F477270
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 719 | 192 | 1438 | 139 |
Family's Representative Sequence
| Representative Sequence | 3300047321|Ga0495676_0957863|Ga0495676_0957863_56_532 |
| Length | 158 |
| Sequence | LPEDPEDVEQIDSRQEQGAEMSGSRKEVLSNALKAEVGGASVDLKTLFTDDVVGWSPYATVSGLAALADLSALREAAFSNVVITFRGLDEVGNKAFAEWLVDADHTGPLVLDEDAVLEATGRHVQLPGVTVADFREGKIRSFRTYFDDISLIEQIAGV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 26 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 28 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 29 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 30 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 31 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 32 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 33 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 35 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 37 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 38 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 39 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 40 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 41 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 51 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 52 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 53 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 54 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 63 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 64 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 83 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 84 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 85 | 3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 86 | 3300031043 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 87 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 88 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 89 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 90 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 91 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 92 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 93 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 94 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 95 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 96 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 97 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 98 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 99 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 100 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 101 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 102 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 103 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 104 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 105 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 106 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 107 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 108 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 109 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 110 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 111 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 112 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 113 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 114 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 115 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 116 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 117 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 118 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 119 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 174 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 175 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 176 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 177 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 179 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 180 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 181 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 182 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 183 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 192 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.61 |
| Metatranscriptomes | 1.39 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.14 |
| Nodule | 0 |
| Rhizoplane | 3.06 |
| Rhizosphere | 95.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 26.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495676_0957863 | 3300047321 | Unclassified | 547 |
| 2 | Ga0058860_12147630 | 3300004801 | Bacteria | 920 |
| 3 | Ga0070683_100911950 | 3300005329 | Unclassified | 843 |
| 4 | Ga0070690_100448466 | 3300005330 | Bacteria | 956 |
| 5 | Ga0070682_100861778 | 3300005337 | Unclassified | 741 |
| 6 | Ga0068868_100660031 | 3300005338 | Archaea | 932 |
| 7 | Ga0070671_100854282 | 3300005355 | Bacteria | 794 |
| 8 | Ga0070674_100166636 | 3300005356 | Bacteria | 1676 |
| 9 | Ga0070688_100291532 | 3300005365 | Bacteria | 1176 |
| 10 | Ga0070709_10820875 | 3300005434 | Unclassified | 731 |
| 11 | Ga0070714_100158672 | 3300005435 | Unclassified | 2044 |
| 12 | Ga0070714_100395268 | 3300005435 | Archaea | 1306 |
| 13 | Ga0070714_100919108 | 3300005435 | Bacteria | 850 |
| 14 | Ga0070713_100455694 | 3300005436 | Bacteria | 1202 |
| 15 | Ga0070713_101749956 | 3300005436 | Bacteria | 603 |
| 16 | Ga0070701_10360338 | 3300005438 | Bacteria | 911 |
| 17 | Ga0070711_100171764 | 3300005439 | Archaea | 1653 |
| 18 | Ga0070711_100764735 | 3300005439 | Bacteria | 817 |
| 19 | Ga0070705_100088165 | 3300005440 | Bacteria | 1925 |
| 20 | Ga0070708_100322729 | 3300005445 | Bacteria | 1455 |
| 21 | Ga0070663_100855224 | 3300005455 | Unclassified | 783 |
| 22 | Ga0070662_100194576 | 3300005457 | Unclassified | 1606 |
| 23 | Ga0070685_10069841 | 3300005466 | Bacteria | 2079 |
| 24 | Ga0070706_100848857 | 3300005467 | Bacteria | 844 |
| 25 | Ga0070698_101203437 | 3300005471 | Unclassified | 707 |
| 26 | Ga0070684_100900318 | 3300005535 | Bacteria | 829 |
| 27 | Ga0070672_101350101 | 3300005543 | Bacteria | 637 |
| 28 | Ga0070704_100697779 | 3300005549 | Bacteria | 900 |
| 29 | Ga0070704_101179136 | 3300005549 | Unclassified | 698 |
| 30 | Ga0068856_101407198 | 3300005614 | Unclassified | 712 |
| 31 | Ga0070702_100170416 | 3300005615 | Bacteria | 1415 |
| 32 | Ga0068852_100423830 | 3300005616 | Bacteria | 1313 |
| 33 | Ga0068859_100563017 | 3300005617 | Bacteria | 1234 |
| 34 | Ga0068864_101259582 | 3300005618 | Unclassified | 739 |
| 35 | Ga0068866_10500573 | 3300005718 | Unclassified | 804 |
| 36 | Ga0068861_100254578 | 3300005719 | Bacteria | 1500 |
| 37 | Ga0068861_101415183 | 3300005719 | Bacteria | 680 |
| 38 | Ga0068870_10033345 | 3300005840 | Bacteria | 2627 |
| 39 | Ga0068870_11056698 | 3300005840 | Unclassified | 582 |
| 40 | Ga0070717_10080475 | 3300006028 | Bacteria | 2733 |
| 41 | Ga0070717_10212822 | 3300006028 | Unclassified | 1697 |
| 42 | Ga0070717_10396154 | 3300006028 | Bacteria | 1240 |
| 43 | Ga0075365_10929413 | 3300006038 | Unclassified | 613 |
| 44 | Ga0070712_101696139 | 3300006175 | Unclassified | 553 |
| 45 | Ga0070712_101777739 | 3300006175 | Unclassified | 540 |
| 46 | Ga0075428_100011145 | 3300006844 | Bacteria | 10005 |
| 47 | Ga0075430_100001957 | 3300006846 | Bacteria | 16928 |
| 48 | Ga0075431_100059027 | 3300006847 | Bacteria | 3959 |
| 49 | Ga0075429_100007113 | 3300006880 | Bacteria | 9719 |
| 50 | Ga0068865_100083280 | 3300006881 | Bacteria | 2302 |
| 51 | Ga0097620_100562915 | 3300006931 | Bacteria | 1234 |
| 52 | Ga0105247_10778011 | 3300009101 | Unclassified | 728 |
| 53 | Ga0114129_10037659 | 3300009147 | Bacteria | 6827 |
| 54 | Ga0105243_10119598 | 3300009148 | Unclassified | 2218 |
| 55 | Ga0105241_12165054 | 3300009174 | Unclassified | 551 |
| 56 | Ga0105242_11079845 | 3300009176 | Unclassified | 815 |
| 57 | Ga0105248_13087399 | 3300009177 | Bacteria | 530 |
| 58 | Ga0105249_10156089 | 3300009553 | Bacteria | 2201 |
| 59 | Ga0105249_12352028 | 3300009553 | Bacteria | 605 |
| 60 | Ga0105246_10201131 | 3300011119 | Bacteria | 1549 |
| 61 | Ga0105246_11239883 | 3300011119 | Unclassified | 688 |
| 62 | Ga0157320_1010558 | 3300012481 | Unclassified | 714 |
| 63 | Ga0157329_1019109 | 3300012491 | Unclassified | 627 |
| 64 | Ga0157347_1030211 | 3300012502 | Unclassified | 676 |
| 65 | Ga0157342_1006678 | 3300012507 | Bacteria | 1100 |
| 66 | Ga0157374_11159329 | 3300013296 | Bacteria | 794 |
| 67 | Ga0163162_10217936 | 3300013306 | Bacteria | 2038 |
| 68 | Ga0163162_10904207 | 3300013306 | Unclassified | 996 |
| 69 | Ga0157375_10037248 | 3300013308 | Bacteria | 4659 |
| 70 | Ga0157375_10226515 | 3300013308 | Bacteria | 2028 |
| 71 | Ga0157375_12589035 | 3300013308 | Unclassified | 606 |
| 72 | Ga0163163_11085742 | 3300014325 | Bacteria | 863 |
| 73 | Ga0157380_10597438 | 3300014326 | Bacteria | 1091 |
| 74 | Ga0157379_10168253 | 3300014968 | Bacteria | 1979 |
| 75 | Ga0157379_10562805 | 3300014968 | Archaea | 1061 |
| 76 | Ga0157376_10669991 | 3300014969 | Unclassified | 1040 |
| 77 | Ga0163161_10586393 | 3300017792 | Bacteria | 917 |
| 78 | Ga0224572_1030457 | 3300024225 | Bacteria | 1030 |
| 79 | Ga0224572_1054413 | 3300024225 | Unclassified | 744 |
| 80 | Ga0228598_1100399 | 3300024227 | Unclassified | 584 |
| 81 | Ga0207699_11015543 | 3300025906 | Unclassified | 613 |
| 82 | Ga0207643_10431593 | 3300025908 | Unclassified | 836 |
| 83 | Ga0207684_10393080 | 3300025910 | Bacteria | 1192 |
| 84 | Ga0207693_10539446 | 3300025915 | Bacteria | 910 |
| 85 | Ga0207693_10667974 | 3300025915 | Unclassified | 806 |
| 86 | Ga0207663_10032558 | 3300025916 | Unclassified | 3096 |
| 87 | Ga0207663_10336000 | 3300025916 | Bacteria | 1139 |
| 88 | Ga0207662_10451069 | 3300025918 | Bacteria | 879 |
| 89 | Ga0207664_10123682 | 3300025929 | Bacteria | 2169 |
| 90 | Ga0207664_10452318 | 3300025929 | Bacteria | 1146 |
| 91 | Ga0207664_10771787 | 3300025929 | Bacteria | 865 |
| 92 | Ga0207709_10645584 | 3300025935 | Unclassified | 842 |
| 93 | Ga0207669_10053793 | 3300025937 | Bacteria | 2428 |
| 94 | Ga0207704_10123748 | 3300025938 | Bacteria | 1776 |
| 95 | Ga0207665_10315573 | 3300025939 | Bacteria | 1172 |
| 96 | Ga0207712_10440344 | 3300025961 | Bacteria | 1103 |
| 97 | Ga0207712_11932633 | 3300025961 | Unclassified | 528 |
| 98 | Ga0207678_10279383 | 3300026067 | Bacteria | 1433 |
| 99 | Ga0207708_10016057 | 3300026075 | Bacteria | 5624 |
| 100 | Ga0207702_12014045 | 3300026078 | Unclassified | 568 |
| 101 | Ga0207648_10239075 | 3300026089 | Bacteria | 1617 |
| 102 | Ga0207676_10172276 | 3300026095 | Bacteria | 1887 |
| 103 | Ga0207675_100106079 | 3300026118 | Unclassified | 2649 |
| 104 | Ga0265763_1012179 | 3300030763 | Bacteria | 817 |
| 105 | Ga0265764_101786 | 3300030882 | Unclassified | 995 |
| 106 | Ga0265769_101982 | 3300030888 | Unclassified | 1038 |
| 107 | Ga0265768_102137 | 3300030963 | Unclassified | 989 |
| 108 | Ga0265779_102804 | 3300031043 | Unclassified | 854 |
| 109 | Ga0265760_10135165 | 3300031090 | Bacteria | 800 |
| 110 | Ga0373926_0001163 | 3300035083 | Bacteria | 7830 |
| 111 | Ga0373926_0034575 | 3300035083 | Bacteria | 1790 |
| 112 | Ga0373934_0002736 | 3300035086 | Bacteria | 6473 |
| 113 | Ga0373934_0004451 | 3300035086 | Bacteria | 5177 |
| 114 | Ga0373934_0067502 | 3300035086 | Bacteria | 1428 |
| 115 | Ga0373934_0075789 | 3300035086 | Bacteria | 1348 |
| 116 | Ga0373934_0290011 | 3300035086 | Bacteria | 678 |
| 117 | Ga0373944_0025164 | 3300035089 | Bacteria | 1750 |
| 118 | Ga0373944_0057884 | 3300035089 | Bacteria | 1236 |
| 119 | Ga0373923_0000427 | 3300035111 | Bacteria | 9877 |
| 120 | Ga0373923_0005768 | 3300035111 | Bacteria | 4226 |
| 121 | Ga0373923_0010304 | 3300035111 | Unclassified | 3397 |
| 122 | Ga0373923_0093355 | 3300035111 | Bacteria | 1319 |
| 123 | Ga0373923_0133208 | 3300035111 | Bacteria | 1118 |
| 124 | Ga0373936_0001898 | 3300035113 | Bacteria | 7711 |
| 125 | Ga0373936_0020934 | 3300035113 | Unclassified | 2542 |
| 126 | Ga0373936_0210011 | 3300035113 | Bacteria | 861 |
| 127 | Ga0373936_0210788 | 3300035113 | Bacteria | 860 |
| 128 | Ga0373936_0231032 | 3300035113 | Unclassified | 823 |
| 129 | Ga0373945_0000597 | 3300035116 | Bacteria | 10357 |
| 130 | Ga0373945_0335894 | 3300035116 | Bacteria | 653 |
| 131 | Ga0373945_0339669 | 3300035116 | Bacteria | 649 |
| 132 | Ga0373945_0403701 | 3300035116 | Unclassified | 599 |
| 133 | Ga0373945_0422820 | 3300035116 | Unclassified | 586 |
| 134 | Ga0373953_0000374 | 3300035117 | Bacteria | 12105 |
| 135 | Ga0373953_0013667 | 3300035117 | Unclassified | 2903 |
| 136 | Ga0373953_0023639 | 3300035117 | Bacteria | 2327 |
| 137 | Ga0373953_0223926 | 3300035117 | Bacteria | 815 |
| 138 | Ga0373954_0000186 | 3300035118 | Bacteria | 22463 |
| 139 | Ga0373954_0009080 | 3300035118 | Bacteria | 4371 |
| 140 | Ga0373954_0034478 | 3300035118 | Bacteria | 2344 |
| 141 | Ga0373954_0048031 | 3300035118 | Bacteria | 1999 |
| 142 | Ga0373954_0160205 | 3300035118 | Bacteria | 1101 |
| 143 | Ga0373956_0001521 | 3300035119 | Bacteria | 9583 |
| 144 | Ga0373956_0002099 | 3300035119 | Bacteria | 8261 |
| 145 | Ga0373956_0013386 | 3300035119 | Bacteria | 3414 |
| 146 | Ga0373956_0415012 | 3300035119 | Bacteria | 642 |
| 147 | Ga0373957_0000187 | 3300035120 | Bacteria | 15720 |
| 148 | Ga0373957_0026464 | 3300035120 | Bacteria | 2098 |
| 149 | Ga0373957_0058732 | 3300035120 | Bacteria | 1486 |
| 150 | Ga0373957_0122359 | 3300035120 | Bacteria | 1054 |
| 151 | Ga0373943_0002992 | 3300035170 | Bacteria | 7676 |
| 152 | Ga0373943_0024226 | 3300035170 | Bacteria | 2828 |
| 153 | Ga0373943_0468854 | 3300035170 | Bacteria | 733 |
| 154 | Ga0373946_0006797 | 3300035171 | Bacteria | 4160 |
| 155 | Ga0373946_0600356 | 3300035171 | Unclassified | 571 |
| 156 | Ga0373955_0002773 | 3300035172 | Bacteria | 7685 |
| 157 | Ga0373955_0009271 | 3300035172 | Bacteria | 4609 |
| 158 | Ga0373955_0016274 | 3300035172 | Bacteria | 3657 |
| 159 | Ga0373955_0026121 | 3300035172 | Unclassified | 3004 |
| 160 | Ga0373955_0146982 | 3300035172 | Bacteria | 1385 |
| 161 | Ga0373955_0149843 | 3300035172 | Bacteria | 1372 |
| 162 | Ga0373955_0172384 | 3300035172 | Unclassified | 1281 |
| 163 | Ga0373955_0190618 | 3300035172 | Bacteria | 1219 |
| 164 | Ga0373955_0198378 | 3300035172 | Unclassified | 1194 |
| 165 | Ga0373924_0006124 | 3300035410 | Unclassified | 4294 |
| 166 | Ga0373924_0020737 | 3300035410 | Bacteria | 2557 |
| 167 | Ga0373924_0034415 | 3300035410 | Bacteria | 2050 |
| 168 | Ga0373924_0120685 | 3300035410 | Bacteria | 1137 |
| 169 | Ga0373924_0250473 | 3300035410 | Bacteria | 784 |
| 170 | Ga0373924_0295951 | 3300035410 | Bacteria | 718 |
| 171 | Ga0373924_0475150 | 3300035410 | Unclassified | 561 |
| 172 | Ga0373935_0000420 | 3300035692 | Bacteria | 22090 |
| 173 | Ga0373935_0016029 | 3300035692 | Unclassified | 4535 |
| 174 | Ga0373935_0181080 | 3300035692 | Bacteria | 1447 |
| 175 | Ga0373935_0194519 | 3300035692 | Bacteria | 1399 |
| 176 | Ga0373935_0212242 | 3300035692 | Unclassified | 1342 |
| 177 | Ga0373935_0274836 | 3300035692 | Bacteria | 1185 |
| 178 | Ga0373935_0391492 | 3300035692 | Bacteria | 997 |
| 179 | Ga0373935_1160731 | 3300035692 | Bacteria | 575 |
| 180 | Ga0373927_0006811 | 3300035695 | Bacteria | 7773 |
| 181 | Ga0373927_0097672 | 3300035695 | Bacteria | 1909 |
| 182 | Ga0373933_0002355 | 3300035724 | Bacteria | 10694 |
| 183 | Ga0373933_0002703 | 3300035724 | Bacteria | 9933 |
| 184 | Ga0373933_0033301 | 3300035724 | Bacteria | 2996 |
| 185 | Ga0373933_0056065 | 3300035724 | Bacteria | 2365 |
| 186 | Ga0373933_0082373 | 3300035724 | Bacteria | 1974 |
| 187 | Ga0373933_0125326 | 3300035724 | Unclassified | 1611 |
| 188 | Ga0373933_0500072 | 3300035724 | Unclassified | 796 |
| 189 | Ga0373933_1024715 | 3300035724 | Unclassified | 544 |
| 190 | Ga0373947_0014651 | 3300035725 | Bacteria | 4496 |
| 191 | Ga0373947_0042665 | 3300035725 | Bacteria | 2708 |
| 192 | Ga0373947_0048964 | 3300035725 | Unclassified | 2536 |
| 193 | Ga0373947_0143735 | 3300035725 | Bacteria | 1532 |
| 194 | Ga0373947_0209792 | 3300035725 | Unclassified | 1277 |
| 195 | Ga0373947_0255295 | 3300035725 | Bacteria | 1160 |
| 196 | Ga0373947_0900616 | 3300035725 | Unclassified | 604 |
| 197 | Ga0373947_1233437 | 3300035725 | Bacteria | 509 |
| 198 | Ga0373937_0012275 | 3300036401 | Bacteria | 7529 |
| 199 | Ga0373937_0017124 | 3300036401 | Bacteria | 6447 |
| 200 | Ga0373937_0029120 | 3300036401 | Bacteria | 5000 |
| 201 | Ga0373937_0051694 | 3300036401 | Bacteria | 3766 |
| 202 | Ga0373937_0121404 | 3300036401 | Bacteria | 2435 |
| 203 | Ga0373937_0156022 | 3300036401 | Bacteria | 2139 |
| 204 | Ga0373937_0340923 | 3300036401 | Bacteria | 1419 |
| 205 | Ga0373937_0364157 | 3300036401 | Bacteria | 1370 |
| 206 | Ga0373937_0548746 | 3300036401 | Bacteria | 1098 |
| 207 | Ga0373937_0569121 | 3300036401 | Bacteria | 1076 |
| 208 | Ga0373937_0806766 | 3300036401 | Bacteria | 886 |
| 209 | Ga0373937_0861703 | 3300036401 | Bacteria | 854 |
| 210 | Ga0373937_0929598 | 3300036401 | Bacteria | 818 |
| 211 | Ga0373937_0974901 | 3300036401 | Bacteria | 796 |
| 212 | Ga0373937_1337304 | 3300036401 | Unclassified | 664 |
| 213 | Ga0373937_1379480 | 3300036401 | Bacteria | 653 |
| 214 | Ga0265778_042855 | 3300036457 | Bacteria | 606 |
| 215 | Ga0373925_0018409 | 3300037068 | Bacteria | 5076 |
| 216 | Ga0373925_0054638 | 3300037068 | Unclassified | 2987 |
| 217 | Ga0373925_0057407 | 3300037068 | Bacteria | 2916 |
| 218 | Ga0373925_0137018 | 3300037068 | Bacteria | 1913 |
| 219 | Ga0373925_0156540 | 3300037068 | Bacteria | 1792 |
| 220 | Ga0373925_0502595 | 3300037068 | Unclassified | 995 |
| 221 | Ga0373925_0779881 | 3300037068 | Unclassified | 788 |
| 222 | Ga0373925_0953804 | 3300037068 | Unclassified | 707 |
| 223 | Ga0395899_0167791 | 3300037312 | Unclassified | 1547 |
| 224 | Ga0395899_0247823 | 3300037312 | Bacteria | 1223 |
| 225 | Ga0395898_0023974 | 3300037466 | Bacteria | 6157 |
| 226 | Ga0395905_0844899 | 3300037471 | Unclassified | 818 |
| 227 | Ga0436361_0651804 | 3300039447 | Bacteria | 640 |
| 228 | Ga0436362_0249601 | 3300039453 | Unclassified | 744 |
| 229 | Ga0451795_1483078 | 3300041456 | Unclassified | 630 |
| 230 | Ga0451847_0024155 | 3300041503 | Unclassified | 589 |
| 231 | Ga0451849_1394978 | 3300041505 | Unclassified | 653 |
| 232 | Ga0451851_0542810 | 3300041507 | Bacteria | 538 |
| 233 | Ga0451853_1263169 | 3300041512 | Archaea | 1340 |
| 234 | Ga0451853_1974014 | 3300041512 | Unclassified | 652 |
| 235 | Ga0451853_3979905 | 3300041512 | Unclassified | 1995 |
| 236 | Ga0495592_0000835 | 3300046454 | Bacteria | 21424 |
| 237 | Ga0495592_0004468 | 3300046454 | Bacteria | 10229 |
| 238 | Ga0495592_0005231 | 3300046454 | Bacteria | 9570 |
| 239 | Ga0495592_0005840 | 3300046454 | Bacteria | 9130 |
| 240 | Ga0495592_0006888 | 3300046454 | Bacteria | 8487 |
| 241 | Ga0495592_0008401 | 3300046454 | Bacteria | 7745 |
| 242 | Ga0495592_0031445 | 3300046454 | Bacteria | 4011 |
| 243 | Ga0495592_0077648 | 3300046454 | Bacteria | 2406 |
| 244 | Ga0495592_0285020 | 3300046454 | Unclassified | 1079 |
| 245 | Ga0495592_0318830 | 3300046454 | Bacteria | 1005 |
| 246 | Ga0495592_0338014 | 3300046454 | Bacteria | 969 |
| 247 | Ga0495592_0391238 | 3300046454 | Unclassified | 882 |
| 248 | Ga0495603_0002523 | 3300046455 | Bacteria | 10774 |
| 249 | Ga0495603_0006239 | 3300046455 | Bacteria | 7126 |
| 250 | Ga0495603_0029728 | 3300046455 | Unclassified | 3294 |
| 251 | Ga0495603_0041602 | 3300046455 | Bacteria | 2747 |
| 252 | Ga0495603_0384340 | 3300046455 | Unclassified | 805 |
| 253 | Ga0495603_0391899 | 3300046455 | Bacteria | 796 |
| 254 | Ga0495603_0775736 | 3300046455 | Unclassified | 547 |
| 255 | Ga0495629_0020056 | 3300046459 | Bacteria | 4773 |
| 256 | Ga0495629_0034398 | 3300046459 | Unclassified | 3582 |
| 257 | Ga0495629_0057970 | 3300046459 | Bacteria | 2707 |
| 258 | Ga0495629_0173878 | 3300046459 | Unclassified | 1494 |
| 259 | Ga0495629_0231254 | 3300046459 | Unclassified | 1274 |
| 260 | Ga0495629_0372603 | 3300046459 | Bacteria | 972 |
| 261 | Ga0495629_0413645 | 3300046459 | Unclassified | 916 |
| 262 | Ga0495629_0717233 | 3300046459 | Bacteria | 663 |
| 263 | Ga0495641_0008399 | 3300046461 | Bacteria | 6307 |
| 264 | Ga0495641_0040184 | 3300046461 | Bacteria | 2176 |
| 265 | Ga0495641_0062472 | 3300046461 | Bacteria | 1680 |
| 266 | Ga0495641_0069001 | 3300046461 | Bacteria | 1589 |
| 267 | Ga0495641_0076547 | 3300046461 | Bacteria | 1500 |
| 268 | Ga0495641_0121976 | 3300046461 | Unclassified | 1163 |
| 269 | Ga0495641_0199000 | 3300046461 | Bacteria | 898 |
| 270 | Ga0495641_0367350 | 3300046461 | Unclassified | 651 |
| 271 | Ga0495641_0403146 | 3300046461 | Bacteria | 620 |
| 272 | Ga0495651_0000784 | 3300046462 | Bacteria | 24624 |
| 273 | Ga0495651_0002556 | 3300046462 | Bacteria | 14070 |
| 274 | Ga0495651_0002738 | 3300046462 | Bacteria | 13663 |
| 275 | Ga0495651_0005571 | 3300046462 | Bacteria | 9598 |
| 276 | Ga0495651_0026930 | 3300046462 | Bacteria | 4476 |
| 277 | Ga0495651_0043055 | 3300046462 | Bacteria | 3503 |
| 278 | Ga0495651_0059231 | 3300046462 | Bacteria | 2937 |
| 279 | Ga0495651_0076797 | 3300046462 | Unclassified | 2529 |
| 280 | Ga0495651_0102875 | 3300046462 | Bacteria | 2123 |
| 281 | Ga0495651_0186904 | 3300046462 | Bacteria | 1461 |
| 282 | Ga0495651_0227750 | 3300046462 | Bacteria | 1286 |
| 283 | Ga0495651_0646192 | 3300046462 | Unclassified | 663 |
| 284 | Ga0495653_0007183 | 3300046463 | Bacteria | 9130 |
| 285 | Ga0495653_0010802 | 3300046463 | Bacteria | 7473 |
| 286 | Ga0495653_0013890 | 3300046463 | Bacteria | 6565 |
| 287 | Ga0495653_0015950 | 3300046463 | Bacteria | 6124 |
| 288 | Ga0495653_0018111 | 3300046463 | Bacteria | 5726 |
| 289 | Ga0495653_0020423 | 3300046463 | Bacteria | 5370 |
| 290 | Ga0495653_0025772 | 3300046463 | Bacteria | 4717 |
| 291 | Ga0495653_0063579 | 3300046463 | Bacteria | 2784 |
| 292 | Ga0495653_0079288 | 3300046463 | Bacteria | 2432 |
| 293 | Ga0495653_0093349 | 3300046463 | Bacteria | 2195 |
| 294 | Ga0495653_0100384 | 3300046463 | Bacteria | 2098 |
| 295 | Ga0495653_0148281 | 3300046463 | Bacteria | 1642 |
| 296 | Ga0495653_0161947 | 3300046463 | Bacteria | 1552 |
| 297 | Ga0495653_0219606 | 3300046463 | Unclassified | 1278 |
| 298 | Ga0495653_0316848 | 3300046463 | Bacteria | 1012 |
| 299 | Ga0495653_0460496 | 3300046463 | Unclassified | 798 |
| 300 | Ga0495580_0006731 | 3300046472 | Bacteria | 9330 |
| 301 | Ga0495580_0011409 | 3300046472 | Bacteria | 6874 |
| 302 | Ga0495580_0438146 | 3300046472 | Unclassified | 878 |
| 303 | Ga0495580_0621240 | 3300046472 | Bacteria | 713 |
| 304 | Ga0495582_0002143 | 3300046473 | Bacteria | 11037 |
| 305 | Ga0495582_0002486 | 3300046473 | Bacteria | 10263 |
| 306 | Ga0495582_0078909 | 3300046473 | Unclassified | 1827 |
| 307 | Ga0495582_0111350 | 3300046473 | Bacteria | 1538 |
| 308 | Ga0495582_0118718 | 3300046473 | Bacteria | 1489 |
| 309 | Ga0495582_0244750 | 3300046473 | Unclassified | 1028 |
| 310 | Ga0495639_0006628 | 3300046475 | Bacteria | 4980 |
| 311 | Ga0495639_0016039 | 3300046475 | Bacteria | 3249 |
| 312 | Ga0495639_0092147 | 3300046475 | Unclassified | 1423 |
| 313 | Ga0495639_0110456 | 3300046475 | Bacteria | 1304 |
| 314 | Ga0495639_0219030 | 3300046475 | Unclassified | 935 |
| 315 | Ga0495662_0004592 | 3300046476 | Bacteria | 6918 |
| 316 | Ga0495662_0010286 | 3300046476 | Bacteria | 4585 |
| 317 | Ga0495662_0137433 | 3300046476 | Bacteria | 1202 |
| 318 | Ga0495662_0200979 | 3300046476 | Bacteria | 982 |
| 319 | Ga0495664_0013665 | 3300046477 | Bacteria | 4608 |
| 320 | Ga0495664_0017646 | 3300046477 | Bacteria | 4081 |
| 321 | Ga0495664_0018299 | 3300046477 | Bacteria | 4011 |
| 322 | Ga0495664_0024616 | 3300046477 | Bacteria | 3500 |
| 323 | Ga0495664_0037718 | 3300046477 | Bacteria | 2852 |
| 324 | Ga0495664_0041010 | 3300046477 | Bacteria | 2738 |
| 325 | Ga0495664_0089397 | 3300046477 | Bacteria | 1851 |
| 326 | Ga0495664_0097497 | 3300046477 | Bacteria | 1770 |
| 327 | Ga0495664_0136129 | 3300046477 | Unclassified | 1488 |
| 328 | Ga0495664_0304556 | 3300046477 | Unclassified | 962 |
| 329 | Ga0495664_0500698 | 3300046477 | Bacteria | 725 |
| 330 | Ga0495664_0500825 | 3300046477 | Unclassified | 725 |
| 331 | Ga0495664_0575078 | 3300046477 | Unclassified | 670 |
| 332 | Ga0495584_0236921 | 3300046491 | Unclassified | 928 |
| 333 | Ga0495585_0227505 | 3300046492 | Bacteria | 939 |
| 334 | Ga0495594_0015464 | 3300046499 | Bacteria | 4009 |
| 335 | Ga0495594_0025405 | 3300046499 | Bacteria | 3184 |
| 336 | Ga0495594_0119806 | 3300046499 | Bacteria | 1487 |
| 337 | Ga0495594_0433663 | 3300046499 | Unclassified | 747 |
| 338 | Ga0495594_0471343 | 3300046499 | Bacteria | 714 |
| 339 | Ga0495594_0611626 | 3300046499 | Bacteria | 618 |
| 340 | Ga0495607_0347715 | 3300046501 | Unclassified | 685 |
| 341 | Ga0495608_0001092 | 3300046511 | Bacteria | 19210 |
| 342 | Ga0495608_0004876 | 3300046511 | Bacteria | 9598 |
| 343 | Ga0495608_0009047 | 3300046511 | Bacteria | 6967 |
| 344 | Ga0495608_0019085 | 3300046511 | Bacteria | 4726 |
| 345 | Ga0495608_0022780 | 3300046511 | Bacteria | 4296 |
| 346 | Ga0495608_0129649 | 3300046511 | Bacteria | 1614 |
| 347 | Ga0495608_0405334 | 3300046511 | Unclassified | 833 |
| 348 | Ga0495608_0535917 | 3300046511 | Bacteria | 706 |
| 349 | Ga0495618_0002062 | 3300046514 | Bacteria | 13193 |
| 350 | Ga0495618_0082325 | 3300046514 | Bacteria | 2056 |
| 351 | Ga0495618_0239621 | 3300046514 | Unclassified | 1140 |
| 352 | Ga0495618_0367047 | 3300046514 | Unclassified | 885 |
| 353 | Ga0495618_0439350 | 3300046514 | Unclassified | 793 |
| 354 | Ga0495628_0001853 | 3300046516 | Bacteria | 19207 |
| 355 | Ga0495628_0003908 | 3300046516 | Bacteria | 13281 |
| 356 | Ga0495628_0005891 | 3300046516 | Bacteria | 10731 |
| 357 | Ga0495628_0019647 | 3300046516 | Bacteria | 5581 |
| 358 | Ga0495628_0028121 | 3300046516 | Bacteria | 4571 |
| 359 | Ga0495628_0044517 | 3300046516 | Bacteria | 3530 |
| 360 | Ga0495628_0076167 | 3300046516 | Bacteria | 2611 |
| 361 | Ga0495628_0097994 | 3300046516 | Bacteria | 2265 |
| 362 | Ga0495628_0408740 | 3300046516 | Bacteria | 990 |
| 363 | Ga0495628_0426801 | 3300046516 | Unclassified | 965 |
| 364 | Ga0495628_0629724 | 3300046516 | Bacteria | 763 |
| 365 | Ga0495630_0000711 | 3300046517 | Bacteria | 23517 |
| 366 | Ga0495630_0004951 | 3300046517 | Bacteria | 9366 |
| 367 | Ga0495630_0004980 | 3300046517 | Bacteria | 9344 |
| 368 | Ga0495630_0045044 | 3300046517 | Unclassified | 3296 |
| 369 | Ga0495630_0075576 | 3300046517 | Bacteria | 2538 |
| 370 | Ga0495630_0120309 | 3300046517 | Archaea | 1992 |
| 371 | Ga0495630_0410396 | 3300046517 | Bacteria | 1038 |
| 372 | Ga0495630_0417277 | 3300046517 | Bacteria | 1028 |
| 373 | Ga0495630_0426872 | 3300046517 | Bacteria | 1016 |
| 374 | Ga0495630_0746171 | 3300046517 | Bacteria | 748 |
| 375 | Ga0495644_0250871 | 3300046523 | Bacteria | 687 |
| 376 | Ga0495666_0003437 | 3300046526 | Bacteria | 7985 |
| 377 | Ga0495666_0011556 | 3300046526 | Bacteria | 4401 |
| 378 | Ga0495666_0241008 | 3300046526 | Bacteria | 825 |
| 379 | Ga0495666_0319371 | 3300046526 | Unclassified | 701 |
| 380 | Ga0495652_0002099 | 3300046529 | Bacteria | 21041 |
| 381 | Ga0495652_0004726 | 3300046529 | Bacteria | 12978 |
| 382 | Ga0495652_0008171 | 3300046529 | Bacteria | 9570 |
| 383 | Ga0495652_0021323 | 3300046529 | Bacteria | 5761 |
| 384 | Ga0495652_0026510 | 3300046529 | Bacteria | 5119 |
| 385 | Ga0495652_0047211 | 3300046529 | Unclassified | 3693 |
| 386 | Ga0495652_0114351 | 3300046529 | Bacteria | 2165 |
| 387 | Ga0495652_0121061 | 3300046529 | Bacteria | 2087 |
| 388 | Ga0495652_0139580 | 3300046529 | Unclassified | 1907 |
| 389 | Ga0495652_0150737 | 3300046529 | Bacteria | 1817 |
| 390 | Ga0495652_0180526 | 3300046529 | Bacteria | 1620 |
| 391 | Ga0495652_0214203 | 3300046529 | Bacteria | 1452 |
| 392 | Ga0495652_0216213 | 3300046529 | Unclassified | 1443 |
| 393 | Ga0495652_0247899 | 3300046529 | Unclassified | 1321 |
| 394 | Ga0495652_0260804 | 3300046529 | Bacteria | 1279 |
| 395 | Ga0495652_0260984 | 3300046529 | Bacteria | 1279 |
| 396 | Ga0495652_0277311 | 3300046529 | Bacteria | 1229 |
| 397 | Ga0495652_0365618 | 3300046529 | Bacteria | 1029 |
| 398 | Ga0495652_0411869 | 3300046529 | Unclassified | 954 |
| 399 | Ga0495652_0626536 | 3300046529 | Unclassified | 731 |
| 400 | Ga0495652_0898127 | 3300046529 | Unclassified | 584 |
| 401 | Ga0495665_0006423 | 3300046531 | Bacteria | 6346 |
| 402 | Ga0495665_0013283 | 3300046531 | Bacteria | 4454 |
| 403 | Ga0495665_0013298 | 3300046531 | Unclassified | 4453 |
| 404 | Ga0495665_0176993 | 3300046531 | Unclassified | 1109 |
| 405 | Ga0495640_0003219 | 3300046533 | Bacteria | 13144 |
| 406 | Ga0495640_0006138 | 3300046533 | Bacteria | 9523 |
| 407 | Ga0495640_0007333 | 3300046533 | Bacteria | 8679 |
| 408 | Ga0495640_0010650 | 3300046533 | Bacteria | 7095 |
| 409 | Ga0495640_0200330 | 3300046533 | Bacteria | 1265 |
| 410 | Ga0495640_0354934 | 3300046533 | Unclassified | 904 |
| 411 | Ga0495640_0498146 | 3300046533 | Bacteria | 741 |
| 412 | Ga0495640_0715731 | 3300046533 | Unclassified | 600 |
| 413 | Ga0495586_0005577 | 3300046535 | Bacteria | 6736 |
| 414 | Ga0495586_0174047 | 3300046535 | Bacteria | 1216 |
| 415 | Ga0495586_0526952 | 3300046535 | Unclassified | 682 |
| 416 | Ga0495586_0560737 | 3300046535 | Unclassified | 660 |
| 417 | Ga0495587_0002018 | 3300046536 | Bacteria | 13528 |
| 418 | Ga0495587_0004135 | 3300046536 | Bacteria | 9598 |
| 419 | Ga0495587_0008621 | 3300046536 | Bacteria | 6554 |
| 420 | Ga0495587_0013468 | 3300046536 | Bacteria | 5139 |
| 421 | Ga0495587_0021600 | 3300046536 | Bacteria | 3970 |
| 422 | Ga0495587_0041279 | 3300046536 | Bacteria | 2753 |
| 423 | Ga0495587_0059618 | 3300046536 | Bacteria | 2239 |
| 424 | Ga0495587_0065577 | 3300046536 | Bacteria | 2120 |
| 425 | Ga0495587_0065658 | 3300046536 | Bacteria | 2118 |
| 426 | Ga0495587_0099903 | 3300046536 | Bacteria | 1672 |
| 427 | Ga0495587_0229389 | 3300046536 | Unclassified | 1046 |
| 428 | Ga0495587_0717520 | 3300046536 | Bacteria | 548 |
| 429 | Ga0495645_0010823 | 3300046543 | Bacteria | 6408 |
| 430 | Ga0495645_0011132 | 3300046543 | Bacteria | 6325 |
| 431 | Ga0495645_0035172 | 3300046543 | Unclassified | 3653 |
| 432 | Ga0495645_0036071 | 3300046543 | Bacteria | 3604 |
| 433 | Ga0495645_0036673 | 3300046543 | Bacteria | 3573 |
| 434 | Ga0495645_0084720 | 3300046543 | Bacteria | 2269 |
| 435 | Ga0495645_0125429 | 3300046543 | Unclassified | 1804 |
| 436 | Ga0495645_0470153 | 3300046543 | Bacteria | 790 |
| 437 | Ga0495645_0599706 | 3300046543 | Bacteria | 678 |
| 438 | Ga0495645_0623096 | 3300046543 | Unclassified | 661 |
| 439 | Ga0495645_0659345 | 3300046543 | Bacteria | 638 |
| 440 | Ga0495622_0127076 | 3300046557 | Bacteria | 1162 |
| 441 | Ga0495667_0002979 | 3300046559 | Bacteria | 11357 |
| 442 | Ga0495667_0003050 | 3300046559 | Bacteria | 11229 |
| 443 | Ga0495667_0004823 | 3300046559 | Bacteria | 9115 |
| 444 | Ga0495667_0004939 | 3300046559 | Bacteria | 9018 |
| 445 | Ga0495667_0005341 | 3300046559 | Bacteria | 8681 |
| 446 | Ga0495667_0066506 | 3300046559 | Unclassified | 2356 |
| 447 | Ga0495667_0072059 | 3300046559 | Unclassified | 2252 |
| 448 | Ga0495667_0077950 | 3300046559 | Unclassified | 2154 |
| 449 | Ga0495667_0088964 | 3300046559 | Bacteria | 2002 |
| 450 | Ga0495667_0174317 | 3300046559 | Bacteria | 1381 |
| 451 | Ga0495667_0211676 | 3300046559 | Unclassified | 1239 |
| 452 | Ga0495667_0606834 | 3300046559 | Bacteria | 681 |
| 453 | Ga0495667_0688211 | 3300046559 | Bacteria | 634 |
| 454 | Ga0495634_0004863 | 3300046642 | Bacteria | 10416 |
| 455 | Ga0495634_0011070 | 3300046642 | Bacteria | 6582 |
| 456 | Ga0495634_0012074 | 3300046642 | Bacteria | 6261 |
| 457 | Ga0495634_0086641 | 3300046642 | Bacteria | 2040 |
| 458 | Ga0495634_0129950 | 3300046642 | Bacteria | 1606 |
| 459 | Ga0495634_0194586 | 3300046642 | Bacteria | 1262 |
| 460 | Ga0495634_0246775 | 3300046642 | Unclassified | 1093 |
| 461 | Ga0495634_0325785 | 3300046642 | Bacteria | 924 |
| 462 | Ga0495635_0002890 | 3300046663 | Bacteria | 11794 |
| 463 | Ga0495635_0018181 | 3300046663 | Bacteria | 4907 |
| 464 | Ga0495635_0020591 | 3300046663 | Bacteria | 4593 |
| 465 | Ga0495635_0021774 | 3300046663 | Bacteria | 4468 |
| 466 | Ga0495635_0099767 | 3300046663 | Bacteria | 1984 |
| 467 | Ga0495635_0134915 | 3300046663 | Bacteria | 1682 |
| 468 | Ga0495635_0156425 | 3300046663 | Bacteria | 1551 |
| 469 | Ga0495635_0218521 | 3300046663 | Bacteria | 1289 |
| 470 | Ga0495635_0331022 | 3300046663 | Bacteria | 1018 |
| 471 | Ga0495635_0432689 | 3300046663 | Bacteria | 871 |
| 472 | Ga0495635_0620430 | 3300046663 | Bacteria | 705 |
| 473 | Ga0495635_0809261 | 3300046663 | Unclassified | 603 |
| 474 | Ga0495588_0022338 | 3300046674 | Bacteria | 3126 |
| 475 | Ga0495588_0465071 | 3300046674 | Unclassified | 663 |
| 476 | Ga0495657_0002344 | 3300046675 | Bacteria | 15942 |
| 477 | Ga0495657_0005932 | 3300046675 | Bacteria | 9598 |
| 478 | Ga0495657_0008082 | 3300046675 | Bacteria | 8067 |
| 479 | Ga0495657_0015134 | 3300046675 | Bacteria | 5652 |
| 480 | Ga0495657_0026611 | 3300046675 | Bacteria | 4094 |
| 481 | Ga0495657_0055934 | 3300046675 | Unclassified | 2631 |
| 482 | Ga0495657_0062860 | 3300046675 | Bacteria | 2451 |
| 483 | Ga0495657_0072582 | 3300046675 | Unclassified | 2244 |
| 484 | Ga0495657_0076798 | 3300046675 | Bacteria | 2169 |
| 485 | Ga0495657_0290753 | 3300046675 | Bacteria | 976 |
| 486 | Ga0495657_0530855 | 3300046675 | Bacteria | 684 |
| 487 | Ga0495657_0606089 | 3300046675 | Bacteria | 633 |
| 488 | Ga0495599_0000517 | 3300046678 | Bacteria | 22135 |
| 489 | Ga0495599_0001250 | 3300046678 | Bacteria | 14421 |
| 490 | Ga0495599_0001497 | 3300046678 | Bacteria | 13431 |
| 491 | Ga0495599_0003197 | 3300046678 | Bacteria | 9542 |
| 492 | Ga0495599_0013537 | 3300046678 | Bacteria | 5038 |
| 493 | Ga0495599_0020401 | 3300046678 | Bacteria | 4127 |
| 494 | Ga0495599_0034648 | 3300046678 | Bacteria | 3171 |
| 495 | Ga0495599_0038474 | 3300046678 | Bacteria | 3005 |
| 496 | Ga0495599_0081198 | 3300046678 | Bacteria | 2025 |
| 497 | Ga0495599_0108857 | 3300046678 | Bacteria | 1726 |
| 498 | Ga0495599_0122324 | 3300046678 | Bacteria | 1617 |
| 499 | Ga0495599_0137483 | 3300046678 | Bacteria | 1516 |
| 500 | Ga0495599_0544624 | 3300046678 | Bacteria | 680 |
| 501 | Ga0495623_0002649 | 3300046679 | Bacteria | 11816 |
| 502 | Ga0495623_0030027 | 3300046679 | Bacteria | 3498 |
| 503 | Ga0495623_0035650 | 3300046679 | Unclassified | 3188 |
| 504 | Ga0495623_0047091 | 3300046679 | Bacteria | 2737 |
| 505 | Ga0495623_0120955 | 3300046679 | Bacteria | 1576 |
| 506 | Ga0495623_0130379 | 3300046679 | Unclassified | 1506 |
| 507 | Ga0495646_0001358 | 3300046680 | Bacteria | 14465 |
| 508 | Ga0495646_0005190 | 3300046680 | Bacteria | 8215 |
| 509 | Ga0495646_0016457 | 3300046680 | Bacteria | 4694 |
| 510 | Ga0495646_0024700 | 3300046680 | Bacteria | 3784 |
| 511 | Ga0495646_0062412 | 3300046680 | Unclassified | 2215 |
| 512 | Ga0495646_0087808 | 3300046680 | Bacteria | 1802 |
| 513 | Ga0495646_0130982 | 3300046680 | Bacteria | 1412 |
| 514 | Ga0495646_0199305 | 3300046680 | Unclassified | 1091 |
| 515 | Ga0495646_0312339 | 3300046680 | Unclassified | 829 |
| 516 | Ga0495646_0327043 | 3300046680 | Bacteria | 806 |
| 517 | Ga0495646_0528591 | 3300046680 | Bacteria | 604 |
| 518 | Ga0495647_0015772 | 3300046681 | Bacteria | 2651 |
| 519 | Ga0495647_0115756 | 3300046681 | Bacteria | 1123 |
| 520 | Ga0495647_0377736 | 3300046681 | Unclassified | 648 |
| 521 | Ga0495647_0608337 | 3300046681 | Bacteria | 513 |
| 522 | Ga0495658_0003423 | 3300046683 | Bacteria | 7852 |
| 523 | Ga0495658_0019065 | 3300046683 | Bacteria | 3576 |
| 524 | Ga0495658_0207987 | 3300046683 | Bacteria | 1222 |
| 525 | Ga0495658_0393574 | 3300046683 | Bacteria | 883 |
| 526 | Ga0495658_0475681 | 3300046683 | Unclassified | 799 |
| 527 | Ga0495658_0608717 | 3300046683 | Bacteria | 700 |
| 528 | Ga0495658_0973566 | 3300046683 | Unclassified | 542 |
| 529 | Ga0495613_0004445 | 3300046689 | Bacteria | 10504 |
| 530 | Ga0495613_0010492 | 3300046689 | Bacteria | 6877 |
| 531 | Ga0495613_0066395 | 3300046689 | Bacteria | 2634 |
| 532 | Ga0495613_0122036 | 3300046689 | Bacteria | 1871 |
| 533 | Ga0495613_0176738 | 3300046689 | Bacteria | 1513 |
| 534 | Ga0495613_0491814 | 3300046689 | Unclassified | 827 |
| 535 | Ga0495624_0002090 | 3300046690 | Bacteria | 15227 |
| 536 | Ga0495624_0025438 | 3300046690 | Unclassified | 3886 |
| 537 | Ga0495624_0078165 | 3300046690 | Bacteria | 2052 |
| 538 | Ga0495624_0391053 | 3300046690 | Unclassified | 835 |
| 539 | Ga0495624_0410234 | 3300046690 | Bacteria | 813 |
| 540 | Ga0495624_0482498 | 3300046690 | Unclassified | 742 |
| 541 | Ga0495624_0551693 | 3300046690 | Bacteria | 688 |
| 542 | Ga0495670_0772408 | 3300046691 | Bacteria | 524 |
| 543 | Ga0495589_0349940 | 3300046794 | Unclassified | 681 |
| 544 | Ga0495600_0004301 | 3300046809 | Bacteria | 8518 |
| 545 | Ga0495600_0006336 | 3300046809 | Bacteria | 7195 |
| 546 | Ga0495600_0012838 | 3300046809 | Bacteria | 5247 |
| 547 | Ga0495600_0046493 | 3300046809 | Bacteria | 2831 |
| 548 | Ga0495600_0055466 | 3300046809 | Unclassified | 2588 |
| 549 | Ga0495600_0112344 | 3300046809 | Bacteria | 1774 |
| 550 | Ga0495600_0125319 | 3300046809 | Bacteria | 1670 |
| 551 | Ga0495600_0153984 | 3300046809 | Bacteria | 1487 |
| 552 | Ga0495600_0210488 | 3300046809 | Bacteria | 1246 |
| 553 | Ga0495600_0243492 | 3300046809 | Unclassified | 1145 |
| 554 | Ga0495600_0245984 | 3300046809 | Bacteria | 1138 |
| 555 | Ga0495600_0314170 | 3300046809 | Bacteria | 986 |
| 556 | Ga0495600_0342408 | 3300046809 | Bacteria | 937 |
| 557 | Ga0495600_0716469 | 3300046809 | Unclassified | 601 |
| 558 | Ga0495581_0001545 | 3300047315 | Bacteria | 12848 |
| 559 | Ga0495581_0002143 | 3300047315 | Bacteria | 11136 |
| 560 | Ga0495581_0011576 | 3300047315 | Bacteria | 5104 |
| 561 | Ga0495581_0019871 | 3300047315 | Bacteria | 3900 |
| 562 | Ga0495581_0116408 | 3300047315 | Unclassified | 1554 |
| 563 | Ga0495604_0004237 | 3300047317 | Bacteria | 11353 |
| 564 | Ga0495604_0006077 | 3300047317 | Bacteria | 9580 |
| 565 | Ga0495604_0009320 | 3300047317 | Bacteria | 7772 |
| 566 | Ga0495604_0018769 | 3300047317 | Bacteria | 5537 |
| 567 | Ga0495604_0083991 | 3300047317 | Bacteria | 2378 |
| 568 | Ga0495604_0097809 | 3300047317 | Bacteria | 2163 |
| 569 | Ga0495604_0114296 | 3300047317 | Bacteria | 1963 |
| 570 | Ga0495604_0331916 | 3300047317 | Bacteria | 1014 |
| 571 | Ga0495604_0916821 | 3300047317 | Unclassified | 546 |
| 572 | Ga0495674_0001155 | 3300047319 | Bacteria | 25441 |
| 573 | Ga0495674_0006505 | 3300047319 | Bacteria | 11207 |
| 574 | Ga0495674_0007595 | 3300047319 | Bacteria | 10359 |
| 575 | Ga0495674_0009809 | 3300047319 | Bacteria | 9091 |
| 576 | Ga0495674_0011462 | 3300047319 | Bacteria | 8364 |
| 577 | Ga0495674_0032941 | 3300047319 | Unclassified | 4697 |
| 578 | Ga0495674_0041093 | 3300047319 | Bacteria | 4133 |
| 579 | Ga0495674_0057642 | 3300047319 | Bacteria | 3399 |
| 580 | Ga0495674_0112405 | 3300047319 | Bacteria | 2308 |
| 581 | Ga0495674_0129012 | 3300047319 | Bacteria | 2131 |
| 582 | Ga0495674_0138443 | 3300047319 | Bacteria | 2047 |
| 583 | Ga0495674_0143073 | 3300047319 | Bacteria | 2009 |
| 584 | Ga0495674_0199912 | 3300047319 | Bacteria | 1658 |
| 585 | Ga0495674_0256616 | 3300047319 | Unclassified | 1437 |
| 586 | Ga0495674_0544573 | 3300047319 | Bacteria | 924 |
| 587 | Ga0495674_0607510 | 3300047319 | Bacteria | 866 |
| 588 | Ga0495674_0915505 | 3300047319 | Bacteria | 676 |
| 589 | Ga0495674_1454507 | 3300047319 | Unclassified | 509 |
| 590 | Ga0495676_0007203 | 3300047321 | Bacteria | 10202 |
| 591 | Ga0495676_0013893 | 3300047321 | Bacteria | 7219 |
| 592 | Ga0495676_0071411 | 3300047321 | Unclassified | 2669 |
| 593 | Ga0495676_0119950 | 3300047321 | Unclassified | 1915 |
| 594 | Ga0495676_0271063 | 3300047321 | Bacteria | 1152 |
| 595 | Ga0495676_0312205 | 3300047321 | Bacteria | 1058 |
| 596 | Ga0495676_0392354 | 3300047321 | Unclassified | 922 |
| 597 | Ga0495676_0940750 | 3300047321 | Unclassified | 553 |
| 598 | Ga0495680_0003815 | 3300047322 | Bacteria | 14630 |
| 599 | Ga0495680_0003854 | 3300047322 | Bacteria | 14537 |
| 600 | Ga0495680_0004037 | 3300047322 | Bacteria | 14154 |
| 601 | Ga0495680_0007244 | 3300047322 | Bacteria | 10217 |
| 602 | Ga0495680_0008067 | 3300047322 | Bacteria | 9598 |
| 603 | Ga0495680_0009024 | 3300047322 | Bacteria | 9009 |
| 604 | Ga0495680_0009481 | 3300047322 | Bacteria | 8749 |
| 605 | Ga0495680_0016048 | 3300047322 | Bacteria | 6442 |
| 606 | Ga0495680_0016453 | 3300047322 | Bacteria | 6351 |
| 607 | Ga0495680_0018494 | 3300047322 | Bacteria | 5912 |
| 608 | Ga0495680_0090686 | 3300047322 | Bacteria | 2292 |
| 609 | Ga0495680_0131744 | 3300047322 | Bacteria | 1836 |
| 610 | Ga0495680_0144950 | 3300047322 | Unclassified | 1735 |
| 611 | Ga0495680_0188048 | 3300047322 | Bacteria | 1487 |
| 612 | Ga0495680_0378789 | 3300047322 | Unclassified | 980 |
| 613 | Ga0495680_0404879 | 3300047322 | Unclassified | 941 |
| 614 | Ga0495680_0501134 | 3300047322 | Unclassified | 824 |
| 615 | Ga0495680_0555115 | 3300047322 | Bacteria | 773 |
| 616 | Ga0495680_0656378 | 3300047322 | Unclassified | 696 |
| 617 | Ga0495675_0006365 | 3300047444 | Bacteria | 7225 |
| 618 | Ga0495675_0008614 | 3300047444 | Bacteria | 6323 |
| 619 | Ga0495675_0037979 | 3300047444 | Bacteria | 3066 |
| 620 | Ga0495675_0041007 | 3300047444 | Bacteria | 2950 |
| 621 | Ga0495675_0052190 | 3300047444 | Bacteria | 2596 |
| 622 | Ga0495675_0074093 | 3300047444 | Bacteria | 2146 |
| 623 | Ga0495675_0119365 | 3300047444 | Bacteria | 1642 |
| 624 | Ga0495675_0190361 | 3300047444 | Bacteria | 1253 |
| 625 | Ga0495677_0293390 | 3300047445 | Unclassified | 639 |
| 626 | Ga0495684_0002514 | 3300047471 | Bacteria | 14609 |
| 627 | Ga0495684_0005968 | 3300047471 | Bacteria | 9462 |
| 628 | Ga0495684_0017681 | 3300047471 | Bacteria | 5491 |
| 629 | Ga0495684_0019530 | 3300047471 | Bacteria | 5220 |
| 630 | Ga0495684_0021969 | 3300047471 | Bacteria | 4912 |
| 631 | Ga0495684_0040280 | 3300047471 | Bacteria | 3582 |
| 632 | Ga0495684_0091077 | 3300047471 | Bacteria | 2309 |
| 633 | Ga0495684_0130043 | 3300047471 | Bacteria | 1892 |
| 634 | Ga0495684_0240262 | 3300047471 | Bacteria | 1321 |
| 635 | Ga0495684_0288051 | 3300047471 | Bacteria | 1183 |
| 636 | Ga0495684_0366335 | 3300047471 | Unclassified | 1019 |
| 637 | Ga0495684_0507181 | 3300047471 | Unclassified | 828 |
| 638 | Ga0495684_0712964 | 3300047471 | Unclassified | 664 |
| 639 | Ga0495593_0000755 | 3300047673 | Bacteria | 18754 |
| 640 | Ga0495593_0008858 | 3300047673 | Bacteria | 5838 |
| 641 | Ga0495602_0007030 | 3300048088 | Bacteria | 11817 |
| 642 | Ga0495602_0010510 | 3300048088 | Bacteria | 9607 |
| 643 | Ga0495602_0030868 | 3300048088 | Bacteria | 5075 |
| 644 | Ga0495602_0075631 | 3300048088 | Bacteria | 2857 |
| 645 | Ga0495602_0088437 | 3300048088 | Bacteria | 2579 |
| 646 | Ga0495602_0105465 | 3300048088 | Bacteria | 2303 |
| 647 | Ga0495602_0124508 | 3300048088 | Bacteria | 2068 |
| 648 | Ga0495602_0249710 | 3300048088 | Bacteria | 1323 |
| 649 | Ga0495602_0297085 | 3300048088 | Bacteria | 1183 |
| 650 | Ga0495602_0327340 | 3300048088 | Bacteria | 1112 |
| 651 | Ga0495602_0384454 | 3300048088 | Unclassified | 1005 |
| 652 | Ga0495602_0516530 | 3300048088 | Bacteria | 832 |
| 653 | Ga0495602_0521523 | 3300048088 | Unclassified | 827 |
| 654 | Ga0495602_0700363 | 3300048088 | Bacteria | 687 |
| 655 | Ga0495602_0732632 | 3300048088 | Unclassified | 668 |
| 656 | Ga0495602_0992398 | 3300048088 | Unclassified | 554 |
| 657 | Ga0495602_1107333 | 3300048088 | Unclassified | 519 |
| 658 | Ga0495614_0023665 | 3300048089 | Unclassified | 2651 |
| 659 | Ga0495614_0304769 | 3300048089 | Unclassified | 737 |
| 660 | Ga0495615_0281839 | 3300048090 | Unclassified | 534 |
| 661 | Ga0496102_0758722 | 3300048905 | Unclassified | 893 |
| 662 | Ga0496104_0467938 | 3300048907 | Unclassified | 1172 |
| 663 | Ga0496104_0477506 | 3300048907 | Bacteria | 1158 |
| 664 | Ga0496104_0969382 | 3300048907 | Unclassified | 755 |
| 665 | Ga0496105_0294997 | 3300048908 | Bacteria | 1305 |
| 666 | Ga0496105_0475428 | 3300048908 | Unclassified | 984 |
| 667 | Ga0496108_1782599 | 3300048911 | Bacteria | 504 |
| 668 | Ga0496109_0132183 | 3300048912 | Bacteria | 2330 |
| 669 | Ga0496109_0148231 | 3300048912 | Bacteria | 2196 |
| 670 | Ga0496109_0437363 | 3300048912 | Unclassified | 1236 |
| 671 | Ga0496109_0578939 | 3300048912 | Bacteria | 1058 |
| 672 | Ga0496110_1353769 | 3300048913 | Bacteria | 621 |
| 673 | Ga0496112_0004932 | 3300048915 | Bacteria | 11425 |
| 674 | Ga0496112_0084839 | 3300048915 | Unclassified | 3133 |
| 675 | Ga0496113_0479589 | 3300048916 | Bacteria | 999 |
| 676 | Ga0496113_0760180 | 3300048916 | Unclassified | 771 |
| 677 | Ga0496114_0198906 | 3300048917 | Bacteria | 1755 |
| 678 | Ga0496114_0328892 | 3300048917 | Bacteria | 1351 |
| 679 | Ga0496114_0335956 | 3300048917 | Archaea | 1336 |
| 680 | Ga0496115_0062186 | 3300048918 | Bacteria | 3011 |
| 681 | Ga0496115_0163945 | 3300048918 | Unclassified | 1838 |
| 682 | nmdc:mga05p37_30851_c1 | 3300050507 | Bacteria | 6543 |
| 683 | nmdc:mga09592_6874_c1 | 3300050508 | Bacteria | 9257 |
| 684 | nmdc:mga0qj67_6375_c1 | 3300050509 | Bacteria | 8667 |
| 685 | nmdc:mga06r32_99963_c1 | 3300050510 | Bacteria | 2846 |
| 686 | Ga0495601_0003803 | 3300053077 | Bacteria | 8687 |
| 687 | Ga0495601_0007624 | 3300053077 | Bacteria | 6355 |
| 688 | Ga0495601_0054300 | 3300053077 | Unclassified | 2534 |
| 689 | Ga0495601_0137114 | 3300053077 | Bacteria | 1595 |
| 690 | Ga0495601_0186890 | 3300053077 | Unclassified | 1354 |
| 691 | Ga0495601_0277606 | 3300053077 | Bacteria | 1092 |
| 692 | Ga0495601_0512853 | 3300053077 | Bacteria | 773 |
| 693 | Ga0495612_0004254 | 3300053078 | Bacteria | 5944 |
| 694 | Ga0495612_0024353 | 3300053078 | Bacteria | 2429 |
| 695 | Ga0495612_0079651 | 3300053078 | Unclassified | 1375 |
| 696 | Ga0495612_0155941 | 3300053078 | Bacteria | 995 |
| 697 | Ga0495612_0175854 | 3300053078 | Bacteria | 939 |
| 698 | Ga0495612_0274451 | 3300053078 | Unclassified | 753 |
| 699 | Ga0495595_0002462 | 3300053084 | Bacteria | 7236 |
| 700 | Ga0495595_0011541 | 3300053084 | Bacteria | 3695 |
| 701 | Ga0495595_0065716 | 3300053084 | Bacteria | 1706 |
| 702 | Ga0495595_0078302 | 3300053084 | Bacteria | 1571 |
| 703 | Ga0495595_0099657 | 3300053084 | Bacteria | 1401 |
| 704 | Ga0495595_0147241 | 3300053084 | Bacteria | 1157 |
| 705 | Ga0495595_0148792 | 3300053084 | Bacteria | 1151 |
| 706 | Ga0495595_0211351 | 3300053084 | Unclassified | 967 |
| 707 | Ga0495619_0013138 | 3300053085 | Bacteria | 5218 |
| 708 | Ga0495619_0018477 | 3300053085 | Bacteria | 4422 |
| 709 | Ga0495619_0041578 | 3300053085 | Bacteria | 3007 |
| 710 | Ga0495619_0060942 | 3300053085 | Bacteria | 2509 |
| 711 | Ga0495619_0076184 | 3300053085 | Bacteria | 2252 |
| 712 | Ga0495619_0219573 | 3300053085 | Unclassified | 1317 |
| 713 | Ga0495619_0284917 | 3300053085 | Bacteria | 1145 |
| 714 | Ga0495619_0285307 | 3300053085 | Bacteria | 1144 |
| 715 | Ga0495619_0302661 | 3300053085 | Bacteria | 1107 |
| 716 | Ga0495619_0469719 | 3300053085 | Bacteria | 866 |
| 717 | Ga0495619_0909890 | 3300053085 | Bacteria | 591 |
| 718 | Ga0587073_0323681 | 3300059492 | Bacteria | 509 |
| 719 | Ga0587079_114872 | 3300059647 | Unclassified | 659 |
| 720 | Ga0495676_0957863 | |||
| 721 | Ga0058860_12147630 | |||
| 722 | Ga0070683_100911950 | |||
| 723 | Ga0070690_100448466 | |||
| 724 | Ga0070682_100861778 | |||
| 725 | Ga0068868_100660031 | |||
| 726 | Ga0070671_100854282 | |||
| 727 | Ga0070674_100166636 | |||
| 728 | Ga0070688_100291532 | |||
| 729 | Ga0070709_10820875 | |||
| 730 | Ga0070714_100158672 | |||
| 731 | Ga0070714_100395268 | |||
| 732 | Ga0070714_100919108 | |||
| 733 | Ga0070713_100455694 | |||
| 734 | Ga0070713_101749956 | |||
| 735 | Ga0070701_10360338 | |||
| 736 | Ga0070711_100171764 | |||
| 737 | Ga0070711_100764735 | |||
| 738 | Ga0070705_100088165 | |||
| 739 | Ga0070708_100322729 | |||
| 740 | Ga0070663_100855224 | |||
| 741 | Ga0070662_100194576 | |||
| 742 | Ga0070685_10069841 | |||
| 743 | Ga0070706_100848857 | |||
| 744 | Ga0070698_101203437 | |||
| 745 | Ga0070684_100900318 | |||
| 746 | Ga0070672_101350101 | |||
| 747 | Ga0070704_100697779 | |||
| 748 | Ga0070704_101179136 | |||
| 749 | Ga0068856_101407198 | |||
| 750 | Ga0070702_100170416 | |||
| 751 | Ga0068852_100423830 | |||
| 752 | Ga0068859_100563017 | |||
| 753 | Ga0068864_101259582 | |||
| 754 | Ga0068866_10500573 | |||
| 755 | Ga0068861_100254578 | |||
| 756 | Ga0068861_101415183 | |||
| 757 | Ga0068870_10033345 | |||
| 758 | Ga0068870_11056698 | |||
| 759 | Ga0070717_10080475 | |||
| 760 | Ga0070717_10212822 | |||
| 761 | Ga0070717_10396154 | |||
| 762 | Ga0075365_10929413 | |||
| 763 | Ga0070712_101696139 | |||
| 764 | Ga0070712_101777739 | |||
| 765 | Ga0075428_100011145 | |||
| 766 | Ga0075430_100001957 | |||
| 767 | Ga0075431_100059027 | |||
| 768 | Ga0075429_100007113 | |||
| 769 | Ga0068865_100083280 | |||
| 770 | Ga0097620_100562915 | |||
| 771 | Ga0105247_10778011 | |||
| 772 | Ga0114129_10037659 | |||
| 773 | Ga0105243_10119598 | |||
| 774 | Ga0105241_12165054 | |||
| 775 | Ga0105242_11079845 | |||
| 776 | Ga0105248_13087399 | |||
| 777 | Ga0105249_10156089 | |||
| 778 | Ga0105249_12352028 | |||
| 779 | Ga0105246_10201131 | |||
| 780 | Ga0105246_11239883 | |||
| 781 | Ga0157320_1010558 | |||
| 782 | Ga0157329_1019109 | |||
| 783 | Ga0157347_1030211 | |||
| 784 | Ga0157342_1006678 | |||
| 785 | Ga0157374_11159329 | |||
| 786 | Ga0163162_10217936 | |||
| 787 | Ga0163162_10904207 | |||
| 788 | Ga0157375_10037248 | |||
| 789 | Ga0157375_10226515 | |||
| 790 | Ga0157375_12589035 | |||
| 791 | Ga0163163_11085742 | |||
| 792 | Ga0157380_10597438 | |||
| 793 | Ga0157379_10168253 | |||
| 794 | Ga0157379_10562805 | |||
| 795 | Ga0157376_10669991 | |||
| 796 | Ga0163161_10586393 | |||
| 797 | Ga0224572_1030457 | |||
| 798 | Ga0224572_1054413 | |||
| 799 | Ga0228598_1100399 | |||
| 800 | Ga0207699_11015543 | |||
| 801 | Ga0207643_10431593 | |||
| 802 | Ga0207684_10393080 | |||
| 803 | Ga0207693_10539446 | |||
| 804 | Ga0207693_10667974 | |||
| 805 | Ga0207663_10032558 | |||
| 806 | Ga0207663_10336000 | |||
| 807 | Ga0207662_10451069 | |||
| 808 | Ga0207664_10123682 | |||
| 809 | Ga0207664_10452318 | |||
| 810 | Ga0207664_10771787 | |||
| 811 | Ga0207709_10645584 | |||
| 812 | Ga0207669_10053793 | |||
| 813 | Ga0207704_10123748 | |||
| 814 | Ga0207665_10315573 | |||
| 815 | Ga0207712_10440344 | |||
| 816 | Ga0207712_11932633 | |||
| 817 | Ga0207678_10279383 | |||
| 818 | Ga0207708_10016057 | |||
| 819 | Ga0207702_12014045 | |||
| 820 | Ga0207648_10239075 | |||
| 821 | Ga0207676_10172276 | |||
| 822 | Ga0207675_100106079 | |||
| 823 | Ga0265763_1012179 | |||
| 824 | Ga0265764_101786 | |||
| 825 | Ga0265769_101982 | |||
| 826 | Ga0265768_102137 | |||
| 827 | Ga0265779_102804 | |||
| 828 | Ga0265760_10135165 | |||
| 829 | Ga0373926_0001163 | |||
| 830 | Ga0373926_0034575 | |||
| 831 | Ga0373934_0002736 | |||
| 832 | Ga0373934_0004451 | |||
| 833 | Ga0373934_0067502 | |||
| 834 | Ga0373934_0075789 | |||
| 835 | Ga0373934_0290011 | |||
| 836 | Ga0373944_0025164 | |||
| 837 | Ga0373944_0057884 | |||
| 838 | Ga0373923_0000427 | |||
| 839 | Ga0373923_0005768 | |||
| 840 | Ga0373923_0010304 | |||
| 841 | Ga0373923_0093355 | |||
| 842 | Ga0373923_0133208 | |||
| 843 | Ga0373936_0001898 | |||
| 844 | Ga0373936_0020934 | |||
| 845 | Ga0373936_0210011 | |||
| 846 | Ga0373936_0210788 | |||
| 847 | Ga0373936_0231032 | |||
| 848 | Ga0373945_0000597 | |||
| 849 | Ga0373945_0335894 | |||
| 850 | Ga0373945_0339669 | |||
| 851 | Ga0373945_0403701 | |||
| 852 | Ga0373945_0422820 | |||
| 853 | Ga0373953_0000374 | |||
| 854 | Ga0373953_0013667 | |||
| 855 | Ga0373953_0023639 | |||
| 856 | Ga0373953_0223926 | |||
| 857 | Ga0373954_0000186 | |||
| 858 | Ga0373954_0009080 | |||
| 859 | Ga0373954_0034478 | |||
| 860 | Ga0373954_0048031 | |||
| 861 | Ga0373954_0160205 | |||
| 862 | Ga0373956_0001521 | |||
| 863 | Ga0373956_0002099 | |||
| 864 | Ga0373956_0013386 | |||
| 865 | Ga0373956_0415012 | |||
| 866 | Ga0373957_0000187 | |||
| 867 | Ga0373957_0026464 | |||
| 868 | Ga0373957_0058732 | |||
| 869 | Ga0373957_0122359 | |||
| 870 | Ga0373943_0002992 | |||
| 871 | Ga0373943_0024226 | |||
| 872 | Ga0373943_0468854 | |||
| 873 | Ga0373946_0006797 | |||
| 874 | Ga0373946_0600356 | |||
| 875 | Ga0373955_0002773 | |||
| 876 | Ga0373955_0009271 | |||
| 877 | Ga0373955_0016274 | |||
| 878 | Ga0373955_0026121 | |||
| 879 | Ga0373955_0146982 | |||
| 880 | Ga0373955_0149843 | |||
| 881 | Ga0373955_0172384 | |||
| 882 | Ga0373955_0190618 | |||
| 883 | Ga0373955_0198378 | |||
| 884 | Ga0373924_0006124 | |||
| 885 | Ga0373924_0020737 | |||
| 886 | Ga0373924_0034415 | |||
| 887 | Ga0373924_0120685 | |||
| 888 | Ga0373924_0250473 | |||
| 889 | Ga0373924_0295951 | |||
| 890 | Ga0373924_0475150 | |||
| 891 | Ga0373935_0000420 | |||
| 892 | Ga0373935_0016029 | |||
| 893 | Ga0373935_0181080 | |||
| 894 | Ga0373935_0194519 | |||
| 895 | Ga0373935_0212242 | |||
| 896 | Ga0373935_0274836 | |||
| 897 | Ga0373935_0391492 | |||
| 898 | Ga0373935_1160731 | |||
| 899 | Ga0373927_0006811 | |||
| 900 | Ga0373927_0097672 | |||
| 901 | Ga0373933_0002355 | |||
| 902 | Ga0373933_0002703 | |||
| 903 | Ga0373933_0033301 | |||
| 904 | Ga0373933_0056065 | |||
| 905 | Ga0373933_0082373 | |||
| 906 | Ga0373933_0125326 | |||
| 907 | Ga0373933_0500072 | |||
| 908 | Ga0373933_1024715 | |||
| 909 | Ga0373947_0014651 | |||
| 910 | Ga0373947_0042665 | |||
| 911 | Ga0373947_0048964 | |||
| 912 | Ga0373947_0143735 | |||
| 913 | Ga0373947_0209792 | |||
| 914 | Ga0373947_0255295 | |||
| 915 | Ga0373947_0900616 | |||
| 916 | Ga0373947_1233437 | |||
| 917 | Ga0373937_0012275 | |||
| 918 | Ga0373937_0017124 | |||
| 919 | Ga0373937_0029120 | |||
| 920 | Ga0373937_0051694 | |||
| 921 | Ga0373937_0121404 | |||
| 922 | Ga0373937_0156022 | |||
| 923 | Ga0373937_0340923 | |||
| 924 | Ga0373937_0364157 | |||
| 925 | Ga0373937_0548746 | |||
| 926 | Ga0373937_0569121 | |||
| 927 | Ga0373937_0806766 | |||
| 928 | Ga0373937_0861703 | |||
| 929 | Ga0373937_0929598 | |||
| 930 | Ga0373937_0974901 | |||
| 931 | Ga0373937_1337304 | |||
| 932 | Ga0373937_1379480 | |||
| 933 | Ga0265778_042855 | |||
| 934 | Ga0373925_0018409 | |||
| 935 | Ga0373925_0054638 | |||
| 936 | Ga0373925_0057407 | |||
| 937 | Ga0373925_0137018 | |||
| 938 | Ga0373925_0156540 | |||
| 939 | Ga0373925_0502595 | |||
| 940 | Ga0373925_0779881 | |||
| 941 | Ga0373925_0953804 | |||
| 942 | Ga0395899_0167791 | |||
| 943 | Ga0395899_0247823 | |||
| 944 | Ga0395898_0023974 | |||
| 945 | Ga0395905_0844899 | |||
| 946 | Ga0436361_0651804 | |||
| 947 | Ga0436362_0249601 | |||
| 948 | Ga0451795_1483078 | |||
| 949 | Ga0451847_0024155 | |||
| 950 | Ga0451849_1394978 | |||
| 951 | Ga0451851_0542810 | |||
| 952 | Ga0451853_1263169 | |||
| 953 | Ga0451853_1974014 | |||
| 954 | Ga0451853_3979905 | |||
| 955 | Ga0495592_0000835 | |||
| 956 | Ga0495592_0004468 | |||
| 957 | Ga0495592_0005231 | |||
| 958 | Ga0495592_0005840 | |||
| 959 | Ga0495592_0006888 | |||
| 960 | Ga0495592_0008401 | |||
| 961 | Ga0495592_0031445 | |||
| 962 | Ga0495592_0077648 | |||
| 963 | Ga0495592_0285020 | |||
| 964 | Ga0495592_0318830 | |||
| 965 | Ga0495592_0338014 | |||
| 966 | Ga0495592_0391238 | |||
| 967 | Ga0495603_0002523 | |||
| 968 | Ga0495603_0006239 | |||
| 969 | Ga0495603_0029728 | |||
| 970 | Ga0495603_0041602 | |||
| 971 | Ga0495603_0384340 | |||
| 972 | Ga0495603_0391899 | |||
| 973 | Ga0495603_0775736 | |||
| 974 | Ga0495629_0020056 | |||
| 975 | Ga0495629_0034398 | |||
| 976 | Ga0495629_0057970 | |||
| 977 | Ga0495629_0173878 | |||
| 978 | Ga0495629_0231254 | |||
| 979 | Ga0495629_0372603 | |||
| 980 | Ga0495629_0413645 | |||
| 981 | Ga0495629_0717233 | |||
| 982 | Ga0495641_0008399 | |||
| 983 | Ga0495641_0040184 | |||
| 984 | Ga0495641_0062472 | |||
| 985 | Ga0495641_0069001 | |||
| 986 | Ga0495641_0076547 | |||
| 987 | Ga0495641_0121976 | |||
| 988 | Ga0495641_0199000 | |||
| 989 | Ga0495641_0367350 | |||
| 990 | Ga0495641_0403146 | |||
| 991 | Ga0495651_0000784 | |||
| 992 | Ga0495651_0002556 | |||
| 993 | Ga0495651_0002738 | |||
| 994 | Ga0495651_0005571 | |||
| 995 | Ga0495651_0026930 | |||
| 996 | Ga0495651_0043055 | |||
| 997 | Ga0495651_0059231 | |||
| 998 | Ga0495651_0076797 | |||
| 999 | Ga0495651_0102875 | |||
| 1000 | Ga0495651_0186904 | |||
| 1001 | Ga0495651_0227750 | |||
| 1002 | Ga0495651_0646192 | |||
| 1003 | Ga0495653_0007183 | |||
| 1004 | Ga0495653_0010802 | |||
| 1005 | Ga0495653_0013890 | |||
| 1006 | Ga0495653_0015950 | |||
| 1007 | Ga0495653_0018111 | |||
| 1008 | Ga0495653_0020423 | |||
| 1009 | Ga0495653_0025772 | |||
| 1010 | Ga0495653_0063579 | |||
| 1011 | Ga0495653_0079288 | |||
| 1012 | Ga0495653_0093349 | |||
| 1013 | Ga0495653_0100384 | |||
| 1014 | Ga0495653_0148281 | |||
| 1015 | Ga0495653_0161947 | |||
| 1016 | Ga0495653_0219606 | |||
| 1017 | Ga0495653_0316848 | |||
| 1018 | Ga0495653_0460496 | |||
| 1019 | Ga0495580_0006731 | |||
| 1020 | Ga0495580_0011409 | |||
| 1021 | Ga0495580_0438146 | |||
| 1022 | Ga0495580_0621240 | |||
| 1023 | Ga0495582_0002143 | |||
| 1024 | Ga0495582_0002486 | |||
| 1025 | Ga0495582_0078909 | |||
| 1026 | Ga0495582_0111350 | |||
| 1027 | Ga0495582_0118718 | |||
| 1028 | Ga0495582_0244750 | |||
| 1029 | Ga0495639_0006628 | |||
| 1030 | Ga0495639_0016039 | |||
| 1031 | Ga0495639_0092147 | |||
| 1032 | Ga0495639_0110456 | |||
| 1033 | Ga0495639_0219030 | |||
| 1034 | Ga0495662_0004592 | |||
| 1035 | Ga0495662_0010286 | |||
| 1036 | Ga0495662_0137433 | |||
| 1037 | Ga0495662_0200979 | |||
| 1038 | Ga0495664_0013665 | |||
| 1039 | Ga0495664_0017646 | |||
| 1040 | Ga0495664_0018299 | |||
| 1041 | Ga0495664_0024616 | |||
| 1042 | Ga0495664_0037718 | |||
| 1043 | Ga0495664_0041010 | |||
| 1044 | Ga0495664_0089397 | |||
| 1045 | Ga0495664_0097497 | |||
| 1046 | Ga0495664_0136129 | |||
| 1047 | Ga0495664_0304556 | |||
| 1048 | Ga0495664_0500698 | |||
| 1049 | Ga0495664_0500825 | |||
| 1050 | Ga0495664_0575078 | |||
| 1051 | Ga0495584_0236921 | |||
| 1052 | Ga0495585_0227505 | |||
| 1053 | Ga0495594_0015464 | |||
| 1054 | Ga0495594_0025405 | |||
| 1055 | Ga0495594_0119806 | |||
| 1056 | Ga0495594_0433663 | |||
| 1057 | Ga0495594_0471343 | |||
| 1058 | Ga0495594_0611626 | |||
| 1059 | Ga0495607_0347715 | |||
| 1060 | Ga0495608_0001092 | |||
| 1061 | Ga0495608_0004876 | |||
| 1062 | Ga0495608_0009047 | |||
| 1063 | Ga0495608_0019085 | |||
| 1064 | Ga0495608_0022780 | |||
| 1065 | Ga0495608_0129649 | |||
| 1066 | Ga0495608_0405334 | |||
| 1067 | Ga0495608_0535917 | |||
| 1068 | Ga0495618_0002062 | |||
| 1069 | Ga0495618_0082325 | |||
| 1070 | Ga0495618_0239621 | |||
| 1071 | Ga0495618_0367047 | |||
| 1072 | Ga0495618_0439350 | |||
| 1073 | Ga0495628_0001853 | |||
| 1074 | Ga0495628_0003908 | |||
| 1075 | Ga0495628_0005891 | |||
| 1076 | Ga0495628_0019647 | |||
| 1077 | Ga0495628_0028121 | |||
| 1078 | Ga0495628_0044517 | |||
| 1079 | Ga0495628_0076167 | |||
| 1080 | Ga0495628_0097994 | |||
| 1081 | Ga0495628_0408740 | |||
| 1082 | Ga0495628_0426801 | |||
| 1083 | Ga0495628_0629724 | |||
| 1084 | Ga0495630_0000711 | |||
| 1085 | Ga0495630_0004951 | |||
| 1086 | Ga0495630_0004980 | |||
| 1087 | Ga0495630_0045044 | |||
| 1088 | Ga0495630_0075576 | |||
| 1089 | Ga0495630_0120309 | |||
| 1090 | Ga0495630_0410396 | |||
| 1091 | Ga0495630_0417277 | |||
| 1092 | Ga0495630_0426872 | |||
| 1093 | Ga0495630_0746171 | |||
| 1094 | Ga0495644_0250871 | |||
| 1095 | Ga0495666_0003437 | |||
| 1096 | Ga0495666_0011556 | |||
| 1097 | Ga0495666_0241008 | |||
| 1098 | Ga0495666_0319371 | |||
| 1099 | Ga0495652_0002099 | |||
| 1100 | Ga0495652_0004726 | |||
| 1101 | Ga0495652_0008171 | |||
| 1102 | Ga0495652_0021323 | |||
| 1103 | Ga0495652_0026510 | |||
| 1104 | Ga0495652_0047211 | |||
| 1105 | Ga0495652_0114351 | |||
| 1106 | Ga0495652_0121061 | |||
| 1107 | Ga0495652_0139580 | |||
| 1108 | Ga0495652_0150737 | |||
| 1109 | Ga0495652_0180526 | |||
| 1110 | Ga0495652_0214203 | |||
| 1111 | Ga0495652_0216213 | |||
| 1112 | Ga0495652_0247899 | |||
| 1113 | Ga0495652_0260804 | |||
| 1114 | Ga0495652_0260984 | |||
| 1115 | Ga0495652_0277311 | |||
| 1116 | Ga0495652_0365618 | |||
| 1117 | Ga0495652_0411869 | |||
| 1118 | Ga0495652_0626536 | |||
| 1119 | Ga0495652_0898127 | |||
| 1120 | Ga0495665_0006423 | |||
| 1121 | Ga0495665_0013283 | |||
| 1122 | Ga0495665_0013298 | |||
| 1123 | Ga0495665_0176993 | |||
| 1124 | Ga0495640_0003219 | |||
| 1125 | Ga0495640_0006138 | |||
| 1126 | Ga0495640_0007333 | |||
| 1127 | Ga0495640_0010650 | |||
| 1128 | Ga0495640_0200330 | |||
| 1129 | Ga0495640_0354934 | |||
| 1130 | Ga0495640_0498146 | |||
| 1131 | Ga0495640_0715731 | |||
| 1132 | Ga0495586_0005577 | |||
| 1133 | Ga0495586_0174047 | |||
| 1134 | Ga0495586_0526952 | |||
| 1135 | Ga0495586_0560737 | |||
| 1136 | Ga0495587_0002018 | |||
| 1137 | Ga0495587_0004135 | |||
| 1138 | Ga0495587_0008621 | |||
| 1139 | Ga0495587_0013468 | |||
| 1140 | Ga0495587_0021600 | |||
| 1141 | Ga0495587_0041279 | |||
| 1142 | Ga0495587_0059618 | |||
| 1143 | Ga0495587_0065577 | |||
| 1144 | Ga0495587_0065658 | |||
| 1145 | Ga0495587_0099903 | |||
| 1146 | Ga0495587_0229389 | |||
| 1147 | Ga0495587_0717520 | |||
| 1148 | Ga0495645_0010823 | |||
| 1149 | Ga0495645_0011132 | |||
| 1150 | Ga0495645_0035172 | |||
| 1151 | Ga0495645_0036071 | |||
| 1152 | Ga0495645_0036673 | |||
| 1153 | Ga0495645_0084720 | |||
| 1154 | Ga0495645_0125429 | |||
| 1155 | Ga0495645_0470153 | |||
| 1156 | Ga0495645_0599706 | |||
| 1157 | Ga0495645_0623096 | |||
| 1158 | Ga0495645_0659345 | |||
| 1159 | Ga0495622_0127076 | |||
| 1160 | Ga0495667_0002979 | |||
| 1161 | Ga0495667_0003050 | |||
| 1162 | Ga0495667_0004823 | |||
| 1163 | Ga0495667_0004939 | |||
| 1164 | Ga0495667_0005341 | |||
| 1165 | Ga0495667_0066506 | |||
| 1166 | Ga0495667_0072059 | |||
| 1167 | Ga0495667_0077950 | |||
| 1168 | Ga0495667_0088964 | |||
| 1169 | Ga0495667_0174317 | |||
| 1170 | Ga0495667_0211676 | |||
| 1171 | Ga0495667_0606834 | |||
| 1172 | Ga0495667_0688211 | |||
| 1173 | Ga0495634_0004863 | |||
| 1174 | Ga0495634_0011070 | |||
| 1175 | Ga0495634_0012074 | |||
| 1176 | Ga0495634_0086641 | |||
| 1177 | Ga0495634_0129950 | |||
| 1178 | Ga0495634_0194586 | |||
| 1179 | Ga0495634_0246775 | |||
| 1180 | Ga0495634_0325785 | |||
| 1181 | Ga0495635_0002890 | |||
| 1182 | Ga0495635_0018181 | |||
| 1183 | Ga0495635_0020591 | |||
| 1184 | Ga0495635_0021774 | |||
| 1185 | Ga0495635_0099767 | |||
| 1186 | Ga0495635_0134915 | |||
| 1187 | Ga0495635_0156425 | |||
| 1188 | Ga0495635_0218521 | |||
| 1189 | Ga0495635_0331022 | |||
| 1190 | Ga0495635_0432689 | |||
| 1191 | Ga0495635_0620430 | |||
| 1192 | Ga0495635_0809261 | |||
| 1193 | Ga0495588_0022338 | |||
| 1194 | Ga0495588_0465071 | |||
| 1195 | Ga0495657_0002344 | |||
| 1196 | Ga0495657_0005932 | |||
| 1197 | Ga0495657_0008082 | |||
| 1198 | Ga0495657_0015134 | |||
| 1199 | Ga0495657_0026611 | |||
| 1200 | Ga0495657_0055934 | |||
| 1201 | Ga0495657_0062860 | |||
| 1202 | Ga0495657_0072582 | |||
| 1203 | Ga0495657_0076798 | |||
| 1204 | Ga0495657_0290753 | |||
| 1205 | Ga0495657_0530855 | |||
| 1206 | Ga0495657_0606089 | |||
| 1207 | Ga0495599_0000517 | |||
| 1208 | Ga0495599_0001250 | |||
| 1209 | Ga0495599_0001497 | |||
| 1210 | Ga0495599_0003197 | |||
| 1211 | Ga0495599_0013537 | |||
| 1212 | Ga0495599_0020401 | |||
| 1213 | Ga0495599_0034648 | |||
| 1214 | Ga0495599_0038474 | |||
| 1215 | Ga0495599_0081198 | |||
| 1216 | Ga0495599_0108857 | |||
| 1217 | Ga0495599_0122324 | |||
| 1218 | Ga0495599_0137483 | |||
| 1219 | Ga0495599_0544624 | |||
| 1220 | Ga0495623_0002649 | |||
| 1221 | Ga0495623_0030027 | |||
| 1222 | Ga0495623_0035650 | |||
| 1223 | Ga0495623_0047091 | |||
| 1224 | Ga0495623_0120955 | |||
| 1225 | Ga0495623_0130379 | |||
| 1226 | Ga0495646_0001358 | |||
| 1227 | Ga0495646_0005190 | |||
| 1228 | Ga0495646_0016457 | |||
| 1229 | Ga0495646_0024700 | |||
| 1230 | Ga0495646_0062412 | |||
| 1231 | Ga0495646_0087808 | |||
| 1232 | Ga0495646_0130982 | |||
| 1233 | Ga0495646_0199305 | |||
| 1234 | Ga0495646_0312339 | |||
| 1235 | Ga0495646_0327043 | |||
| 1236 | Ga0495646_0528591 | |||
| 1237 | Ga0495647_0015772 | |||
| 1238 | Ga0495647_0115756 | |||
| 1239 | Ga0495647_0377736 | |||
| 1240 | Ga0495647_0608337 | |||
| 1241 | Ga0495658_0003423 | |||
| 1242 | Ga0495658_0019065 | |||
| 1243 | Ga0495658_0207987 | |||
| 1244 | Ga0495658_0393574 | |||
| 1245 | Ga0495658_0475681 | |||
| 1246 | Ga0495658_0608717 | |||
| 1247 | Ga0495658_0973566 | |||
| 1248 | Ga0495613_0004445 | |||
| 1249 | Ga0495613_0010492 | |||
| 1250 | Ga0495613_0066395 | |||
| 1251 | Ga0495613_0122036 | |||
| 1252 | Ga0495613_0176738 | |||
| 1253 | Ga0495613_0491814 | |||
| 1254 | Ga0495624_0002090 | |||
| 1255 | Ga0495624_0025438 | |||
| 1256 | Ga0495624_0078165 | |||
| 1257 | Ga0495624_0391053 | |||
| 1258 | Ga0495624_0410234 | |||
| 1259 | Ga0495624_0482498 | |||
| 1260 | Ga0495624_0551693 | |||
| 1261 | Ga0495670_0772408 | |||
| 1262 | Ga0495589_0349940 | |||
| 1263 | Ga0495600_0004301 | |||
| 1264 | Ga0495600_0006336 | |||
| 1265 | Ga0495600_0012838 | |||
| 1266 | Ga0495600_0046493 | |||
| 1267 | Ga0495600_0055466 | |||
| 1268 | Ga0495600_0112344 | |||
| 1269 | Ga0495600_0125319 | |||
| 1270 | Ga0495600_0153984 | |||
| 1271 | Ga0495600_0210488 | |||
| 1272 | Ga0495600_0243492 | |||
| 1273 | Ga0495600_0245984 | |||
| 1274 | Ga0495600_0314170 | |||
| 1275 | Ga0495600_0342408 | |||
| 1276 | Ga0495600_0716469 | |||
| 1277 | Ga0495581_0001545 | |||
| 1278 | Ga0495581_0002143 | |||
| 1279 | Ga0495581_0011576 | |||
| 1280 | Ga0495581_0019871 | |||
| 1281 | Ga0495581_0116408 | |||
| 1282 | Ga0495604_0004237 | |||
| 1283 | Ga0495604_0006077 | |||
| 1284 | Ga0495604_0009320 | |||
| 1285 | Ga0495604_0018769 | |||
| 1286 | Ga0495604_0083991 | |||
| 1287 | Ga0495604_0097809 | |||
| 1288 | Ga0495604_0114296 | |||
| 1289 | Ga0495604_0331916 | |||
| 1290 | Ga0495604_0916821 | |||
| 1291 | Ga0495674_0001155 | |||
| 1292 | Ga0495674_0006505 | |||
| 1293 | Ga0495674_0007595 | |||
| 1294 | Ga0495674_0009809 | |||
| 1295 | Ga0495674_0011462 | |||
| 1296 | Ga0495674_0032941 | |||
| 1297 | Ga0495674_0041093 | |||
| 1298 | Ga0495674_0057642 | |||
| 1299 | Ga0495674_0112405 | |||
| 1300 | Ga0495674_0129012 | |||
| 1301 | Ga0495674_0138443 | |||
| 1302 | Ga0495674_0143073 | |||
| 1303 | Ga0495674_0199912 | |||
| 1304 | Ga0495674_0256616 | |||
| 1305 | Ga0495674_0544573 | |||
| 1306 | Ga0495674_0607510 | |||
| 1307 | Ga0495674_0915505 | |||
| 1308 | Ga0495674_1454507 | |||
| 1309 | Ga0495676_0007203 | |||
| 1310 | Ga0495676_0013893 | |||
| 1311 | Ga0495676_0071411 | |||
| 1312 | Ga0495676_0119950 | |||
| 1313 | Ga0495676_0271063 | |||
| 1314 | Ga0495676_0312205 | |||
| 1315 | Ga0495676_0392354 | |||
| 1316 | Ga0495676_0940750 | |||
| 1317 | Ga0495680_0003815 | |||
| 1318 | Ga0495680_0003854 | |||
| 1319 | Ga0495680_0004037 | |||
| 1320 | Ga0495680_0007244 | |||
| 1321 | Ga0495680_0008067 | |||
| 1322 | Ga0495680_0009024 | |||
| 1323 | Ga0495680_0009481 | |||
| 1324 | Ga0495680_0016048 | |||
| 1325 | Ga0495680_0016453 | |||
| 1326 | Ga0495680_0018494 | |||
| 1327 | Ga0495680_0090686 | |||
| 1328 | Ga0495680_0131744 | |||
| 1329 | Ga0495680_0144950 | |||
| 1330 | Ga0495680_0188048 | |||
| 1331 | Ga0495680_0378789 | |||
| 1332 | Ga0495680_0404879 | |||
| 1333 | Ga0495680_0501134 | |||
| 1334 | Ga0495680_0555115 | |||
| 1335 | Ga0495680_0656378 | |||
| 1336 | Ga0495675_0006365 | |||
| 1337 | Ga0495675_0008614 | |||
| 1338 | Ga0495675_0037979 | |||
| 1339 | Ga0495675_0041007 | |||
| 1340 | Ga0495675_0052190 | |||
| 1341 | Ga0495675_0074093 | |||
| 1342 | Ga0495675_0119365 | |||
| 1343 | Ga0495675_0190361 | |||
| 1344 | Ga0495677_0293390 | |||
| 1345 | Ga0495684_0002514 | |||
| 1346 | Ga0495684_0005968 | |||
| 1347 | Ga0495684_0017681 | |||
| 1348 | Ga0495684_0019530 | |||
| 1349 | Ga0495684_0021969 | |||
| 1350 | Ga0495684_0040280 | |||
| 1351 | Ga0495684_0091077 | |||
| 1352 | Ga0495684_0130043 | |||
| 1353 | Ga0495684_0240262 | |||
| 1354 | Ga0495684_0288051 | |||
| 1355 | Ga0495684_0366335 | |||
| 1356 | Ga0495684_0507181 | |||
| 1357 | Ga0495684_0712964 | |||
| 1358 | Ga0495593_0000755 | |||
| 1359 | Ga0495593_0008858 | |||
| 1360 | Ga0495602_0007030 | |||
| 1361 | Ga0495602_0010510 | |||
| 1362 | Ga0495602_0030868 | |||
| 1363 | Ga0495602_0075631 | |||
| 1364 | Ga0495602_0088437 | |||
| 1365 | Ga0495602_0105465 | |||
| 1366 | Ga0495602_0124508 | |||
| 1367 | Ga0495602_0249710 | |||
| 1368 | Ga0495602_0297085 | |||
| 1369 | Ga0495602_0327340 | |||
| 1370 | Ga0495602_0384454 | |||
| 1371 | Ga0495602_0516530 | |||
| 1372 | Ga0495602_0521523 | |||
| 1373 | Ga0495602_0700363 | |||
| 1374 | Ga0495602_0732632 | |||
| 1375 | Ga0495602_0992398 | |||
| 1376 | Ga0495602_1107333 | |||
| 1377 | Ga0495614_0023665 | |||
| 1378 | Ga0495614_0304769 | |||
| 1379 | Ga0495615_0281839 | |||
| 1380 | Ga0496102_0758722 | |||
| 1381 | Ga0496104_0467938 | |||
| 1382 | Ga0496104_0477506 | |||
| 1383 | Ga0496104_0969382 | |||
| 1384 | Ga0496105_0294997 | |||
| 1385 | Ga0496105_0475428 | |||
| 1386 | Ga0496108_1782599 | |||
| 1387 | Ga0496109_0132183 | |||
| 1388 | Ga0496109_0148231 | |||
| 1389 | Ga0496109_0437363 | |||
| 1390 | Ga0496109_0578939 | |||
| 1391 | Ga0496110_1353769 | |||
| 1392 | Ga0496112_0004932 | |||
| 1393 | Ga0496112_0084839 | |||
| 1394 | Ga0496113_0479589 | |||
| 1395 | Ga0496113_0760180 | |||
| 1396 | Ga0496114_0198906 | |||
| 1397 | Ga0496114_0328892 | |||
| 1398 | Ga0496114_0335956 | |||
| 1399 | Ga0496115_0062186 | |||
| 1400 | Ga0496115_0163945 | |||
| 1401 | nmdc:mga05p37_30851_c1 | |||
| 1402 | nmdc:mga09592_6874_c1 | |||
| 1403 | nmdc:mga0qj67_6375_c1 | |||
| 1404 | nmdc:mga06r32_99963_c1 | |||
| 1405 | Ga0495601_0003803 | |||
| 1406 | Ga0495601_0007624 | |||
| 1407 | Ga0495601_0054300 | |||
| 1408 | Ga0495601_0137114 | |||
| 1409 | Ga0495601_0186890 | |||
| 1410 | Ga0495601_0277606 | |||
| 1411 | Ga0495601_0512853 | |||
| 1412 | Ga0495612_0004254 | |||
| 1413 | Ga0495612_0024353 | |||
| 1414 | Ga0495612_0079651 | |||
| 1415 | Ga0495612_0155941 | |||
| 1416 | Ga0495612_0175854 | |||
| 1417 | Ga0495612_0274451 | |||
| 1418 | Ga0495595_0002462 | |||
| 1419 | Ga0495595_0011541 | |||
| 1420 | Ga0495595_0065716 | |||
| 1421 | Ga0495595_0078302 | |||
| 1422 | Ga0495595_0099657 | |||
| 1423 | Ga0495595_0147241 | |||
| 1424 | Ga0495595_0148792 | |||
| 1425 | Ga0495595_0211351 | |||
| 1426 | Ga0495619_0013138 | |||
| 1427 | Ga0495619_0018477 | |||
| 1428 | Ga0495619_0041578 | |||
| 1429 | Ga0495619_0060942 | |||
| 1430 | Ga0495619_0076184 | |||
| 1431 | Ga0495619_0219573 | |||
| 1432 | Ga0495619_0284917 | |||
| 1433 | Ga0495619_0285307 | |||
| 1434 | Ga0495619_0302661 | |||
| 1435 | Ga0495619_0469719 | |||
| 1436 | Ga0495619_0909890 | |||
| 1437 | Ga0587073_0323681 | |||
| 1438 | Ga0587079_114872 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2imj-assembly2.cif.gz_D | x-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14. | 0.9137 | 28 | 127 |
| 3kkg-assembly1.cif.gz_A-2 | crystal structure of putative snoal-like polyketide cyclase (yp_509242.1) from jannaschia sp. ccs1 at 1.40 a resolution | 0.8776 | 5 | 138 |
| 4hvn-assembly1.cif.gz_B | crystal structure of hypothetical protein with ketosteroid isomerase-like protein fold from catenulispora acidiphila dsm 44928 in complex with trimethylamine. | 0.8629 | 8 | 136 |
| 3k0z-assembly1.cif.gz_B | crystal structure of putative polyketide cyclase (np_977253.1) from bacillus cereus atcc 10987 at 1.91 a resolution | 0.8551 | 3 | 136 |
| 4lgq-assembly2.cif.gz_D | crystal structure of a putative polyketide cyclase (cv_0247) from chromobacterium violaceum atcc 12472 at 2.72 a resolution | 0.8477 | 4 | 136 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3k0zB00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8641 | 3 | 136 | 3.10.450.50 |
| 3kkgA00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8588 | 5 | 138 | 3.10.450.50 |
| af_P96818_5_130_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8556 | 5 | 134 | 3.10.450.50 |
| 4lgqD00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8541 | 4 | 136 | 3.10.450.50 |
| 5aigB00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8396 | 4 | 137 | 3.10.450.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A524N2H5-F1-model_v4 | SnoaL-like domain-containing protein | 0.9714 | 4 | 136 |
|
| AF-A0A534M0I7-F1-model_v4 | Ester cyclase | 0.965 | 62 | 136 |
GO:0030638
|
| AF-M0HX01-F1-model_v4 | Ester cyclase | 0.9558 | 18 | 138 |
GO:0030638
|
| AF-A0A544ZCV4-F1-model_v4 | Ester cyclase | 0.9446 | 26 | 136 |
GO:0030638
|
| AF-A0A521XYQ0-F1-model_v4 | Ester cyclase | 0.9439 | 19 | 136 |
GO:0030638
|