F477275

General Info

Members Datasets Scaffolds Average Seq Length
719 244 1438 106

Family's Representative Sequence

Representative Sequence 3300049593|Ga0501077_0028442|Ga0501077_0028442_2423_2779
Length 118
Sequence VTSASIAAFSPTLSGVLRKRRFADLVNRQLDLFEEDERELLAEAAEADARWTHASAEESEELYGDYQLVVDAIAERLLDVRETYAASLDETTADQYRTTFDAAARKRFRRFASLLDGE

Samples

Sample ID Description Type Environment
1 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
159 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
160 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
161 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
162 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
163 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
164 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
165 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
166 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
167 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
168 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
169 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
172 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
175 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
176 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
177 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
178 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
179 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
180 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
181 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
182 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
183 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
184 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
213 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
214 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
219 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
220 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
221 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
222 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
225 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
229 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
230 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
231 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
234 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
235 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
239 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
240 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
241 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.25
Nodule 0
Rhizoplane 4.03
Rhizosphere 94.44
Stem 0
Stem Tuber 0
Unclassified 23.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501077_0028442 3300049593 Bacteria 3552
2 Ga0070658_10020806 3300005327 Bacteria 5257
3 Ga0070658_10125516 3300005327 Bacteria 2136
4 Ga0070658_10741140 3300005327 Bacteria 853
5 Ga0070676_10199609 3300005328 Unclassified 1311
6 Ga0070683_100012761 3300005329 Bacteria 7308
7 Ga0070683_100116559 3300005329 Unclassified 2522
8 Ga0070683_100163196 3300005329 Bacteria 2114
9 Ga0070683_100204920 3300005329 Bacteria 1873
10 Ga0070683_100266500 3300005329 Unclassified 1629
11 Ga0070683_101176794 3300005329 Unclassified 737
12 Ga0070683_101284004 3300005329 Unclassified 704
13 Ga0070683_101772363 3300005329 Unclassified 593
14 Ga0070670_102072541 3300005331 Bacteria 524
15 Ga0070677_10238963 3300005333 Bacteria 896
16 Ga0068869_100109629 3300005334 Unclassified 2098
17 Ga0070666_10172962 3300005335 Bacteria 1513
18 Ga0070680_100013940 3300005336 Bacteria 6273
19 Ga0070680_100044542 3300005336 Bacteria 3605
20 Ga0070682_100001712 3300005337 Bacteria 12197
21 Ga0070682_100202698 3300005337 Unclassified 1400
22 Ga0070682_100230701 3300005337 Bacteria 1323
23 Ga0070682_100376022 3300005337 Unclassified 1067
24 Ga0070682_100778705 3300005337 Unclassified 775
25 Ga0068868_100013592 3300005338 Bacteria 5977
26 Ga0068868_100060980 3300005338 Bacteria 2987
27 Ga0070660_100006223 3300005339 Bacteria 8263
28 Ga0070660_100504565 3300005339 Unclassified 1006
29 Ga0070691_10000781 3300005341 Bacteria 12645
30 Ga0070691_10454999 3300005341 Bacteria 732
31 Ga0070691_10671094 3300005341 Bacteria 619
32 Ga0070687_100011765 3300005343 Bacteria 3840
33 Ga0070687_100165662 3300005343 Unclassified 1311
34 Ga0070661_100051608 3300005344 Bacteria 3010
35 Ga0070661_100150713 3300005344 Unclassified 1758
36 Ga0070692_10004463 3300005345 Bacteria 5850
37 Ga0070668_100174976 3300005347 Bacteria 1749
38 Ga0070668_101100576 3300005347 Bacteria 717
39 Ga0070668_101394095 3300005347 Unclassified 639
40 Ga0070668_101775827 3300005347 Bacteria 567
41 Ga0070669_100128448 3300005353 Bacteria 1942
42 Ga0070669_100669026 3300005353 Bacteria 875
43 Ga0070675_100013253 3300005354 Bacteria 6478
44 Ga0070675_100143919 3300005354 Bacteria 2039
45 Ga0070675_100176508 3300005354 Unclassified 1845
46 Ga0070675_100238849 3300005354 Bacteria 1587
47 Ga0070675_100264615 3300005354 Bacteria 1508
48 Ga0070671_100127913 3300005355 Unclassified 2139
49 Ga0070671_100134573 3300005355 Bacteria 2083
50 Ga0070671_100198696 3300005355 Unclassified 1700
51 Ga0070671_100262053 3300005355 Unclassified 1469
52 Ga0070671_100577024 3300005355 Bacteria 971
53 Ga0070674_100024608 3300005356 Bacteria 3910
54 Ga0070674_100026395 3300005356 Bacteria 3793
55 Ga0070674_100035054 3300005356 Unclassified 3358
56 Ga0070674_100164746 3300005356 Bacteria 1685
57 Ga0070674_100175982 3300005356 Bacteria 1635
58 Ga0070674_100215709 3300005356 Bacteria 1490
59 Ga0070674_100343715 3300005356 Unclassified 1203
60 Ga0070674_100741165 3300005356 Bacteria 843
61 Ga0070673_100001958 3300005364 Bacteria 12419
62 Ga0070673_100058421 3300005364 Bacteria 3049
63 Ga0070673_100346818 3300005364 Unclassified 1317
64 Ga0070659_100006531 3300005366 Bacteria 8420
65 Ga0070659_100212870 3300005366 Unclassified 1593
66 Ga0070659_100843002 3300005366 Unclassified 799
67 Ga0070701_10005023 3300005438 Bacteria 5424
68 Ga0070701_11072287 3300005438 Bacteria 566
69 Ga0070705_100052487 3300005440 Bacteria 2382
70 Ga0070700_100024808 3300005441 Bacteria 3526
71 Ga0070700_100854187 3300005441 Bacteria 737
72 Ga0070708_102090259 3300005445 Bacteria 524
73 Ga0070663_100099721 3300005455 Bacteria 2166
74 Ga0070663_100382113 3300005455 Unclassified 1147
75 Ga0070663_100426144 3300005455 Bacteria 1089
76 Ga0070678_100019284 3300005456 Bacteria 4443
77 Ga0070678_100093811 3300005456 Unclassified 2309
78 Ga0070678_101308050 3300005456 Unclassified 675
79 Ga0070678_101409162 3300005456 Bacteria 651
80 Ga0070678_102295950 3300005456 Bacteria 512
81 Ga0070662_100008794 3300005457 Bacteria 6586
82 Ga0070662_100464420 3300005457 Unclassified 1052
83 Ga0070662_101359677 3300005457 Bacteria 612
84 Ga0070681_10143620 3300005458 Bacteria 2316
85 Ga0070681_10325545 3300005458 Bacteria 1446
86 Ga0068867_100011666 3300005459 Bacteria 6206
87 Ga0068867_100095123 3300005459 Bacteria 2266
88 Ga0068867_100446742 3300005459 Bacteria 1101
89 Ga0068867_100532640 3300005459 Bacteria 1015
90 Ga0070685_10009536 3300005466 Bacteria 5020
91 Ga0070685_10041854 3300005466 Unclassified 2612
92 Ga0070698_100712639 3300005471 Bacteria 946
93 Ga0070679_100027697 3300005530 Bacteria 5580
94 Ga0070679_100924593 3300005530 Bacteria 816
95 Ga0070684_100016734 3300005535 Bacteria 6002
96 Ga0070684_100047370 3300005535 Bacteria 3725
97 Ga0070684_100053101 3300005535 Unclassified 3526
98 Ga0070684_100118958 3300005535 Bacteria 2375
99 Ga0070684_100687447 3300005535 Unclassified 953
100 Ga0068853_100002053 3300005539 Bacteria 14918
101 Ga0070672_100012897 3300005543 Bacteria 5888
102 Ga0070672_100019493 3300005543 Bacteria 4924
103 Ga0070672_100112092 3300005543 Unclassified 2225
104 Ga0070672_100491269 3300005543 Unclassified 1061
105 Ga0070686_100116613 3300005544 Unclassified 1828
106 Ga0070686_100943102 3300005544 Bacteria 704
107 Ga0070696_100178383 3300005546 Bacteria 1575
108 Ga0070696_101392235 3300005546 Bacteria 598
109 Ga0070693_100046774 3300005547 Bacteria 2459
110 Ga0070693_100609833 3300005547 Bacteria 789
111 Ga0070665_100087089 3300005548 Bacteria 3128
112 Ga0070665_100479102 3300005548 Bacteria 1255
113 Ga0070665_101567738 3300005548 Unclassified 667
114 Ga0068855_101222037 3300005563 Bacteria 781
115 Ga0070664_100011913 3300005564 Bacteria 7058
116 Ga0068857_100033412 3300005577 Bacteria 4549
117 Ga0068857_100105667 3300005577 Unclassified 2528
118 Ga0068857_100301716 3300005577 Unclassified 1477
119 Ga0068857_100450002 3300005577 Bacteria 1204
120 Ga0068854_100005835 3300005578 Bacteria 7796
121 Ga0068854_100274199 3300005578 Unclassified 1355
122 Ga0068856_100113518 3300005614 Unclassified 2707
123 Ga0070702_100009253 3300005615 Unclassified 4814
124 Ga0070702_100145435 3300005615 Unclassified 1515
125 Ga0068852_100002371 3300005616 Bacteria 12983
126 Ga0068859_100081776 3300005617 Bacteria 3272
127 Ga0068859_100476956 3300005617 Unclassified 1343
128 Ga0068864_100104963 3300005618 Unclassified 2511
129 Ga0068864_100856098 3300005618 Bacteria 896
130 Ga0068864_101261974 3300005618 Bacteria 738
131 Ga0068866_10050031 3300005718 Bacteria 2120
132 Ga0068866_10174499 3300005718 Unclassified 1264
133 Ga0068866_10197785 3300005718 Bacteria 1199
134 Ga0068866_10636179 3300005718 Bacteria 724
135 Ga0068866_10699229 3300005718 Bacteria 695
136 Ga0068866_10737600 3300005718 Bacteria 679
137 Ga0068866_10758397 3300005718 Bacteria 671
138 Ga0068861_100113603 3300005719 Bacteria 2173
139 Ga0068861_101756336 3300005719 Bacteria 614
140 Ga0068851_10134690 3300005834 Bacteria 1339
141 Ga0068851_10216565 3300005834 Bacteria 1074
142 Ga0068851_10493845 3300005834 Bacteria 733
143 Ga0068870_10000685 3300005840 Bacteria 12965
144 Ga0068870_10186527 3300005840 Unclassified 1249
145 Ga0068870_10655382 3300005840 Unclassified 720
146 Ga0068863_100098876 3300005841 Bacteria 2772
147 Ga0068863_101914888 3300005841 Bacteria 603
148 Ga0068858_100222261 3300005842 Bacteria 1789
149 Ga0068858_100575290 3300005842 Bacteria 1091
150 Ga0068860_100113669 3300005843 Bacteria 2589
151 Ga0068860_100179105 3300005843 Unclassified 2049
152 Ga0068860_100486778 3300005843 Unclassified 1230
153 Ga0068862_101127921 3300005844 Bacteria 780
154 Ga0081455_10011342 3300005937 Bacteria 8962
155 Ga0081455_10064761 3300005937 Bacteria 3059
156 Ga0081455_10071664 3300005937 Bacteria 2872
157 Ga0081538_10001394 3300005981 Bacteria 24783
158 Ga0081539_10001263 3300005985 Bacteria 44753
159 Ga0075365_10202266 3300006038 Bacteria 1391
160 Ga0075365_10760253 3300006038 Bacteria 684
161 Ga0075364_10101016 3300006051 Bacteria 1920
162 Ga0075364_11163294 3300006051 Bacteria 523
163 Ga0075367_10945511 3300006178 Unclassified 550
164 Ga0097621_100116158 3300006237 Unclassified 2266
165 Ga0097621_100249430 3300006237 Bacteria 1554
166 Ga0097621_100864649 3300006237 Bacteria 841
167 Ga0097621_100986186 3300006237 Unclassified 788
168 Ga0068871_100036187 3300006358 Bacteria 3929
169 Ga0068871_100641381 3300006358 Bacteria 969
170 Ga0075428_100188205 3300006844 Bacteria 2233
171 Ga0075430_100186571 3300006846 Bacteria 1724
172 Ga0075433_11707393 3300006852 Unclassified 542
173 Ga0075434_101462697 3300006871 Bacteria 693
174 Ga0075429_100633080 3300006880 Bacteria 937
175 Ga0075429_101707060 3300006880 Bacteria 547
176 Ga0068865_100014098 3300006881 Bacteria 5072
177 Ga0068865_100018100 3300006881 Bacteria 4541
178 Ga0068865_100212158 3300006881 Bacteria 1509
179 Ga0068865_100438663 3300006881 Bacteria 1077
180 Ga0068865_100823643 3300006881 Bacteria 802
181 Ga0097620_100081781 3300006931 Bacteria 3272
182 Ga0097620_100476918 3300006931 Unclassified 1343
183 Ga0105240_11877604 3300009093 Bacteria 623
184 Ga0105240_12621444 3300009093 Bacteria 521
185 Ga0111539_10006960 3300009094 Bacteria 14514
186 Ga0111539_10074007 3300009094 Bacteria 4015
187 Ga0111539_10385516 3300009094 Bacteria 1632
188 Ga0111539_11695879 3300009094 Unclassified 733
189 Ga0111539_11797939 3300009094 Unclassified 711
190 Ga0111539_12559193 3300009094 Bacteria 592
191 Ga0105245_10008068 3300009098 Bacteria 9206
192 Ga0105245_10068162 3300009098 Unclassified 3223
193 Ga0105245_10193633 3300009098 Bacteria 1949
194 Ga0105245_10265614 3300009098 Unclassified 1672
195 Ga0105245_10288603 3300009098 Bacteria 1606
196 Ga0105245_10364669 3300009098 Unclassified 1435
197 Ga0105245_10751275 3300009098 Bacteria 1011
198 Ga0105245_11863191 3300009098 Bacteria 654
199 Ga0105247_10041631 3300009101 Bacteria 2812
200 Ga0105247_10994977 3300009101 Bacteria 654
201 Ga0114129_10353057 3300009147 Bacteria 1947
202 Ga0114129_10451480 3300009147 Bacteria 1686
203 Ga0114129_10692940 3300009147 Bacteria 1310
204 Ga0114129_11077726 3300009147 Bacteria 1007
205 Ga0114129_11447774 3300009147 Bacteria 846
206 Ga0114129_11790774 3300009147 Bacteria 747
207 Ga0105243_10004018 3300009148 Bacteria 11716
208 Ga0105243_10007875 3300009148 Bacteria 8184
209 Ga0105243_10137679 3300009148 Bacteria 2079
210 Ga0105243_10372540 3300009148 Bacteria 1318
211 Ga0105243_11704686 3300009148 Unclassified 659
212 Ga0105243_12465050 3300009148 Bacteria 559
213 Ga0105242_10067548 3300009176 Unclassified 2956
214 Ga0105242_10142341 3300009176 Bacteria 2082
215 Ga0105242_10461250 3300009176 Bacteria 1200
216 Ga0105242_10791995 3300009176 Bacteria 937
217 Ga0105248_10286384 3300009177 Bacteria 1855
218 Ga0105248_10647613 3300009177 Unclassified 1192
219 Ga0105248_11043744 3300009177 Unclassified 923
220 Ga0105248_11414323 3300009177 Unclassified 787
221 Ga0105248_13468566 3300009177 Bacteria 501
222 Ga0105238_10021955 3300009551 Bacteria 6502
223 Ga0105238_10223925 3300009551 Bacteria 1858
224 Ga0105238_12682043 3300009551 Bacteria 535
225 Ga0105249_10015358 3300009553 Bacteria 6776
226 Ga0105249_10067152 3300009553 Bacteria 3303
227 Ga0105249_10067633 3300009553 Bacteria 3292
228 Ga0105239_10021141 3300010375 Bacteria 7178
229 Ga0105239_10218530 3300010375 Bacteria 2137
230 Ga0105239_10600201 3300010375 Bacteria 1256
231 Ga0105239_10683993 3300010375 Bacteria 1173
232 Ga0105246_10026274 3300011119 Bacteria 3802
233 Ga0105246_10078279 3300011119 Unclassified 2348
234 Ga0105246_10129824 3300011119 Bacteria 1880
235 Ga0157326_1070366 3300012513 Unclassified 553
236 Ga0157373_11393917 3300013100 Bacteria 533
237 Ga0157371_10003237 3300013102 Bacteria 14944
238 Ga0157369_10172235 3300013105 Bacteria 2280
239 Ga0157374_11181696 3300013296 Bacteria 786
240 Ga0157374_12227659 3300013296 Bacteria 575
241 Ga0157378_11015008 3300013297 Bacteria 864
242 Ga0157378_12537265 3300013297 Bacteria 565
243 Ga0163162_10076833 3300013306 Bacteria 3402
244 Ga0163162_10492366 3300013306 Unclassified 1357
245 Ga0163162_11856261 3300013306 Unclassified 689
246 Ga0157372_10008369 3300013307 Bacteria 10997
247 Ga0157372_12590993 3300013307 Unclassified 582
248 Ga0157375_10048535 3300013308 Bacteria 4153
249 Ga0157375_10720262 3300013308 Bacteria 1150
250 Ga0157375_11286039 3300013308 Unclassified 860
251 Ga0157375_12083114 3300013308 Bacteria 675
252 Ga0163163_10130751 3300014325 Unclassified 2551
253 Ga0163163_10289425 3300014325 Bacteria 1690
254 Ga0163163_10857583 3300014325 Unclassified 972
255 Ga0163163_10964601 3300014325 Bacteria 916
256 Ga0163163_11071496 3300014325 Unclassified 869
257 Ga0163163_11541761 3300014325 Bacteria 726
258 Ga0163163_11901115 3300014325 Bacteria 655
259 Ga0163163_12057016 3300014325 Bacteria 631
260 Ga0157380_10018392 3300014326 Bacteria 5186
261 Ga0157380_10031987 3300014326 Bacteria 4042
262 Ga0157380_10090420 3300014326 Unclassified 2525
263 Ga0157380_10277994 3300014326 Bacteria 1530
264 Ga0157380_11277449 3300014326 Bacteria 780
265 Ga0157380_12438997 3300014326 Bacteria 588
266 Ga0157380_12679987 3300014326 Bacteria 565
267 Ga0157377_10005725 3300014745 Bacteria 5860
268 Ga0157377_10046641 3300014745 Bacteria 2425
269 Ga0157377_10192467 3300014745 Bacteria 1290
270 Ga0157377_11492677 3300014745 Unclassified 537
271 Ga0157379_10349401 3300014968 Unclassified 1354
272 Ga0157379_11099008 3300014968 Bacteria 761
273 Ga0157379_11608103 3300014968 Unclassified 635
274 Ga0157376_10023873 3300014969 Bacteria 4794
275 Ga0157376_10228217 3300014969 Bacteria 1728
276 Ga0157376_10350635 3300014969 Bacteria 1412
277 Ga0157376_10384221 3300014969 Bacteria 1353
278 Ga0157376_10694176 3300014969 Unclassified 1022
279 Ga0163161_10135225 3300017792 Bacteria 1863
280 Ga0163161_10170556 3300017792 Unclassified 1663
281 Ga0163161_10616943 3300017792 Bacteria 896
282 Ga0207656_10288057 3300025321 Bacteria 811
283 Ga0207656_10397228 3300025321 Bacteria 693
284 Ga0207642_10034392 3300025899 Unclassified 2155
285 Ga0207688_10012183 3300025901 Bacteria 4678
286 Ga0207688_10014657 3300025901 Bacteria 4258
287 Ga0207688_10849052 3300025901 Bacteria 578
288 Ga0207680_10118518 3300025903 Bacteria 1728
289 Ga0207680_10726080 3300025903 Bacteria 712
290 Ga0207647_10084225 3300025904 Bacteria 1903
291 Ga0207645_10192233 3300025907 Unclassified 1342
292 Ga0207643_10002875 3300025908 Bacteria 9291
293 Ga0207643_10020606 3300025908 Bacteria 3620
294 Ga0207643_10131343 3300025908 Unclassified 1490
295 Ga0207643_10149907 3300025908 Unclassified 1398
296 Ga0207705_10142417 3300025909 Bacteria 1791
297 Ga0207654_10988194 3300025911 Bacteria 612
298 Ga0207707_10177704 3300025912 Unclassified 1859
299 Ga0207660_10178798 3300025917 Unclassified 1647
300 Ga0207662_10405667 3300025918 Bacteria 925
301 Ga0207657_10005874 3300025919 Bacteria 12787
302 Ga0207657_10115501 3300025919 Bacteria 2212
303 Ga0207649_10235848 3300025920 Unclassified 1311
304 Ga0207649_10477406 3300025920 Bacteria 945
305 Ga0207652_10163111 3300025921 Unclassified 1998
306 Ga0207652_10370220 3300025921 Bacteria 1293
307 Ga0207652_11817084 3300025921 Unclassified 514
308 Ga0207694_10085310 3300025924 Bacteria 2485
309 Ga0207650_10010107 3300025925 Bacteria 6466
310 Ga0207650_10336404 3300025925 Bacteria 1239
311 Ga0207650_10391692 3300025925 Unclassified 1149
312 Ga0207659_10125900 3300025926 Bacteria 1970
313 Ga0207687_10014081 3300025927 Bacteria 5230
314 Ga0207687_10095754 3300025927 Bacteria 2174
315 Ga0207687_10182411 3300025927 Bacteria 1627
316 Ga0207687_10675279 3300025927 Unclassified 875
317 Ga0207687_11263785 3300025927 Unclassified 635
318 Ga0207644_10107407 3300025931 Bacteria 2106
319 Ga0207644_10486246 3300025931 Bacteria 1017
320 Ga0207644_10761133 3300025931 Bacteria 809
321 Ga0207644_10971200 3300025931 Bacteria 713
322 Ga0207644_11483086 3300025931 Bacteria 569
323 Ga0207690_10558569 3300025932 Unclassified 931
324 Ga0207706_10006537 3300025933 Bacteria 10802
325 Ga0207706_10119519 3300025933 Bacteria 2317
326 Ga0207706_10330671 3300025933 Bacteria 1326
327 Ga0207686_10166983 3300025934 Bacteria 1548
328 Ga0207686_10251933 3300025934 Unclassified 1290
329 Ga0207686_10466096 3300025934 Bacteria 974
330 Ga0207686_10687048 3300025934 Bacteria 812
331 Ga0207686_11041167 3300025934 Bacteria 665
332 Ga0207709_10029522 3300025935 Unclassified 3182
333 Ga0207709_10041070 3300025935 Bacteria 2774
334 Ga0207709_10060410 3300025935 Bacteria 2363
335 Ga0207709_11296535 3300025935 Bacteria 602
336 Ga0207670_10012823 3300025936 Bacteria 4918
337 Ga0207669_10158728 3300025937 Bacteria 1594
338 Ga0207669_10208407 3300025937 Bacteria 1425
339 Ga0207669_10301324 3300025937 Unclassified 1218
340 Ga0207669_10511961 3300025937 Bacteria 962
341 Ga0207669_10521426 3300025937 Unclassified 954
342 Ga0207669_10897440 3300025937 Bacteria 740
343 Ga0207669_11100086 3300025937 Unclassified 671
344 Ga0207704_10061154 3300025938 Bacteria 2334
345 Ga0207704_11009042 3300025938 Bacteria 704
346 Ga0207704_11131668 3300025938 Unclassified 666
347 Ga0207704_11640817 3300025938 Bacteria 552
348 Ga0207691_10006369 3300025940 Bacteria 11405
349 Ga0207691_10008449 3300025940 Bacteria 9887
350 Ga0207691_10079394 3300025940 Unclassified 2953
351 Ga0207691_11183076 3300025940 Unclassified 634
352 Ga0207711_10158564 3300025941 Bacteria 2046
353 Ga0207711_10171587 3300025941 Bacteria 1968
354 Ga0207711_10216703 3300025941 Unclassified 1750
355 Ga0207661_10014245 3300025944 Bacteria 5823
356 Ga0207661_10035968 3300025944 Bacteria 3863
357 Ga0207661_10070450 3300025944 Bacteria 2855
358 Ga0207661_10389751 3300025944 Unclassified 1262
359 Ga0207661_10530880 3300025944 Bacteria 1077
360 Ga0207661_10960543 3300025944 Bacteria 787
361 Ga0207661_11704536 3300025944 Unclassified 575
362 Ga0207679_10335643 3300025945 Bacteria 1313
363 Ga0207679_11117337 3300025945 Unclassified 723
364 Ga0207667_10191644 3300025949 Bacteria 2098
365 Ga0207651_10068544 3300025960 Bacteria 2501
366 Ga0207651_10297401 3300025960 Unclassified 1341
367 Ga0207651_10939350 3300025960 Bacteria 771
368 Ga0207712_10052654 3300025961 Bacteria 2852
369 Ga0207712_10312348 3300025961 Bacteria 1294
370 Ga0207668_11681396 3300025972 Bacteria 573
371 Ga0207640_10044988 3300025981 Bacteria 2832
372 Ga0207640_11374061 3300025981 Bacteria 632
373 Ga0207658_10251207 3300025986 Bacteria 1503
374 Ga0207658_11069638 3300025986 Bacteria 737
375 Ga0207677_10210254 3300026023 Bacteria 1553
376 Ga0207677_10308783 3300026023 Bacteria 1310
377 Ga0207677_11499192 3300026023 Unclassified 623
378 Ga0207703_10080882 3300026035 Bacteria 2707
379 Ga0207703_10127398 3300026035 Unclassified 2194
380 Ga0207639_10184083 3300026041 Bacteria 1779
381 Ga0207639_10520389 3300026041 Bacteria 1089
382 Ga0207678_10046202 3300026067 Bacteria 3766
383 Ga0207678_10093063 3300026067 Bacteria 2576
384 Ga0207678_10418915 3300026067 Unclassified 1161
385 Ga0207678_10430975 3300026067 Bacteria 1144
386 Ga0207708_10038706 3300026075 Bacteria 3632
387 Ga0207708_10453528 3300026075 Unclassified 1068
388 Ga0207708_11101480 3300026075 Archaea 692
389 Ga0207708_11641790 3300026075 Bacteria 565
390 Ga0207702_10137847 3300026078 Unclassified 2204
391 Ga0207702_10151131 3300026078 Unclassified 2112
392 Ga0207641_10740567 3300026088 Unclassified 970
393 Ga0207641_10874658 3300026088 Unclassified 892
394 Ga0207641_12066872 3300026088 Unclassified 571
395 Ga0207648_10009895 3300026089 Bacteria 9090
396 Ga0207648_10092382 3300026089 Unclassified 2646
397 Ga0207648_10173742 3300026089 Unclassified 1905
398 Ga0207648_10658844 3300026089 Bacteria 968
399 Ga0207648_10745147 3300026089 Unclassified 910
400 Ga0207648_11187397 3300026089 Unclassified 717
401 Ga0207676_10029132 3300026095 Unclassified 4131
402 Ga0207676_10090067 3300026095 Bacteria 2516
403 Ga0207676_10572265 3300026095 Bacteria 1082
404 Ga0207674_10018022 3300026116 Bacteria 7691
405 Ga0207674_10281330 3300026116 Bacteria 1611
406 Ga0207674_10426357 3300026116 Bacteria 1282
407 Ga0207675_100084663 3300026118 Bacteria 2975
408 Ga0207675_100260370 3300026118 Bacteria 1681
409 Ga0207675_100285492 3300026118 Unclassified 1604
410 Ga0207683_10031736 3300026121 Bacteria 4586
411 Ga0207683_10094502 3300026121 Unclassified 2665
412 Ga0207683_10134886 3300026121 Bacteria 2222
413 Ga0207683_10319832 3300026121 Unclassified 1421
414 Ga0207683_10356898 3300026121 Bacteria 1342
415 Ga0207683_12196911 3300026121 Bacteria 500
416 Ga0207698_10028103 3300026142 Bacteria 4005
417 Ga0207698_10095357 3300026142 Bacteria 2449
418 Ga0207698_10518620 3300026142 Unclassified 1163
419 Ga0207698_10611624 3300026142 Unclassified 1075
420 Ga0268266_10409827 3300028379 Unclassified 1283
421 Ga0268265_10225582 3300028380 Unclassified 1643
422 Ga0268265_10327062 3300028380 Bacteria 1391
423 Ga0268265_11038064 3300028380 Bacteria 811
424 Ga0268264_10140205 3300028381 Bacteria 2155
425 Ga0268264_10265222 3300028381 Bacteria 1602
426 Ga0307408_100617055 3300031548 Unclassified 966
427 Ga0307408_102453957 3300031548 Bacteria 507
428 Ga0307409_102745913 3300031995 Bacteria 520
429 Ga0307416_100454147 3300032002 Bacteria 1335
430 Ga0373951_0137168 3300035091 Bacteria 677
431 Ga0373942_0111994 3300035207 Bacteria 845
432 Ga0451804_0721543 3300041463 Unclassified 1089
433 Ga0451807_1895063 3300041486 Bacteria 581
434 Ga0451853_2549579 3300041512 Bacteria 794
435 Ga0451853_2874699 3300041512 Bacteria 781
436 Ga0439463_013509 3300042016 Unclassified 2010
437 Ga0450902_105809 3300042137 Bacteria 502
438 Ga0450906_015068 3300042145 Unclassified 1408
439 Ga0450907_007288 3300042146 Bacteria 1848
440 Ga0450908_039235 3300042184 Unclassified 821
441 Ga0450918_081047 3300042531 Archaea 619
442 Ga0453683_0538970 3300044673 Bacteria 759
443 Ga0495603_0007432 3300046455 Bacteria 6590
444 Ga0495603_0146681 3300046455 Bacteria 1372
445 Ga0495603_0867761 3300046455 Bacteria 513
446 Ga0495641_0483541 3300046461 Unclassified 564
447 Ga0495653_0922998 3300046463 Bacteria 519
448 Ga0495582_0803114 3300046473 Bacteria 544
449 Ga0495631_0205104 3300046518 Bacteria 843
450 Ga0495631_0216032 3300046518 Bacteria 819
451 Ga0495644_0098290 3300046523 Bacteria 1107
452 Ga0495663_0265051 3300046525 Bacteria 613
453 Ga0495587_0550245 3300046536 Bacteria 637
454 Ga0495656_0016568 3300046615 Bacteria 2799
455 Ga0495656_0159212 3300046615 Bacteria 1096
456 Ga0495656_0262546 3300046615 Bacteria 875
457 Ga0495656_0292269 3300046615 Bacteria 833
458 Ga0495656_0569530 3300046615 Bacteria 605
459 Ga0495611_0354771 3300046648 Bacteria 673
460 Ga0495635_0169751 3300046663 Bacteria 1484
461 Ga0495588_0326999 3300046674 Unclassified 806
462 Ga0495588_0520010 3300046674 Bacteria 624
463 Ga0495657_0076277 3300046675 Bacteria 2177
464 Ga0495671_0170934 3300046692 Bacteria 1057
465 Ga0495589_0216495 3300046794 Bacteria 901
466 Ga0495589_0353498 3300046794 Bacteria 677
467 Ga0495604_0381666 3300047317 Bacteria 931
468 Ga0495674_0010972 3300047319 Bacteria 8560
469 Ga0496100_0421230 3300048903 Bacteria 1020
470 Ga0496100_0784341 3300048903 Bacteria 746
471 Ga0496101_0373463 3300048904 Bacteria 1121
472 Ga0496101_0719916 3300048904 Bacteria 788
473 Ga0496102_0374508 3300048905 Bacteria 1340
474 Ga0496102_1868497 3300048905 Bacteria 517
475 Ga0496104_0160961 3300048907 Unclassified 2153
476 Ga0496104_1450349 3300048907 Bacteria 589
477 Ga0496105_0154420 3300048908 Bacteria 1886
478 Ga0496105_0741211 3300048908 Bacteria 751
479 Ga0496107_0207087 3300048910 Unclassified 1458
480 Ga0496107_0311772 3300048910 Bacteria 1171
481 Ga0496107_0424615 3300048910 Bacteria 988
482 Ga0496108_0074930 3300048911 Unclassified 2858
483 Ga0496108_0631214 3300048911 Bacteria 932
484 Ga0496108_0640542 3300048911 Unclassified 924
485 Ga0496108_1437587 3300048911 Unclassified 576
486 Ga0496109_0246817 3300048912 Unclassified 1681
487 Ga0496109_1537389 3300048912 Unclassified 600
488 Ga0496110_0233407 3300048913 Unclassified 1673
489 Ga0496111_0021052 3300048914 Bacteria 4548
490 Ga0496111_0103492 3300048914 Unclassified 2094
491 Ga0496111_1261095 3300048914 Bacteria 522
492 Ga0496114_0048478 3300048917 Bacteria 3533
493 Ga0496114_0101719 3300048917 Bacteria 2454
494 Ga0496114_0544188 3300048917 Bacteria 1026
495 Ga0496114_0658644 3300048917 Bacteria 920
496 Ga0501031_0005742 3300049568 Bacteria 8085
497 Ga0501031_0030821 3300049568 Bacteria 3498
498 Ga0501031_0032813 3300049568 Bacteria 3386
499 Ga0501031_0172835 3300049568 Bacteria 1412
500 Ga0501031_0254597 3300049568 Unclassified 1141
501 Ga0501031_0331320 3300049568 Bacteria 986
502 Ga0501032_0294593 3300049569 Unclassified 1049
503 Ga0501033_0023999 3300049570 Bacteria 4601
504 Ga0501033_0223902 3300049570 Bacteria 1338
505 Ga0501034_0302561 3300049571 Bacteria 1536
506 Ga0501036_0015890 3300049572 Bacteria 6287
507 Ga0501036_0016429 3300049572 Bacteria 6181
508 Ga0501036_0019052 3300049572 Bacteria 5758
509 Ga0501036_0022425 3300049572 Bacteria 5311
510 Ga0501036_0126475 3300049572 Unclassified 2158
511 Ga0501036_0186225 3300049572 Unclassified 1747
512 Ga0501036_0490701 3300049572 Unclassified 1022
513 Ga0501036_0527690 3300049572 Bacteria 982
514 Ga0501037_0086920 3300049573 Bacteria 2263
515 Ga0501037_0230640 3300049573 Bacteria 1300
516 Ga0501038_0001233 3300049574 Bacteria 23205
517 Ga0501038_0063079 3300049574 Bacteria 3164
518 Ga0501038_0081404 3300049574 Bacteria 2728
519 Ga0501038_0086589 3300049574 Bacteria 2632
520 Ga0501038_0239779 3300049574 Bacteria 1440
521 Ga0501039_0002571 3300049575 Bacteria 13554
522 Ga0501039_0042951 3300049575 Bacteria 3492
523 Ga0501039_0202075 3300049575 Bacteria 1562
524 Ga0501039_0491962 3300049575 Unclassified 963
525 Ga0501040_0021623 3300049576 Bacteria 4298
526 Ga0501040_0057485 3300049576 Bacteria 2670
527 Ga0501040_0064842 3300049576 Bacteria 2515
528 Ga0501040_0177247 3300049576 Bacteria 1510
529 Ga0501040_0201982 3300049576 Bacteria 1411
530 Ga0501040_0216803 3300049576 Bacteria 1361
531 Ga0501040_0298707 3300049576 Unclassified 1151
532 Ga0501041_0016374 3300049577 Bacteria 4406
533 Ga0501041_0067223 3300049577 Bacteria 2197
534 Ga0501041_0084006 3300049577 Bacteria 1962
535 Ga0501041_0457128 3300049577 Bacteria 811
536 Ga0501041_0815030 3300049577 Bacteria 599
537 Ga0501042_0001944 3300049578 Bacteria 12443
538 Ga0501042_0013760 3300049578 Bacteria 5511
539 Ga0501042_0023089 3300049578 Bacteria 4348
540 Ga0501042_0029424 3300049578 Bacteria 3873
541 Ga0501042_0029643 3300049578 Bacteria 3860
542 Ga0501042_0066670 3300049578 Bacteria 2573
543 Ga0501043_0038684 3300049579 Bacteria 3751
544 Ga0501043_0060335 3300049579 Bacteria 2977
545 Ga0501043_0081171 3300049579 Bacteria 2548
546 Ga0501043_0128699 3300049579 Bacteria 1985
547 Ga0501046_0002238 3300049580 Bacteria 18255
548 Ga0501046_0046873 3300049580 Bacteria 3429
549 Ga0501046_0126345 3300049580 Unclassified 1942
550 Ga0501046_0287048 3300049580 Bacteria 1204
551 Ga0501048_0010299 3300049582 Bacteria 6988
552 Ga0501048_0022562 3300049582 Bacteria 4603
553 Ga0501048_0069452 3300049582 Bacteria 2488
554 Ga0501048_0079666 3300049582 Unclassified 2311
555 Ga0501048_0123624 3300049582 Bacteria 1829
556 Ga0501048_0835779 3300049582 Bacteria 662
557 Ga0501067_0007721 3300049583 Bacteria 5983
558 Ga0501067_0017547 3300049583 Bacteria 3961
559 Ga0501067_0403022 3300049583 Bacteria 763
560 Ga0501068_0032416 3300049584 Bacteria 3108
561 Ga0501068_0041064 3300049584 Bacteria 2779
562 Ga0501068_0340274 3300049584 Unclassified 963
563 Ga0501068_0973970 3300049584 Bacteria 559
564 Ga0501069_0007569 3300049585 Bacteria 5700
565 Ga0501069_0029282 3300049585 Bacteria 3022
566 Ga0501069_0056277 3300049585 Bacteria 2191
567 Ga0501069_0188959 3300049585 Bacteria 1192
568 Ga0501069_0383137 3300049585 Bacteria 831
569 Ga0501069_0590548 3300049585 Bacteria 666
570 Ga0501070_0021898 3300049586 Bacteria 5355
571 Ga0501070_0056221 3300049586 Bacteria 3262
572 Ga0501070_0078905 3300049586 Bacteria 2724
573 Ga0501070_0481905 3300049586 Archaea 998
574 Ga0501071_0015825 3300049587 Bacteria 5182
575 Ga0501071_0026430 3300049587 Bacteria 4074
576 Ga0501071_0041548 3300049587 Bacteria 3293
577 Ga0501071_0062523 3300049587 Bacteria 2697
578 Ga0501071_0081894 3300049587 Bacteria 2362
579 Ga0501071_0207622 3300049587 Bacteria 1472
580 Ga0501071_0249725 3300049587 Bacteria 1339
581 Ga0501071_0468716 3300049587 Bacteria 965
582 Ga0501071_0639434 3300049587 Bacteria 818
583 Ga0501071_1025061 3300049587 Bacteria 637
584 Ga0501072_0015977 3300049588 Bacteria 5755
585 Ga0501072_0041305 3300049588 Bacteria 3622
586 Ga0501072_0045386 3300049588 Bacteria 3455
587 Ga0501072_0069967 3300049588 Unclassified 2771
588 Ga0501072_0079048 3300049588 Bacteria 2604
589 Ga0501072_0104506 3300049588 Bacteria 2252
590 Ga0501072_0317278 3300049588 Bacteria 1238
591 Ga0501073_0053563 3300049589 Unclassified 2824
592 Ga0501073_0313037 3300049589 Bacteria 1083
593 Ga0501074_0015498 3300049590 Bacteria 5541
594 Ga0501074_0016179 3300049590 Bacteria 5420
595 Ga0501074_0019682 3300049590 Bacteria 4900
596 Ga0501074_0029712 3300049590 Bacteria 3959
597 Ga0501074_0227394 3300049590 Unclassified 1328
598 Ga0501074_0513004 3300049590 Bacteria 849
599 Ga0501074_0616857 3300049590 Bacteria 767
600 Ga0501075_0020640 3300049591 Bacteria 4794
601 Ga0501075_0029430 3300049591 Bacteria 4062
602 Ga0501075_0042558 3300049591 Unclassified 3405
603 Ga0501075_0072840 3300049591 Bacteria 2597
604 Ga0501075_0091945 3300049591 Bacteria 2302
605 Ga0501075_0101065 3300049591 Bacteria 2190
606 Ga0501075_0260162 3300049591 Unclassified 1323
607 Ga0501075_1055731 3300049591 Bacteria 617
608 Ga0501076_0017170 3300049592 Bacteria 5497
609 Ga0501076_0041066 3300049592 Bacteria 3637
610 Ga0501076_0042002 3300049592 Bacteria 3600
611 Ga0501076_0044689 3300049592 Bacteria 3493
612 Ga0501076_0069701 3300049592 Bacteria 2810
613 Ga0501076_0080631 3300049592 Unclassified 2613
614 Ga0501076_0108028 3300049592 Bacteria 2247
615 Ga0501076_0365248 3300049592 Unclassified 1186
616 Ga0501076_0392689 3300049592 Unclassified 1141
617 Ga0501076_0976121 3300049592 Bacteria 698
618 Ga0501076_1783658 3300049592 Bacteria 504
619 Ga0501077_0008860 3300049593 Bacteria 6243
620 Ga0501077_0015815 3300049593 Bacteria 4752
621 Ga0501077_0020119 3300049593 Bacteria 4224
622 Ga0501077_0036010 3300049593 Bacteria 3152
623 Ga0501077_0048282 3300049593 Bacteria 2704
624 Ga0501077_0299344 3300049593 Bacteria 1025
625 Ga0501077_0539338 3300049593 Unclassified 748
626 Ga0501077_0688714 3300049593 Archaea 657
627 Ga0501079_0042134 3300049741 Bacteria 3526
628 Ga0501079_0052745 3300049741 Bacteria 3138
629 Ga0501079_0069293 3300049741 Bacteria 2722
630 Ga0501079_0086551 3300049741 Bacteria 2425
631 Ga0501079_0229335 3300049741 Bacteria 1451
632 Ga0501079_0366321 3300049741 Bacteria 1130
633 Ga0501080_0032915 3300049742 Bacteria 4837
634 Ga0501080_0033295 3300049742 Bacteria 4809
635 Ga0501080_0037636 3300049742 Bacteria 4518
636 Ga0501080_0056973 3300049742 Bacteria 3639
637 Ga0501080_0076337 3300049742 Bacteria 3117
638 Ga0501080_0097529 3300049742 Bacteria 2729
639 Ga0501080_0478851 3300049742 Bacteria 1114
640 Ga0501080_0610216 3300049742 Bacteria 968
641 Ga0501080_0783550 3300049742 Bacteria 837
642 Ga0501080_1268085 3300049742 Archaea 632
643 Ga0501081_0005337 3300049743 Bacteria 8292
644 Ga0501081_0017215 3300049743 Bacteria 4781
645 Ga0501081_0070783 3300049743 Bacteria 2430
646 Ga0501081_0096120 3300049743 Bacteria 2089
647 Ga0501081_0097930 3300049743 Bacteria 2070
648 Ga0501081_0150992 3300049743 Bacteria 1669
649 Ga0501081_0210410 3300049743 Bacteria 1412
650 Ga0501081_0218427 3300049743 Bacteria 1386
651 Ga0501083_0001237 3300049744 Bacteria 17325
652 Ga0501083_0019007 3300049744 Bacteria 4783
653 Ga0501083_0070801 3300049744 Bacteria 2319
654 Ga0501083_0078168 3300049744 Bacteria 2195
655 Ga0501083_0194040 3300049744 Unclassified 1325
656 Ga0501083_1112286 3300049744 Bacteria 514
657 Ga0501035_0006912 3300049822 Bacteria 10599
658 Ga0501035_0092494 3300049822 Bacteria 2661
659 Ga0501035_0242379 3300049822 Unclassified 1533
660 Ga0501035_0551313 3300049822 Bacteria 944
661 Ga0501044_0194459 3300049823 Bacteria 1989
662 Ga0501044_0317303 3300049823 Bacteria 1484
663 Ga0501045_0021740 3300049824 Bacteria 4593
664 Ga0501045_0026671 3300049824 Bacteria 4157
665 Ga0501045_0037507 3300049824 Bacteria 3523
666 Ga0501045_0046832 3300049824 Unclassified 3148
667 Ga0501045_0095884 3300049824 Bacteria 2194
668 Ga0501045_0154153 3300049824 Unclassified 1709
669 Ga0501045_0309378 3300049824 Bacteria 1176
670 Ga0501045_0371313 3300049824 Bacteria 1065
671 Ga0501045_0436225 3300049824 Bacteria 974
672 Ga0501045_0531236 3300049824 Bacteria 873
673 nmdc:mga00v17_167978_c1 3300050491 Bacteria 1414
674 nmdc:mga0yw44_15657_c1 3300050492 Bacteria 4070
675 nmdc:mga0yw44_707987_c1 3300050492 Bacteria 684
676 nmdc:mga06z11_392600_c1 3300050494 Bacteria 834
677 nmdc:mga05p37_1057987_c1 3300050507 Bacteria 855
678 nmdc:mga05p37_1712565_c1 3300050507 Bacteria 612
679 nmdc:mga05p37_2019990_c1 3300050507 Bacteria 544
680 nmdc:mga05p37_212203_c1 3300050507 Bacteria 2340
681 nmdc:mga05p37_265010_c1 3300050507 Bacteria 2055
682 nmdc:mga05p37_445176_c1 3300050507 Bacteria 1501
683 nmdc:mga09592_1144571_c1 3300050508 Bacteria 645
684 nmdc:mga0qj67_80648_c1 3300050509 Bacteria 2607
685 nmdc:mga06r32_73161_c1 3300050510 Bacteria 3319
686 nmdc:mga08y16_10062_c1 3300050511 Bacteria 9926
687 nmdc:mga08y16_258391_c1 3300050511 Bacteria 1799
688 nmdc:mga0n895_1869818_c1 3300050512 Unclassified 560
689 nmdc:mga0rr50_443861_c1 3300050513 Bacteria 1099
690 nmdc:mga08x19_1166353_c1 3300050514 Unclassified 546
691 nmdc:mga0a205_1344455_c1 3300050515 Bacteria 562
692 Ga0495619_0011342 3300053085 Bacteria 5611
693 Ga0501084_0006937 3300054114 Bacteria 9329
694 Ga0501084_0008276 3300054114 Bacteria 8580
695 Ga0501084_0038942 3300054114 Bacteria 3975
696 Ga0501084_0049123 3300054114 Bacteria 3531
697 Ga0501084_0104713 3300054114 Bacteria 2376
698 Ga0501084_0105788 3300054114 Bacteria 2363
699 Ga0501084_0427384 3300054114 Bacteria 1120
700 Ga0501084_0820090 3300054114 Unclassified 783
701 Ga0501082_0016449 3300060353 Bacteria 6367
702 Ga0501082_0017102 3300060353 Bacteria 6247
703 Ga0501082_0061060 3300060353 Bacteria 3245
704 Ga0501082_0119332 3300060353 Bacteria 2285
705 Ga0501082_0123555 3300060353 Bacteria 2244
706 Ga0501082_0188650 3300060353 Unclassified 1794
707 Ga0501082_0278193 3300060353 Bacteria 1457
708 Ga0501082_0357918 3300060353 Bacteria 1273
709 Ga0501082_0363187 3300060353 Bacteria 1263
710 Ga0501082_0518156 3300060353 Bacteria 1042
711 Ga0501082_0665664 3300060353 Unclassified 911
712 Ga0501082_1535340 3300060353 Bacteria 581
713 Ga0501082_1700359 3300060353 Bacteria 551
714 Ga0530510_0003037 3300061734 Bacteria 11528
715 Ga0530510_0059056 3300061734 Bacteria 2774
716 Ga0530510_0140380 3300061734 Bacteria 1780
717 Ga0530510_0642681 3300061734 Bacteria 808
718 Ga0530510_1013162 3300061734 Bacteria 636
719 Ga0530510_1194546 3300061734 Bacteria 583
720 Ga0501077_0028442
721 Ga0070658_10020806
722 Ga0070658_10125516
723 Ga0070658_10741140
724 Ga0070676_10199609
725 Ga0070683_100012761
726 Ga0070683_100116559
727 Ga0070683_100163196
728 Ga0070683_100204920
729 Ga0070683_100266500
730 Ga0070683_101176794
731 Ga0070683_101284004
732 Ga0070683_101772363
733 Ga0070670_102072541
734 Ga0070677_10238963
735 Ga0068869_100109629
736 Ga0070666_10172962
737 Ga0070680_100013940
738 Ga0070680_100044542
739 Ga0070682_100001712
740 Ga0070682_100202698
741 Ga0070682_100230701
742 Ga0070682_100376022
743 Ga0070682_100778705
744 Ga0068868_100013592
745 Ga0068868_100060980
746 Ga0070660_100006223
747 Ga0070660_100504565
748 Ga0070691_10000781
749 Ga0070691_10454999
750 Ga0070691_10671094
751 Ga0070687_100011765
752 Ga0070687_100165662
753 Ga0070661_100051608
754 Ga0070661_100150713
755 Ga0070692_10004463
756 Ga0070668_100174976
757 Ga0070668_101100576
758 Ga0070668_101394095
759 Ga0070668_101775827
760 Ga0070669_100128448
761 Ga0070669_100669026
762 Ga0070675_100013253
763 Ga0070675_100143919
764 Ga0070675_100176508
765 Ga0070675_100238849
766 Ga0070675_100264615
767 Ga0070671_100127913
768 Ga0070671_100134573
769 Ga0070671_100198696
770 Ga0070671_100262053
771 Ga0070671_100577024
772 Ga0070674_100024608
773 Ga0070674_100026395
774 Ga0070674_100035054
775 Ga0070674_100164746
776 Ga0070674_100175982
777 Ga0070674_100215709
778 Ga0070674_100343715
779 Ga0070674_100741165
780 Ga0070673_100001958
781 Ga0070673_100058421
782 Ga0070673_100346818
783 Ga0070659_100006531
784 Ga0070659_100212870
785 Ga0070659_100843002
786 Ga0070701_10005023
787 Ga0070701_11072287
788 Ga0070705_100052487
789 Ga0070700_100024808
790 Ga0070700_100854187
791 Ga0070708_102090259
792 Ga0070663_100099721
793 Ga0070663_100382113
794 Ga0070663_100426144
795 Ga0070678_100019284
796 Ga0070678_100093811
797 Ga0070678_101308050
798 Ga0070678_101409162
799 Ga0070678_102295950
800 Ga0070662_100008794
801 Ga0070662_100464420
802 Ga0070662_101359677
803 Ga0070681_10143620
804 Ga0070681_10325545
805 Ga0068867_100011666
806 Ga0068867_100095123
807 Ga0068867_100446742
808 Ga0068867_100532640
809 Ga0070685_10009536
810 Ga0070685_10041854
811 Ga0070698_100712639
812 Ga0070679_100027697
813 Ga0070679_100924593
814 Ga0070684_100016734
815 Ga0070684_100047370
816 Ga0070684_100053101
817 Ga0070684_100118958
818 Ga0070684_100687447
819 Ga0068853_100002053
820 Ga0070672_100012897
821 Ga0070672_100019493
822 Ga0070672_100112092
823 Ga0070672_100491269
824 Ga0070686_100116613
825 Ga0070686_100943102
826 Ga0070696_100178383
827 Ga0070696_101392235
828 Ga0070693_100046774
829 Ga0070693_100609833
830 Ga0070665_100087089
831 Ga0070665_100479102
832 Ga0070665_101567738
833 Ga0068855_101222037
834 Ga0070664_100011913
835 Ga0068857_100033412
836 Ga0068857_100105667
837 Ga0068857_100301716
838 Ga0068857_100450002
839 Ga0068854_100005835
840 Ga0068854_100274199
841 Ga0068856_100113518
842 Ga0070702_100009253
843 Ga0070702_100145435
844 Ga0068852_100002371
845 Ga0068859_100081776
846 Ga0068859_100476956
847 Ga0068864_100104963
848 Ga0068864_100856098
849 Ga0068864_101261974
850 Ga0068866_10050031
851 Ga0068866_10174499
852 Ga0068866_10197785
853 Ga0068866_10636179
854 Ga0068866_10699229
855 Ga0068866_10737600
856 Ga0068866_10758397
857 Ga0068861_100113603
858 Ga0068861_101756336
859 Ga0068851_10134690
860 Ga0068851_10216565
861 Ga0068851_10493845
862 Ga0068870_10000685
863 Ga0068870_10186527
864 Ga0068870_10655382
865 Ga0068863_100098876
866 Ga0068863_101914888
867 Ga0068858_100222261
868 Ga0068858_100575290
869 Ga0068860_100113669
870 Ga0068860_100179105
871 Ga0068860_100486778
872 Ga0068862_101127921
873 Ga0081455_10011342
874 Ga0081455_10064761
875 Ga0081455_10071664
876 Ga0081538_10001394
877 Ga0081539_10001263
878 Ga0075365_10202266
879 Ga0075365_10760253
880 Ga0075364_10101016
881 Ga0075364_11163294
882 Ga0075367_10945511
883 Ga0097621_100116158
884 Ga0097621_100249430
885 Ga0097621_100864649
886 Ga0097621_100986186
887 Ga0068871_100036187
888 Ga0068871_100641381
889 Ga0075428_100188205
890 Ga0075430_100186571
891 Ga0075433_11707393
892 Ga0075434_101462697
893 Ga0075429_100633080
894 Ga0075429_101707060
895 Ga0068865_100014098
896 Ga0068865_100018100
897 Ga0068865_100212158
898 Ga0068865_100438663
899 Ga0068865_100823643
900 Ga0097620_100081781
901 Ga0097620_100476918
902 Ga0105240_11877604
903 Ga0105240_12621444
904 Ga0111539_10006960
905 Ga0111539_10074007
906 Ga0111539_10385516
907 Ga0111539_11695879
908 Ga0111539_11797939
909 Ga0111539_12559193
910 Ga0105245_10008068
911 Ga0105245_10068162
912 Ga0105245_10193633
913 Ga0105245_10265614
914 Ga0105245_10288603
915 Ga0105245_10364669
916 Ga0105245_10751275
917 Ga0105245_11863191
918 Ga0105247_10041631
919 Ga0105247_10994977
920 Ga0114129_10353057
921 Ga0114129_10451480
922 Ga0114129_10692940
923 Ga0114129_11077726
924 Ga0114129_11447774
925 Ga0114129_11790774
926 Ga0105243_10004018
927 Ga0105243_10007875
928 Ga0105243_10137679
929 Ga0105243_10372540
930 Ga0105243_11704686
931 Ga0105243_12465050
932 Ga0105242_10067548
933 Ga0105242_10142341
934 Ga0105242_10461250
935 Ga0105242_10791995
936 Ga0105248_10286384
937 Ga0105248_10647613
938 Ga0105248_11043744
939 Ga0105248_11414323
940 Ga0105248_13468566
941 Ga0105238_10021955
942 Ga0105238_10223925
943 Ga0105238_12682043
944 Ga0105249_10015358
945 Ga0105249_10067152
946 Ga0105249_10067633
947 Ga0105239_10021141
948 Ga0105239_10218530
949 Ga0105239_10600201
950 Ga0105239_10683993
951 Ga0105246_10026274
952 Ga0105246_10078279
953 Ga0105246_10129824
954 Ga0157326_1070366
955 Ga0157373_11393917
956 Ga0157371_10003237
957 Ga0157369_10172235
958 Ga0157374_11181696
959 Ga0157374_12227659
960 Ga0157378_11015008
961 Ga0157378_12537265
962 Ga0163162_10076833
963 Ga0163162_10492366
964 Ga0163162_11856261
965 Ga0157372_10008369
966 Ga0157372_12590993
967 Ga0157375_10048535
968 Ga0157375_10720262
969 Ga0157375_11286039
970 Ga0157375_12083114
971 Ga0163163_10130751
972 Ga0163163_10289425
973 Ga0163163_10857583
974 Ga0163163_10964601
975 Ga0163163_11071496
976 Ga0163163_11541761
977 Ga0163163_11901115
978 Ga0163163_12057016
979 Ga0157380_10018392
980 Ga0157380_10031987
981 Ga0157380_10090420
982 Ga0157380_10277994
983 Ga0157380_11277449
984 Ga0157380_12438997
985 Ga0157380_12679987
986 Ga0157377_10005725
987 Ga0157377_10046641
988 Ga0157377_10192467
989 Ga0157377_11492677
990 Ga0157379_10349401
991 Ga0157379_11099008
992 Ga0157379_11608103
993 Ga0157376_10023873
994 Ga0157376_10228217
995 Ga0157376_10350635
996 Ga0157376_10384221
997 Ga0157376_10694176
998 Ga0163161_10135225
999 Ga0163161_10170556
1000 Ga0163161_10616943
1001 Ga0207656_10288057
1002 Ga0207656_10397228
1003 Ga0207642_10034392
1004 Ga0207688_10012183
1005 Ga0207688_10014657
1006 Ga0207688_10849052
1007 Ga0207680_10118518
1008 Ga0207680_10726080
1009 Ga0207647_10084225
1010 Ga0207645_10192233
1011 Ga0207643_10002875
1012 Ga0207643_10020606
1013 Ga0207643_10131343
1014 Ga0207643_10149907
1015 Ga0207705_10142417
1016 Ga0207654_10988194
1017 Ga0207707_10177704
1018 Ga0207660_10178798
1019 Ga0207662_10405667
1020 Ga0207657_10005874
1021 Ga0207657_10115501
1022 Ga0207649_10235848
1023 Ga0207649_10477406
1024 Ga0207652_10163111
1025 Ga0207652_10370220
1026 Ga0207652_11817084
1027 Ga0207694_10085310
1028 Ga0207650_10010107
1029 Ga0207650_10336404
1030 Ga0207650_10391692
1031 Ga0207659_10125900
1032 Ga0207687_10014081
1033 Ga0207687_10095754
1034 Ga0207687_10182411
1035 Ga0207687_10675279
1036 Ga0207687_11263785
1037 Ga0207644_10107407
1038 Ga0207644_10486246
1039 Ga0207644_10761133
1040 Ga0207644_10971200
1041 Ga0207644_11483086
1042 Ga0207690_10558569
1043 Ga0207706_10006537
1044 Ga0207706_10119519
1045 Ga0207706_10330671
1046 Ga0207686_10166983
1047 Ga0207686_10251933
1048 Ga0207686_10466096
1049 Ga0207686_10687048
1050 Ga0207686_11041167
1051 Ga0207709_10029522
1052 Ga0207709_10041070
1053 Ga0207709_10060410
1054 Ga0207709_11296535
1055 Ga0207670_10012823
1056 Ga0207669_10158728
1057 Ga0207669_10208407
1058 Ga0207669_10301324
1059 Ga0207669_10511961
1060 Ga0207669_10521426
1061 Ga0207669_10897440
1062 Ga0207669_11100086
1063 Ga0207704_10061154
1064 Ga0207704_11009042
1065 Ga0207704_11131668
1066 Ga0207704_11640817
1067 Ga0207691_10006369
1068 Ga0207691_10008449
1069 Ga0207691_10079394
1070 Ga0207691_11183076
1071 Ga0207711_10158564
1072 Ga0207711_10171587
1073 Ga0207711_10216703
1074 Ga0207661_10014245
1075 Ga0207661_10035968
1076 Ga0207661_10070450
1077 Ga0207661_10389751
1078 Ga0207661_10530880
1079 Ga0207661_10960543
1080 Ga0207661_11704536
1081 Ga0207679_10335643
1082 Ga0207679_11117337
1083 Ga0207667_10191644
1084 Ga0207651_10068544
1085 Ga0207651_10297401
1086 Ga0207651_10939350
1087 Ga0207712_10052654
1088 Ga0207712_10312348
1089 Ga0207668_11681396
1090 Ga0207640_10044988
1091 Ga0207640_11374061
1092 Ga0207658_10251207
1093 Ga0207658_11069638
1094 Ga0207677_10210254
1095 Ga0207677_10308783
1096 Ga0207677_11499192
1097 Ga0207703_10080882
1098 Ga0207703_10127398
1099 Ga0207639_10184083
1100 Ga0207639_10520389
1101 Ga0207678_10046202
1102 Ga0207678_10093063
1103 Ga0207678_10418915
1104 Ga0207678_10430975
1105 Ga0207708_10038706
1106 Ga0207708_10453528
1107 Ga0207708_11101480
1108 Ga0207708_11641790
1109 Ga0207702_10137847
1110 Ga0207702_10151131
1111 Ga0207641_10740567
1112 Ga0207641_10874658
1113 Ga0207641_12066872
1114 Ga0207648_10009895
1115 Ga0207648_10092382
1116 Ga0207648_10173742
1117 Ga0207648_10658844
1118 Ga0207648_10745147
1119 Ga0207648_11187397
1120 Ga0207676_10029132
1121 Ga0207676_10090067
1122 Ga0207676_10572265
1123 Ga0207674_10018022
1124 Ga0207674_10281330
1125 Ga0207674_10426357
1126 Ga0207675_100084663
1127 Ga0207675_100260370
1128 Ga0207675_100285492
1129 Ga0207683_10031736
1130 Ga0207683_10094502
1131 Ga0207683_10134886
1132 Ga0207683_10319832
1133 Ga0207683_10356898
1134 Ga0207683_12196911
1135 Ga0207698_10028103
1136 Ga0207698_10095357
1137 Ga0207698_10518620
1138 Ga0207698_10611624
1139 Ga0268266_10409827
1140 Ga0268265_10225582
1141 Ga0268265_10327062
1142 Ga0268265_11038064
1143 Ga0268264_10140205
1144 Ga0268264_10265222
1145 Ga0307408_100617055
1146 Ga0307408_102453957
1147 Ga0307409_102745913
1148 Ga0307416_100454147
1149 Ga0373951_0137168
1150 Ga0373942_0111994
1151 Ga0451804_0721543
1152 Ga0451807_1895063
1153 Ga0451853_2549579
1154 Ga0451853_2874699
1155 Ga0439463_013509
1156 Ga0450902_105809
1157 Ga0450906_015068
1158 Ga0450907_007288
1159 Ga0450908_039235
1160 Ga0450918_081047
1161 Ga0453683_0538970
1162 Ga0495603_0007432
1163 Ga0495603_0146681
1164 Ga0495603_0867761
1165 Ga0495641_0483541
1166 Ga0495653_0922998
1167 Ga0495582_0803114
1168 Ga0495631_0205104
1169 Ga0495631_0216032
1170 Ga0495644_0098290
1171 Ga0495663_0265051
1172 Ga0495587_0550245
1173 Ga0495656_0016568
1174 Ga0495656_0159212
1175 Ga0495656_0262546
1176 Ga0495656_0292269
1177 Ga0495656_0569530
1178 Ga0495611_0354771
1179 Ga0495635_0169751
1180 Ga0495588_0326999
1181 Ga0495588_0520010
1182 Ga0495657_0076277
1183 Ga0495671_0170934
1184 Ga0495589_0216495
1185 Ga0495589_0353498
1186 Ga0495604_0381666
1187 Ga0495674_0010972
1188 Ga0496100_0421230
1189 Ga0496100_0784341
1190 Ga0496101_0373463
1191 Ga0496101_0719916
1192 Ga0496102_0374508
1193 Ga0496102_1868497
1194 Ga0496104_0160961
1195 Ga0496104_1450349
1196 Ga0496105_0154420
1197 Ga0496105_0741211
1198 Ga0496107_0207087
1199 Ga0496107_0311772
1200 Ga0496107_0424615
1201 Ga0496108_0074930
1202 Ga0496108_0631214
1203 Ga0496108_0640542
1204 Ga0496108_1437587
1205 Ga0496109_0246817
1206 Ga0496109_1537389
1207 Ga0496110_0233407
1208 Ga0496111_0021052
1209 Ga0496111_0103492
1210 Ga0496111_1261095
1211 Ga0496114_0048478
1212 Ga0496114_0101719
1213 Ga0496114_0544188
1214 Ga0496114_0658644
1215 Ga0501031_0005742
1216 Ga0501031_0030821
1217 Ga0501031_0032813
1218 Ga0501031_0172835
1219 Ga0501031_0254597
1220 Ga0501031_0331320
1221 Ga0501032_0294593
1222 Ga0501033_0023999
1223 Ga0501033_0223902
1224 Ga0501034_0302561
1225 Ga0501036_0015890
1226 Ga0501036_0016429
1227 Ga0501036_0019052
1228 Ga0501036_0022425
1229 Ga0501036_0126475
1230 Ga0501036_0186225
1231 Ga0501036_0490701
1232 Ga0501036_0527690
1233 Ga0501037_0086920
1234 Ga0501037_0230640
1235 Ga0501038_0001233
1236 Ga0501038_0063079
1237 Ga0501038_0081404
1238 Ga0501038_0086589
1239 Ga0501038_0239779
1240 Ga0501039_0002571
1241 Ga0501039_0042951
1242 Ga0501039_0202075
1243 Ga0501039_0491962
1244 Ga0501040_0021623
1245 Ga0501040_0057485
1246 Ga0501040_0064842
1247 Ga0501040_0177247
1248 Ga0501040_0201982
1249 Ga0501040_0216803
1250 Ga0501040_0298707
1251 Ga0501041_0016374
1252 Ga0501041_0067223
1253 Ga0501041_0084006
1254 Ga0501041_0457128
1255 Ga0501041_0815030
1256 Ga0501042_0001944
1257 Ga0501042_0013760
1258 Ga0501042_0023089
1259 Ga0501042_0029424
1260 Ga0501042_0029643
1261 Ga0501042_0066670
1262 Ga0501043_0038684
1263 Ga0501043_0060335
1264 Ga0501043_0081171
1265 Ga0501043_0128699
1266 Ga0501046_0002238
1267 Ga0501046_0046873
1268 Ga0501046_0126345
1269 Ga0501046_0287048
1270 Ga0501048_0010299
1271 Ga0501048_0022562
1272 Ga0501048_0069452
1273 Ga0501048_0079666
1274 Ga0501048_0123624
1275 Ga0501048_0835779
1276 Ga0501067_0007721
1277 Ga0501067_0017547
1278 Ga0501067_0403022
1279 Ga0501068_0032416
1280 Ga0501068_0041064
1281 Ga0501068_0340274
1282 Ga0501068_0973970
1283 Ga0501069_0007569
1284 Ga0501069_0029282
1285 Ga0501069_0056277
1286 Ga0501069_0188959
1287 Ga0501069_0383137
1288 Ga0501069_0590548
1289 Ga0501070_0021898
1290 Ga0501070_0056221
1291 Ga0501070_0078905
1292 Ga0501070_0481905
1293 Ga0501071_0015825
1294 Ga0501071_0026430
1295 Ga0501071_0041548
1296 Ga0501071_0062523
1297 Ga0501071_0081894
1298 Ga0501071_0207622
1299 Ga0501071_0249725
1300 Ga0501071_0468716
1301 Ga0501071_0639434
1302 Ga0501071_1025061
1303 Ga0501072_0015977
1304 Ga0501072_0041305
1305 Ga0501072_0045386
1306 Ga0501072_0069967
1307 Ga0501072_0079048
1308 Ga0501072_0104506
1309 Ga0501072_0317278
1310 Ga0501073_0053563
1311 Ga0501073_0313037
1312 Ga0501074_0015498
1313 Ga0501074_0016179
1314 Ga0501074_0019682
1315 Ga0501074_0029712
1316 Ga0501074_0227394
1317 Ga0501074_0513004
1318 Ga0501074_0616857
1319 Ga0501075_0020640
1320 Ga0501075_0029430
1321 Ga0501075_0042558
1322 Ga0501075_0072840
1323 Ga0501075_0091945
1324 Ga0501075_0101065
1325 Ga0501075_0260162
1326 Ga0501075_1055731
1327 Ga0501076_0017170
1328 Ga0501076_0041066
1329 Ga0501076_0042002
1330 Ga0501076_0044689
1331 Ga0501076_0069701
1332 Ga0501076_0080631
1333 Ga0501076_0108028
1334 Ga0501076_0365248
1335 Ga0501076_0392689
1336 Ga0501076_0976121
1337 Ga0501076_1783658
1338 Ga0501077_0008860
1339 Ga0501077_0015815
1340 Ga0501077_0020119
1341 Ga0501077_0036010
1342 Ga0501077_0048282
1343 Ga0501077_0299344
1344 Ga0501077_0539338
1345 Ga0501077_0688714
1346 Ga0501079_0042134
1347 Ga0501079_0052745
1348 Ga0501079_0069293
1349 Ga0501079_0086551
1350 Ga0501079_0229335
1351 Ga0501079_0366321
1352 Ga0501080_0032915
1353 Ga0501080_0033295
1354 Ga0501080_0037636
1355 Ga0501080_0056973
1356 Ga0501080_0076337
1357 Ga0501080_0097529
1358 Ga0501080_0478851
1359 Ga0501080_0610216
1360 Ga0501080_0783550
1361 Ga0501080_1268085
1362 Ga0501081_0005337
1363 Ga0501081_0017215
1364 Ga0501081_0070783
1365 Ga0501081_0096120
1366 Ga0501081_0097930
1367 Ga0501081_0150992
1368 Ga0501081_0210410
1369 Ga0501081_0218427
1370 Ga0501083_0001237
1371 Ga0501083_0019007
1372 Ga0501083_0070801
1373 Ga0501083_0078168
1374 Ga0501083_0194040
1375 Ga0501083_1112286
1376 Ga0501035_0006912
1377 Ga0501035_0092494
1378 Ga0501035_0242379
1379 Ga0501035_0551313
1380 Ga0501044_0194459
1381 Ga0501044_0317303
1382 Ga0501045_0021740
1383 Ga0501045_0026671
1384 Ga0501045_0037507
1385 Ga0501045_0046832
1386 Ga0501045_0095884
1387 Ga0501045_0154153
1388 Ga0501045_0309378
1389 Ga0501045_0371313
1390 Ga0501045_0436225
1391 Ga0501045_0531236
1392 nmdc:mga00v17_167978_c1
1393 nmdc:mga0yw44_15657_c1
1394 nmdc:mga0yw44_707987_c1
1395 nmdc:mga06z11_392600_c1
1396 nmdc:mga05p37_1057987_c1
1397 nmdc:mga05p37_1712565_c1
1398 nmdc:mga05p37_2019990_c1
1399 nmdc:mga05p37_212203_c1
1400 nmdc:mga05p37_265010_c1
1401 nmdc:mga05p37_445176_c1
1402 nmdc:mga09592_1144571_c1
1403 nmdc:mga0qj67_80648_c1
1404 nmdc:mga06r32_73161_c1
1405 nmdc:mga08y16_10062_c1
1406 nmdc:mga08y16_258391_c1
1407 nmdc:mga0n895_1869818_c1
1408 nmdc:mga0rr50_443861_c1
1409 nmdc:mga08x19_1166353_c1
1410 nmdc:mga0a205_1344455_c1
1411 Ga0495619_0011342
1412 Ga0501084_0006937
1413 Ga0501084_0008276
1414 Ga0501084_0038942
1415 Ga0501084_0049123
1416 Ga0501084_0104713
1417 Ga0501084_0105788
1418 Ga0501084_0427384
1419 Ga0501084_0820090
1420 Ga0501082_0016449
1421 Ga0501082_0017102
1422 Ga0501082_0061060
1423 Ga0501082_0119332
1424 Ga0501082_0123555
1425 Ga0501082_0188650
1426 Ga0501082_0278193
1427 Ga0501082_0357918
1428 Ga0501082_0363187
1429 Ga0501082_0518156
1430 Ga0501082_0665664
1431 Ga0501082_1535340
1432 Ga0501082_1700359
1433 Ga0530510_0003037
1434 Ga0530510_0059056
1435 Ga0530510_0140380
1436 Ga0530510_0642681
1437 Ga0530510_1013162
1438 Ga0530510_1194546

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6v7u-assembly1.cif.gz_A structure of a phage-encoded quorum sensing anti-activator, aqs1 0.8617 23 69
1gsq-assembly1.cif.gz_A three-dimensional structure, catalytic properties and evolution of a sigma class glutathione transferase from squid, a progenitor of the lens-crystallins of cephalopods 0.8067 21 64
4djg-assembly1.cif.gz_B crystal structure of the coiled-coil 1 domain of actin-binding protein scab1 0.7845 22 64
4djg-assembly1.cif.gz_B crystal structure of the coiled-coil 1 domain of actin-binding protein scab1 0.703 22 64
6v7u-assembly1.cif.gz_A structure of a phage-encoded quorum sensing anti-activator, aqs1 0.6462 23 69
ID Description Score Start End Superfamily
4djgB00 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;ATP synthase delta/epsilon subunit, C-terminal domain 0.7845 22 64 1.20.5.440
4djgB00 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;ATP synthase delta/epsilon subunit, C-terminal domain 0.703 22 64 1.20.5.440
1serB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Serine-tRNA synthetase, tRNA binding domain 0.6995 12 69 1.10.287.40
2y3dA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6944 11 87 1.20.120.1490
1sesB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Serine-tRNA synthetase, tRNA binding domain 0.6852 12 69 1.10.287.40
ID Description Score Start End GO Terms
AF-A0A538MB04-F1-model_v4 Uncharacterized protein 0.995 3 87
AF-A0A7V9FXW7-F1-model_v4 Uncharacterized protein 0.9842 3 96
AF-A0A537TPC9-F1-model_v4 Uncharacterized protein 0.9816 11 98
AF-A0A7V9I497-F1-model_v4 Uncharacterized protein 0.9767 4 99
AF-A0A538HSN3-F1-model_v4 Uncharacterized protein 0.9511 1 102

Map