2842373630 207
213 iso_pu_bacteria 2842377471 2842379405 207
214 iso_pu_bacteria 2842384541 2842384654 207
215 iso_pu_bacteria 2842395702 2842400558 207
216 iso_pu_bacteria 2842402390 2842402522 207
217 iso_pu_bacteria 2842409023 2842410107 207
218 iso_pu_bacteria 2842415677 2842416755 207
219 iso_pu_bacteria 2842422224 2842423316 207
220 iso_pu_bacteria 2842428310 2842433145 207
221 iso_pu_bacteria 2842434925 2842439450 207
222 iso_pu_bacteria 2842441272 2842446079 207
223 iso_pu_bacteria 2842447887 2842449106 207
224 iso_pu_bacteria 2842462802 2842467316 207
225 iso_pu_bacteria 2842469257 2842474111 207
226 iso_pu_bacteria 2842489311 2842493468 207
227 iso_pu_bacteria 2842495871 2842497619 207
228 iso_pu_bacteria 2842515876 2842519269 207
229 iso_pu_bacteria 2844454524 2844457909 207
230 iso_pu_bacteria 2857516855 2857516981 207
231 iso_pu_bacteria 2899792073 2899795833 207
232 iso_pu_bacteria 2899803654 2899806697 207
233 iso_pu_bacteria 2919100787 2919105619 207
234 iso_pu_bacteria 2919114240 2919114399 207
235 iso_pu_bacteria 2919166419 2919169667 207
236 iso_pu_bacteria 2923556063 2923562141 207
237 iso_pu_bacteria 2926754445 2926755419 207
238 iso_pu_bacteria 2933006813 2933009093 207
239 iso_pu_bacteria 2933011516 2933014559 207
240 iso_pu_bacteria 2933016740 2933023690 207
241 iso_pu_bacteria 2933570622 2933571271 207
242 iso_pu_bacteria 2933586486 2933591964 207
243 iso_pu_bacteria 2933599457 2933600509 207
244 iso_pu_bacteria 2935894831 2935896561 207
245 iso_pu_bacteria 2936367885 2936371600 207
246 iso_pu_bacteria 2936375103 2936376973 207
247 iso_pu_bacteria 2936381700 2936383440 207
248 iso_pu_bacteria 2978969890 2978972029 207
249 iso_pu_bacteria 2984587000 2984590313 207
250 iso_pu_bacteria 2996887358 2996892557 207
251 iso_pu_bacteria 2996893221 2996898079 207
252 iso_pu_bacteria 3005409236 3005409365 207
253 iso_pu_bacteria 3005445848 3005448857 207
254 iso_pu_bacteria 639633055 639649602 207
255 iso_pu_bacteria 8003570095 8003571908 207
256 iso_pu_bacteria 8005258706 8005264816 207
257 iso_pu_bacteria 8005275841 8005281675 207
258 iso_pu_bacteria 8005282627 8005284366 207
259 iso_pu_bacteria 8005289223 8005289618 207
260 iso_pu_bacteria 8005321885 8005327084 207
261 iso_pu_bacteria 8005376324 8005382659 207
262 iso_pu_bacteria 8005382845 8005384622 207
263 iso_pu_bacteria 8005395548 8005395651 207
264 iso_pu_bacteria 8005430974 8005433888 207
265 iso_pu_bacteria 8005460587 8005464244 207
266 iso_pu_bacteria 8005484373 8005488805 207
267 iso_pu_bacteria 8005497431 8005501348 207
268 iso_pu_bacteria 8005542996 8005546083 207
269 iso_pu_bacteria 8005563573 8005568435 207
270 iso_pu_bacteria 8005570704 8005573028 207
271 iso_pu_bacteria 8005619151 8005622710 207
272 iso_pu_bacteria 8005626139 8005630225 207
273 iso_pu_bacteria 8005668836 8005672767 207
274 iso_pu_bacteria 8005695170 8005696770 207
275 iso_pu_bacteria 8018163183 8018163323 207
276 iso_pu_bacteria 8018176218 8018178979 207
277 iso_pu_bacteria 8024479707 8024486088 207
278 iso_pu_bacteria 8024486573 8024488451 207
279 iso_pu_bacteria 8024501048 8024501163 207
280 iso_pu_bacteria 8056375014 8056377040 207
281 iso_pu_bacteria 8056382006 8056387363 207
282 iso_pu_bacteria 8057874678 8057881899 207
283 iso_pu_bacteria 2582581308 2585279451 208
284 iso_pu_bacteria 2582581316 2585331055 208
285 iso_pu_bacteria 2585427527 2585531065 208
286 iso_pu_bacteria 2585427530 2585553014 208
287 iso_pu_bacteria 2615840626 2616307024 208
288 iso_pu_bacteria 2818991453 2819640016 208
289 3300002739 JGI25158J39367_1000924 JGI25158J39367_10009245 209
290 3300002987 JGI25159J45721_1000108 JGI25159J45721_100010828 209
291 3300002987 JGI25159J45721_1009532 JGI25159J45721_10095323 209
292 3300003354 JGI25160J50197_1000001 JGI25160J50197_1000001163 209
293 3300003354 JGI25160J50197_1042491 JGI25160J50197_10424912 209
294 3300003374 JGI25161J50226_1000001 JGI25161J50226_1000001605 209
295 3300003374 JGI25161J50226_1000163 JGI25161J50226_100016347 209
296 3300004625 Ga0055543_1000007 Ga0055543_100000732 209
297 3300004625 Ga0055543_1000220 Ga0055543_10002204 209
298 3300005262 Ga0065165_1000008 Ga0065165_1000008300 209
299 3300025208 Ga0209436_100272 Ga0209436_10027215 209
300 3300025284 Ga0209130_1000003 Ga0209130_1000003611 209
301 3300025284 Ga0209130_1000023 Ga0209130_1000023159 209
302 3300025302 Ga0207426_1000011 Ga0207426_1000011164 209
303 3300025302 Ga0207426_1000087 Ga0207426_1000087203 209
304 iso_pu_bacteria 2775507266 2778173404 209
305 iso_pu_bacteria 2842482326 2842483687 209
306 3300005331 Ga0070670_100006743 Ga0070670_1000067434 210
307 3300025925 Ga0207650_10001249 Ga0207650_100012495 210
308 3300046471 Ga0495650_0041528 Ga0495650_0041528_315_983 210
309 3300046507 Ga0495606_0177706 Ga0495606_0177706_87_755 210
310 3300048920 Ga0496117_0123208 Ga0496117_0123208_249_917 210
311 3300048921 Ga0496118_0047537 Ga0496118_0047537_277_945 210
312 iso_pu_bacteria 3005416602 3005418793 210
313 iso_pu_bacteria 8005314921 8005318315 210
314 3300002737 JGI25162J39368_1000149 JGI25162J39368_100014916 211
315 3300002773 JGI25152J39213_1005057 JGI25152J39213_10050573 211
316 3300002773 JGI25152J39213_1012615 JGI25152J39213_10126152 211
317 3300002773 JGI25152J39213_1019713 JGI25152J39213_10197132 211
318 3300002774 JGI25150J39212_1000091 JGI25150J39212_100009139 211
319 3300003187 JGI25151J46595_10000027 JGI25151J46595_1000002752 211
320 3300003187 JGI25151J46595_10000737 JGI25151J46595_100007374 211
321 3300003187 JGI25151J46595_10002713 JGI25151J46595_100027134 211
322 3300003187 JGI25151J46595_10003152 JGI25151J46595_1000315212 211
323 3300003215 JGI25153J46596_10025633 JGI25153J46596_100256332 211
324 3300003215 JGI25153J46596_10032025 JGI25153J46596_100320252 211
325 3300003354 JGI25160J50197_1000766 JGI25160J50197_100076616 211
326 3300003374 JGI25161J50226_1001467 JGI25161J50226_10014672 211
327 3300003578 Ga0006562J51391_1161272 Ga0006562J51391_11612721 211
328 3300003771 Ga0055526_1003775 Ga0055526_10037755 211
329 3300003775 Ga0055524_1001962 Ga0055524_10019627 211
330 3300003775 Ga0055524_1002479 Ga0055524_10024795 211
331 3300003775 Ga0055524_1016289 Ga0055524_10162891 211
332 3300003790 Ga0055528_1001291 Ga0055528_100129113 211
333 3300003790 Ga0055528_1001315 Ga0055528_10013155 211
334 3300003790 Ga0055528_1004820 Ga0055528_10048204 211
335 3300003792 Ga0055540_1000483 Ga0055540_10004832 211
336 3300003792 Ga0055540_1009779 Ga0055540_10097792 211
337 3300003792 Ga0055540_1012556 Ga0055540_10125563 211
338 3300004625 Ga0055543_1000108 Ga0055543_100010834 211
339 3300005262 Ga0065165_1010003 Ga0065165_10100031 211
340 3300005262 Ga0065165_1045051 Ga0065165_10450512 211
341 3300006038 Ga0075365_10002545 Ga0075365_1000254511 211
342 3300006042 Ga0075368_10016715 Ga0075368_100167153 211
343 3300006048 Ga0075363_100024716 Ga0075363_1000247163 211
344 3300006048 Ga0075363_100311845 Ga0075363_1003118451 211
345 3300006177 Ga0075362_10001438 Ga0075362_100014384 211
346 3300006178 Ga0075367_10019538 Ga0075367_100195384 211
347 3300006186 Ga0075369_10013658 Ga0075369_100136584 211
348 3300006186 Ga0075369_10105239 Ga0075369_101052393 211
349 3300006195 Ga0075366_10008481 Ga0075366_100084812 211
350 3300006353 Ga0075370_10000296 Ga0075370_1000029616 211
351 3300006948 Ga0099826_10000404 Ga0099826_100004045 211
352 3300006948 Ga0099826_10010403 Ga0099826_1001040310 211
353 3300009036 Ga0105244_10225682 Ga0105244_102256821 211
354 3300009766 Ga0123342_1030001 Ga0123342_10300012 211
355 3300013102 Ga0157371_10009685 Ga0157371_100096856 211
356 3300013105 Ga0157369_10253917 Ga0157369_102539172 211
357 3300013105 Ga0157369_10960494 Ga0157369_109604942 211
358 3300025233 Ga0209437_100058 Ga0209437_100058125 211
359 3300025245 Ga0207425_1000043 Ga0207425_100004350 211
360 3300025245 Ga0207425_1000495 Ga0207425_100049524 211
361 3300025245 Ga0207425_1010927 Ga0207425_10109272 211
362 3300025246 Ga0209646_1006128 Ga0209646_10061282 211
363 3300025258 Ga0209129_1000072 Ga0209129_1000072144 211
364 3300025258 Ga0209129_1000128 Ga0209129_100012898 211
365 3300025258 Ga0209129_1000702 Ga0209129_10007023 211
366 3300025258 Ga0209129_1000810 Ga0209129_100081016 211
367 3300025261 Ga0209233_1000149 Ga0209233_100014959 211
368 3300025273 Ga0209673_1000125 Ga0209673_1000125111 211
369 3300025273 Ga0209673_1000256 Ga0209673_100025647 211
370 3300025273 Ga0209673_1001106 Ga0209673_10011062 211
371 3300025273 Ga0209673_1001124 Ga0209673_100112416 211
372 3300025273 Ga0209673_1003945 Ga0209673_10039451 211
373 3300025284 Ga0209130_1018831 Ga0209130_10188312 211
374 3300025284 Ga0209130_1026880 Ga0209130_10268802 211
375 3300025291 Ga0209675_1037288 Ga0209675_10372882 211
376 3300025292 Ga0209676_1017938 Ga0209676_10179382 211
377 3300025292 Ga0209676_1023533 Ga0209676_10235333 211
378 3300025294 Ga0209025_1000120 Ga0209025_1000120144 211
379 3300025294 Ga0209025_1000154 Ga0209025_100015419 211
380 3300025294 Ga0209025_1000451 Ga0209025_100045111 211
381 3300025294 Ga0209025_1000537 Ga0209025_100053739 211
382 3300025294 Ga0209025_1009663 Ga0209025_10096632 211
383 3300025294 Ga0209025_1010434 Ga0209025_10104344 211
384 3300025294 Ga0209025_1107509 Ga0209025_11075091 211
385 3300025295 Ga0209564_1000259 Ga0209564_100025954 211
386 3300025295 Ga0209564_1000778 Ga0209564_100077840 211
387 3300025295 Ga0209564_1012596 Ga0209564_10125962 211
388 3300025295 Ga0209564_1013716 Ga0209564_10137164 211
389 3300025297 Ga0209758_1000111 Ga0209758_1000111145 211
390 3300025297 Ga0209758_1001689 Ga0209758_100168910 211
391 3300025297 Ga0209758_1001921 Ga0209758_100192119 211
392 3300025297 Ga0209758_1013196 Ga0209758_10131963 211
393 3300025297 Ga0209758_1053509 Ga0209758_10535091 211
394 3300025297 Ga0209758_1105598 Ga0209758_11055982 211
395 3300025299 Ga0209256_1000283 Ga0209256_100028344 211
396 3300025299 Ga0209256_1000669 Ga0209256_100066933 211
397 3300025299 Ga0209256_1001412 Ga0209256_10014124 211
398 3300025299 Ga0209256_1010497 Ga0209256_10104974 211
399 3300025302 Ga0207426_1000208 Ga0207426_1000208138 211
400 3300025303 Ga0209051_1000434 Ga0209051_100043435 211
401 3300025303 Ga0209051_1002537 Ga0209051_100253716 211
402 3300025303 Ga0209051_1011745 Ga0209051_10117454 211
403 3300025303 Ga0209051_1018130 Ga0209051_10181302 211
404 3300025303 Ga0209051_1046682 Ga0209051_10466822 211
405 3300025303 Ga0209051_1076025 Ga0209051_10760251 211
406 3300027312 Ga0209371_1001488 Ga0209371_10014882 211
407 3300027312 Ga0209371_1031306 Ga0209371_10313062 211
408 3300027666 Ga0209282_1005835 Ga0209282_10058355 211
409 3300027666 Ga0209282_1008576 Ga0209282_10085762 211
410 3300027866 Ga0209813_10028992 Ga0209813_100289923 211
411 3300028794 Ga0307515_10016158 Ga0307515_1001615811 211
412 3300030500 Ga0268256_1035540 Ga0268256_10355402 211
413 3300030744 Ga0316181_1077312 Ga0316181_10773124 211
414 3300031456 Ga0307513_10017820 Ga0307513_100178206 211
415 3300031731 Ga0307405_10006331 Ga0307405_100063312 211
416 3300031852 Ga0307410_10422158 Ga0307410_104221581 211
417 3300031901 Ga0307406_10012688 Ga0307406_100126882 211
418 3300031911 Ga0307412_10011713 Ga0307412_100117136 211
419 3300041406 Ga0439439_0005679 Ga0439439_0005679_949_1620 211
420 3300041413 Ga0439465_0006683 Ga0439465_0006683_674_1345 211
421 3300041441 Ga0451787_506157 Ga0451787_506157_45_716 211
422 3300041451 Ga0451791_1385197 Ga0451791_1385197_45_716 211
423 3300041456 Ga0451795_1336264 Ga0451795_1336264_499_1170 211
424 3300041486 Ga0451807_0807317 Ga0451807_0807317_368_1039 211
425 3300041491 Ga0451833_1409442 Ga0451833_1409442_875_1546 211
426 3300041494 Ga0451837_0356305 Ga0451837_0356305_52_723 211
427 3300041494 Ga0451837_1426596 Ga0451837_1426596_674_1345 211
428 3300041496 Ga0451839_0519812 Ga0451839_0519812_1437_2108 211
429 3300041498 Ga0451841_0067188 Ga0451841_0067188_3544_4215 211
430 3300041498 Ga0451841_0886176 Ga0451841_0886176_168_839 211
431 3300041501 Ga0451845_0941672 Ga0451845_0941672_120_791 211
432 3300041503 Ga0451847_0391898 Ga0451847_0391898_574_1245 211
433 3300041505 Ga0451849_0478376 Ga0451849_0478376_210_881 211
434 3300041507 Ga0451851_0359614 Ga0451851_0359614_522_1193 211
435 3300041507 Ga0451851_0362762 Ga0451851_0362762_302_973 211
436 3300041507 Ga0451851_0997622 Ga0451851_0997622_377_1048 211
437 3300041510 Ga0451854_31556 Ga0451854_31556_206_877 211
438 3300041511 Ga0451855_0123925 Ga0451855_0123925_331_1002 211
439 3300041512 Ga0451853_2441200 Ga0451853_2441200_1622_2293 211
440 3300042006 Ga0439432_122620 Ga0439432_122620_63_734 211
441 3300042007 Ga0439449_0014977 Ga0439449_0014977_106_777 211
442 3300042007 Ga0439449_0091240 Ga0439449_0091240_297_968 211
443 3300046452 Ga0495617_156741 Ga0495617_156741_40_711 211
444 3300046453 Ga0495627_076257 Ga0495627_076257_48_719 211
445 3300046454 Ga0495592_0185871 Ga0495592_0185871_719_1390 211
446 3300046459 Ga0495629_0011633 Ga0495629_0011633_5069_5740 211
447 3300046460 Ga0495638_0002684 Ga0495638_0002684_2176_2847 211
448 3300046462 Ga0495651_0426252 Ga0495651_0426252_130_801 211
449 3300046471 Ga0495650_0076648 Ga0495650_0076648_440_1111 211
450 3300046471 Ga0495650_0093763 Ga0495650_0093763_217_888 211
451 3300046473 Ga0495582_0350850 Ga0495582_0350850_77_748 211
452 3300046474 Ga0495605_0024293 Ga0495605_0024293_2076_2747 211
453 3300046474 Ga0495605_0065354 Ga0495605_0065354_298_969 211
454 3300046474 Ga0495605_0142592 Ga0495605_0142592_311_982 211
455 3300046474 Ga0495605_0171700 Ga0495605_0171700_75_746 211
456 3300046492 Ga0495585_0010500 Ga0495585_0010500_2056_2727 211
457 3300046492 Ga0495585_0016828 Ga0495585_0016828_2942_3613 211
458 3300046492 Ga0495585_0042594 Ga0495585_0042594_1447_2118 211
459 3300046500 Ga0495596_0025969 Ga0495596_0025969_281_952 211
460 3300046501 Ga0495607_0036345 Ga0495607_0036345_1742_2413 211
461 3300046501 Ga0495607_0090988 Ga0495607_0090988_771_1442 211
462 3300046506 Ga0495583_0008644 Ga0495583_0008644_2142_2813 211
463 3300046506 Ga0495583_0017563 Ga0495583_0017563_1391_2062 211
464 3300046506 Ga0495583_0076224 Ga0495583_0076224_194_865 211
465 3300046507 Ga0495606_0014480 Ga0495606_0014480_3242_3913 211
466 3300046507 Ga0495606_0090605 Ga0495606_0090605_792_1463 211
467 3300046507 Ga0495606_0200008 Ga0495606_0200008_453_1124 211
468 3300046512 Ga0495610_0011881 Ga0495610_0011881_2339_3010 211
469 3300046512 Ga0495610_0133978 Ga0495610_0133978_58_729 211
470 3300046513 Ga0495616_0076540 Ga0495616_0076540_624_1295 211
471 3300046514 Ga0495618_0337425 Ga0495618_0337425_209_880 211
472 3300046515 Ga0495620_0019701 Ga0495620_0019701_2480_3151 211
473 3300046515 Ga0495620_0109817 Ga0495620_0109817_360_1031 211
474 3300046518 Ga0495631_0002418 Ga0495631_0002418_2136_2807 211
475 3300046518 Ga0495631_0026930 Ga0495631_0026930_772_1443 211
476 3300046519 Ga0495632_0011295 Ga0495632_0011295_3420_4091 211
477 3300046519 Ga0495632_0011535 Ga0495632_0011535_2026_2697 211
478 3300046519 Ga0495632_0106936 Ga0495632_0106936_172_843 211
479 3300046522 Ga0495643_0042539 Ga0495643_0042539_1703_2374 211
480 3300046522 Ga0495643_0047962 Ga0495643_0047962_189_860 211
481 3300046524 Ga0495648_0028085 Ga0495648_0028085_1793_2464 211
482 3300046524 Ga0495648_0029443 Ga0495648_0029443_1757_2428 211
483 3300046524 Ga0495648_0177648 Ga0495648_0177648_193_864 211
484 3300046529 Ga0495652_0500993 Ga0495652_0500993_34_705 211
485 3300046538 Ga0495609_0013402 Ga0495609_0013402_3138_3809 211
486 3300046538 Ga0495609_0044374 Ga0495609_0044374_1308_1979 211
487 3300046538 Ga0495609_0230008 Ga0495609_0230008_52_723 211
488 3300046542 Ga0495597_0021425 Ga0495597_0021425_2032_2703 211
489 3300046558 Ga0495633_0033410 Ga0495633_0033410_659_1330 211
490 3300046616 Ga0495668_0011366 Ga0495668_0011366_2018_2689 211
491 3300046616 Ga0495668_0126107 Ga0495668_0126107_340_1011 211
492 3300046648 Ga0495611_0015171 Ga0495611_0015171_398_1069 211
493 3300046648 Ga0495611_0150621 Ga0495611_0150621_64_735 211
494 3300046660 Ga0495625_0014370 Ga0495625_0014370_2198_2869 211
495 3300046660 Ga0495625_0093902 Ga0495625_0093902_154_825 211
496 3300046660 Ga0495625_0223977 Ga0495625_0223977_304_975 211
497 3300046660 Ga0495625_0295102 Ga0495625_0295102_301_972 211
498 3300046663 Ga0495635_0095787 Ga0495635_0095787_527_1198 211
499 3300046665 Ga0495661_0052942 Ga0495661_0052942_1249_1920 211
500 3300046665 Ga0495661_0230471 Ga0495661_0230471_119_790 211
501 3300046675 Ga0495657_0130399 Ga0495657_0130399_235_906 211
502 3300046691 Ga0495670_0007974 Ga0495670_0007974_3088_3759 211
503 3300046691 Ga0495670_0044321 Ga0495670_0044321_1316_1987 211
504 3300046691 Ga0495670_0081383 Ga0495670_0081383_190_861 211
505 3300046692 Ga0495671_0078571 Ga0495671_0078571_104_775 211
506 3300046692 Ga0495671_0088405 Ga0495671_0088405_382_1053 211
507 3300046694 Ga0495649_0030912 Ga0495649_0030912_56_727 211
508 3300046810 Ga0495660_0011239 Ga0495660_0011239_1372_2043 211
509 3300046810 Ga0495660_0075985 Ga0495660_0075985_245_916 211
510 3300047317 Ga0495604_0009351 Ga0495604_0009351_1932_2603 211
511 3300047318 Ga0495636_0020118 Ga0495636_0020118_762_1433 211
512 3300047320 Ga0495672_0029103 Ga0495672_0029103_1909_2580 211
513 3300047443 Ga0495687_089111 Ga0495687_089111_75_746 211
514 3300047469 Ga0495673_0057849 Ga0495673_0057849_464_1135 211
515 3300047469 Ga0495673_0179321 Ga0495673_0179321_112_783 211
516 3300047470 Ga0495681_0014458 Ga0495681_0014458_1996_2667 211
517 3300047470 Ga0495681_0172625 Ga0495681_0172625_71_742 211
518 3300047472 Ga0495686_0019073 Ga0495686_0019073_1034_1705 211
519 3300047472 Ga0495686_0041073 Ga0495686_0041073_1043_1714 211
520 3300048090 Ga0495615_0022829 Ga0495615_0022829_395_1066 211
521 3300048091 Ga0495626_0034213 Ga0495626_0034213_512_1183 211
522 3300048905 Ga0496102_0394871 Ga0496102_0394871_198_869 211
523 3300048907 Ga0496104_0465704 Ga0496104_0465704_293_964 211
524 3300048913 Ga0496110_0427473 Ga0496110_0427473_91_762 211
525 3300048914 Ga0496111_0016074 Ga0496111_0016074_2729_3400 211
526 3300048919 Ga0496116_0000105 Ga0496116_0000105_60002_60673 211
527 3300048919 Ga0496116_0006925 Ga0496116_0006925_2738_3409 211
528 3300048919 Ga0496116_0007875 Ga0496116_0007875_7134_7805 211
529 3300048919 Ga0496116_0040555 Ga0496116_0040555_414_1085 211
530 3300048919 Ga0496116_0067855 Ga0496116_0067855_753_1424 211
531 3300048919 Ga0496116_0068104 Ga0496116_0068104_168_839 211
532 3300048919 Ga0496116_0202769 Ga0496116_0202769_233_904 211
533 3300048920 Ga0496117_0016743 Ga0496117_0016743_3340_4011 211
534 3300048920 Ga0496117_0039280 Ga0496117_0039280_111_782 211
535 3300048920 Ga0496117_0227723 Ga0496117_0227723_122_793 211
536 3300048921 Ga0496118_0014507 Ga0496118_0014507_2846_3517 211
537 3300048921 Ga0496118_0021462 Ga0496118_0021462_2866_3537 211
538 3300048921 Ga0496118_0154264 Ga0496118_0154264_87_758 211
539 3300048921 Ga0496118_0187056 Ga0496118_0187056_78_749 211
540 3300048922 Ga0496119_0033843 Ga0496119_0033843_1451_2122 211
541 3300048922 Ga0496119_0041128 Ga0496119_0041128_238_909 211
542 3300048922 Ga0496119_0121878 Ga0496119_0121878_396_1067 211
543 3300048922 Ga0496119_0248144 Ga0496119_0248144_133_804 211
544 3300048924 Ga0496121_0011993 Ga0496121_0011993_4922_5593 211
545 3300048924 Ga0496121_0032437 Ga0496121_0032437_2476_3147 211
546 3300048924 Ga0496121_0035631 Ga0496121_0035631_1778_2449 211
547 3300048924 Ga0496121_0043024 Ga0496121_0043024_800_1471 211
548 3300048924 Ga0496121_0105311 Ga0496121_0105311_1260_1931 211
549 3300048924 Ga0496121_0210834 Ga0496121_0210834_465_1136 211
550 3300048924 Ga0496121_0295766 Ga0496121_0295766_91_762 211
551 3300048924 Ga0496121_0449160 Ga0496121_0449160_115_786 211
552 3300048925 Ga0496122_0015649 Ga0496122_0015649_5033_5704 211
553 3300048925 Ga0496122_0027756 Ga0496122_0027756_1883_2554 211
554 3300048925 Ga0496122_0059616 Ga0496122_0059616_365_1036 211
555 3300048925 Ga0496122_0203860 Ga0496122_0203860_63_734 211
556 3300048926 Ga0496123_0004716 Ga0496123_0004716_1448_2119 211
557 3300048926 Ga0496123_0019400 Ga0496123_0019400_1952_2623 211
558 3300048926 Ga0496123_0054424 Ga0496123_0054424_1717_2388 211
559 3300048926 Ga0496123_0062112 Ga0496123_0062112_1523_2194 211
560 3300048926 Ga0496123_0137730 Ga0496123_0137730_431_1102 211
561 3300048927 Ga0496124_0000067 Ga0496124_0000067_68568_69239 211
562 3300048927 Ga0496124_0006891 Ga0496124_0006891_9998_10669 211
563 3300048927 Ga0496124_0019469 Ga0496124_0019469_2739_3410 211
564 3300048927 Ga0496124_0034333 Ga0496124_0034333_1508_2179 211
565 3300048927 Ga0496124_0047233 Ga0496124_0047233_2276_2947 211
566 3300048927 Ga0496124_0103540 Ga0496124_0103540_1479_2150 211
567 3300048927 Ga0496124_0120303 Ga0496124_0120303_557_1228 211
568 3300048927 Ga0496124_0209505 Ga0496124_0209505_117_788 211
569 3300048927 Ga0496124_0228705 Ga0496124_0228705_138_809 211
570 3300048927 Ga0496124_0336646 Ga0496124_0336646_280_951 211
571 3300048928 Ga0496125_0005400 Ga0496125_0005400_3529_4200 211
572 3300048928 Ga0496125_0048793 Ga0496125_0048793_2739_3410 211
573 3300048928 Ga0496125_0222756 Ga0496125_0222756_60_731 211
574 3300048928 Ga0496125_0239791 Ga0496125_0239791_229_900 211
575 3300048928 Ga0496125_0258921 Ga0496125_0258921_163_834 211
576 3300048929 Ga0496126_0000780 Ga0496126_0000780_49030_49701 211
577 3300048929 Ga0496126_0074643 Ga0496126_0074643_2072_2743 211
578 3300048929 Ga0496126_0366645 Ga0496126_0366645_337_1008 211
579 3300049459 Ga0495678_019113 Ga0495678_019113_380_1051 211
580 3300049459 Ga0495678_046186 Ga0495678_046186_104_775 211
581 3300049459 Ga0495678_051013 Ga0495678_051013_56_727 211
582 3300049460 Ga0495682_0058279 Ga0495682_0058279_58_729 211
583 3300050489 nmdc:mga03683_60837_c1 nmdc:mga03683_60837_c1_696_1367 211
584 3300050490 nmdc:mga03n38_55256_c1 nmdc:mga03n38_55256_c1_878_1549 211
585 3300050492 nmdc:mga0yw44_42139_c1 nmdc:mga0yw44_42139_c1_1543_2214 211
586 3300050493 nmdc:mga0k408_15622_c1 nmdc:mga0k408_15622_c1_1587_2258 211
587 3300050494 nmdc:mga06z11_63609_c1 nmdc:mga06z11_63609_c1_986_1657 211
588 3300050495 nmdc:mga04h51_39772_c1 nmdc:mga04h51_39772_c1_314_985 211
589 3300050496 nmdc:mga07m45_31638_c1 nmdc:mga07m45_31638_c1_1204_1875 211
590 3300050516 nmdc:mga0sz30_126726_c1 nmdc:mga0sz30_126726_c1_403_1074 211
591 3300050516 nmdc:mga0sz30_7809_c1 nmdc:mga0sz30_7809_c1_1850_2521 211
592 3300053088 Ga0500644_0141598 Ga0500644_0141598_235_906 211
593 3300053105 Ga0500557_009931 Ga0500557_009931_422_1093 211
594 3300053108 Ga0500562_028625 Ga0500562_028625_471_1142 211
595 3300053109 Ga0500569_001416 Ga0500569_001416_3730_4401 211
596 3300053109 Ga0500569_020295 Ga0500569_020295_868_1539 211
597 3300053111 Ga0500572_009765 Ga0500572_009765_105_776 211
598 3300053118 Ga0500594_0002866 Ga0500594_0002866_1238_1909 211
599 3300053123 Ga0500614_071210 Ga0500614_071210_203_874 211
600 3300053134 Ga0500658_0285960 Ga0500658_0285960_17_688 211
601 3300053135 Ga0500659_0113461 Ga0500659_0113461_180_851 211
602 3300053139 Ga0500568_0009417 Ga0500568_0009417_1871_2542 211
603 3300053148 Ga0500590_031710 Ga0500590_031710_1004_1675 211
604 3300053152 Ga0500606_084255 Ga0500606_084255_218_889 211
605 3300053153 Ga0500616_0020975 Ga0500616_0020975_1612_2283 211
606 3300053156 Ga0500622_0231734 Ga0500622_0231734_110_781 211
607 3300053157 Ga0500624_001660 Ga0500624_001660_219_890 211
608 3300053158 Ga0500627_0052792 Ga0500627_0052792_471_1142 211
609 3300053161 Ga0500634_0000243 Ga0500634_0000243_5993_6664 211
610 3300053177 Ga0500636_0000374 Ga0500636_0000374_3010_3681 211
611 3300053177 Ga0500636_0000443 Ga0500636_0000443_7700_8371 211
612 iso_pu_bacteria 2818991448 2819609905 211
613 iso_pu_bacteria 8005645114 8005645819 211
614 3300005548 Ga0070665_100363096 Ga0070665_1003630963 212
615 3300005563 Ga0068855_100223595 Ga0068855_1002235953 212
616 3300005616 Ga0068852_100050243 Ga0068852_1000502434 212
617 3300005834 Ga0068851_10215264 Ga0068851_102152641 212
618 3300025253 Ga0209677_100493 Ga0209677_10049316 212
619 3300025261 Ga0209233_1000137 Ga0209233_1000137112 212
620 3300025913 Ga0207695_10000037 Ga0207695_10000037111 212
621 3300025914 Ga0207671_10000080 Ga0207671_10000080112 212
622 3300025935 Ga0207709_10873955 Ga0207709_108739551 212
623 3300026142 Ga0207698_10151060 Ga0207698_101510603 212
624 3300028379 Ga0268266_10220485 Ga0268266_102204852 212
625 3300053177 Ga0500636_0170806 Ga0500636_0170806_406_1080 212
626 iso_pu_bacteria 2510917022 2511131950 212
627 iso_pu_bacteria 2524023209 2524459034 212
628 iso_pu_bacteria 2582581307 2585273990 212
629 iso_pu_bacteria 2582581315 2585322889 212
630 iso_pu_bacteria 2585427531 2585560441 212
631 iso_pu_bacteria 2585427608 2585898634 212
632 iso_pu_bacteria 2585427609 2585903777 212
633 iso_pu_bacteria 2585428125 2587981104 212
634 iso_pu_bacteria 2615840698 2616554639 212
635 iso_pu_bacteria 2667528174 2671111882 212
636 iso_pu_bacteria 2838029111 2838033218 212
637 iso_pu_bacteria 2842298080 2842298386 212
638 iso_pu_bacteria 2842357229 2842360398 212
639 iso_pu_bacteria 2842475841 2842480117 212
640 iso_pu_bacteria 2842502639 2842505098 212
641 iso_pu_bacteria 2842509118 2842510401 212
642 iso_pu_bacteria 2852387548 2852390817 212
643 iso_pu_bacteria 8005682033 8005682499 212
644 iso_pu_bacteria 8046767195 8046772620 212
645 3300003214 JGI25165J46597_1001844 JGI25165J46597_10018447 213
646 3300025256 Ga0209759_1026858 Ga0209759_10268582 213
647 iso_pu_bacteria 2919408235 2919410383 213
648 3300025254 Ga0209148_1005477 Ga0209148_10054773 214
649 3300003316 rootH1_10000492 rootH1_100004924 215
650 3300003320 rootH2_10065851 rootH2_100658512 215
651 3300003322 rootL2_10069708 rootL2_100697083 215
652 3300003323 rootH1_10147282 rootH1_101472824 215
653 3300001979 JGI24740J21852_10000220 JGI24740J21852_1000022020 216
654 3300002704 JGI25155J39150_1000066 JGI25155J39150_100006615 216
655 3300002705 JGI25156J39149_1000075 JGI25156J39149_100007530 216
656 3300002738 JGI25154J39366_1000075 JGI25154J39366_100007531 216
657 3300002741 JGI25157J39369_1000051 JGI25157J39369_100005168 216
658 3300002741 JGI25157J39369_1000077 JGI25157J39369_100007742 216
659 3300003214 JGI25165J46597_1000781 JGI25165J46597_100078110 216
660 3300003316 rootH1_10000491 rootH1_100004912 216
661 3300005614 Ga0068856_100018348 Ga0068856_1000183483 216
662 3300006048 Ga0075363_100286327 Ga0075363_1002863272 216
663 3300009093 Ga0105240_10000014 Ga0105240_10000014110 216
664 3300009177 Ga0105248_10235320 Ga0105248_102353202 216
665 3300009545 Ga0105237_10000685 Ga0105237_1000068537 216
666 3300010375 Ga0105239_10001960 Ga0105239_1000196012 216
667 3300013104 Ga0157370_10000015 Ga0157370_10000015110 216
668 3300015262 Ga0182007_10001042 Ga0182007_100010423 216
669 3300025206 Ga0209435_100005 Ga0209435_100005460 216
670 3300025233 Ga0209437_100060 Ga0209437_100060135 216
671 3300025246 Ga0209646_1000011 Ga0209646_1000011460 216
672 3300025250 Ga0209026_1000008 Ga0209026_1000008460 216
673 3300025256 Ga0209759_1000004 Ga0209759_1000004460 216
674 3300025261 Ga0209233_1000160 Ga0209233_100016096 216
675 3300027312 Ga0209371_1002322 Ga0209371_10023223 216
676 3300030500 Ga0268256_1002674 Ga0268256_10026743 216
677 3300044694 Ga0466963_0067613 Ga0466963_0067613_69_755 216
678 3300044765 Ga0466970_0038631 Ga0466970_0038631_484_1170 216
679 3300044842 Ga0466957_0036296 Ga0466957_0036296_243_929 216
680 3300045049 Ga0466959_0256697 Ga0466959_0256697_377_1063 216
681 3300045836 Ga0466958_0103078 Ga0466958_0103078_670_1356 216
682 3300045976 Ga0466967_0376794 Ga0466967_0376794_440_1126 216
683 3300046507 Ga0495606_0005913 Ga0495606_0005913_6883_7599 216
684 3300046507 Ga0495606_0219110 Ga0495606_0219110_142_828 216
685 3300047472 Ga0495686_0007362 Ga0495686_0007362_4141_4860 216
686 3300048903 Ga0496100_0258121 Ga0496100_0258121_166_852 216
687 3300048904 Ga0496101_0041771 Ga0496101_0041771_2465_3151 216
688 3300048905 Ga0496102_0010148 Ga0496102_0010148_6619_7305 216
689 3300048906 Ga0496103_0039134 Ga0496103_0039134_208_894 216
690 3300048910 Ga0496107_0082556 Ga0496107_0082556_236_922 216
691 3300048916 Ga0496113_0422117 Ga0496113_0422117_27_713 216
692 3300048919 Ga0496116_0006284 Ga0496116_0006284_3646_4332 216
693 3300048920 Ga0496117_0006083 Ga0496117_0006083_10971_11657 216
694 3300048920 Ga0496117_0095099 Ga0496117_0095099_126_812 216
695 3300048920 Ga0496117_0251453 Ga0496117_0251453_168_854 216
696 3300048921 Ga0496118_0006836 Ga0496118_0006836_10971_11657 216
697 3300048922 Ga0496119_0009897 Ga0496119_0009897_919_1605 216
698 3300048922 Ga0496119_0010784 Ga0496119_0010784_5492_6178 216
699 3300048922 Ga0496119_0071226 Ga0496119_0071226_1233_1919 216
700 3300048923 Ga0496120_0014163 Ga0496120_0014163_1047_1733 216
701 3300048923 Ga0496120_0141752 Ga0496120_0141752_436_1122 216
702 3300048924 Ga0496121_0007360 Ga0496121_0007360_6492_7178 216
703 3300048924 Ga0496121_0029609 Ga0496121_0029609_3883_4614 216
704 3300048924 Ga0496121_0044299 Ga0496121_0044299_2972_3658 216
705 3300048925 Ga0496122_0008642 Ga0496122_0008642_6807_7493 216
706 3300048925 Ga0496122_0090298 Ga0496122_0090298_1353_2039 216
707 3300048926 Ga0496123_0011311 Ga0496123_0011311_274_960 216
708 3300048926 Ga0496123_0154024 Ga0496123_0154024_327_1013 216
709 3300048927 Ga0496124_0029118 Ga0496124_0029118_3194_3880 216
710 3300048927 Ga0496124_0032066 Ga0496124_0032066_2738_3424 216
711 3300048928 Ga0496125_0055340 Ga0496125_0055340_355_1041 216
712 3300048928 Ga0496125_0149009 Ga0496125_0149009_658_1344 216
713 3300048928 Ga0496125_0192010 Ga0496125_0192010_280_966 216
714 3300049822 Ga0501035_0246602 Ga0501035_0246602_35_721 216
715 3300053125 Ga0500618_048414 Ga0500618_048414_91_777 216
716 3300053137 Ga0500561_0093855 Ga0500561_0093855_53_739 216
717 3300053177 Ga0500636_0244814 Ga0500636_0244814_68_754 216
718 3300053735 Ga0500596_024697 Ga0500596_024697_43_729 216
719 iso_pu_bacteria 2643221599 2644002940 216
720 iso_pu_bacteria 3005452660 3005455077 216

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01730

UreF

UreF

61

201

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jc4-assembly2.cif.gz_C crystal structure of the urease accessory protein uref from klebsiella pneumoniae 0.8233 12 191
3cxn-assembly2.cif.gz_C structure of the urease accessory protein uref from helicobacter pylori 0.7927 3 192
8hc1-assembly1.cif.gz_H cryoem structure of helicobacter pylori urefd/urease complex 0.784 11 216
8hc1-assembly1.cif.gz_H cryoem structure of helicobacter pylori urefd/urease complex 0.7475 11 216
4hi0-assembly1.cif.gz_C crystal structure of helicobacter pylori urease accessory protein uref/h/g complex 0.7447 1 216
ID Description Score Start End Superfamily
af_Q2G2K7_3_207_1.10.4190.10 Mainly Alpha;Orthogonal Bundle;Urease accessory protein UreF;Urease accessory protein UreF 0.8377 13 193 1.10.4190.10
af_P9WFE5_1_189_1.10.4190.10 Mainly Alpha;Orthogonal Bundle;Urease accessory protein UreF;Urease accessory protein UreF 0.8082 11 187 1.10.4190.10
af_O14016_3_208_1.10.4190.10 Mainly Alpha;Orthogonal Bundle;Urease accessory protein UreF;Urease accessory protein UreF 0.8014 11 189 1.10.4190.10
3cxnC00 Mainly Alpha;Orthogonal Bundle;Urease accessory protein UreF;Urease accessory protein UreF 0.7704 3 192 1.10.4190.10
af_P9WFE5_1_189_1.10.4190.10 Mainly Alpha;Orthogonal Bundle;Urease accessory protein UreF;Urease accessory protein UreF 0.7577 11 187 1.10.4190.10
ID Description Score Start End GO Terms
AF-A0A4S0V640-F1-model_v4 Urease accessory protein UreF 0.9258 27 157 GO:0016151
AF-A0A4Q3S398-F1-model_v4 Urease accessory protein UreF 0.8939 12 162 GO:0016151
AF-A0A4S0V640-F1-model_v4 Urease accessory protein UreF 0.8931 27 157 GO:0016151
AF-A0A258LC10-F1-model_v4 Urease accessory protein UreF 0.8871 10 196 GO:0016151
AF-A0A2N3BRD3-F1-model_v4 Urease accessory protein UreF 0.879 11 188 GO:0016151

Feature Viewer

pLDDT pTM Quality
79.73 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map