F477208

General Info

Members Datasets Scaffolds Average Seq Length
719 220 1438 131

Family's Representative Sequence

Representative Sequence 3300001904|JGI24736J21556_1014536|JGI24736J21556_10145363
Length 131
Sequence MSRGESATPLGVVRGLGSAHHGGEHWLTERVTSIALLFLGTWFIASLLLLPKLDQRTLIEWLHAPSGAIPMALLVVIGFRHALDGMKVVIDDYVHEEGSRFALNLLMLFLAVGGGAIALFALARIAFGAVA

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
179 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
180 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
181 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
182 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
183 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
184 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
185 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
190 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
191 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
192 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
199 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
200 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
201 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
202 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
203 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
204 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
218 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
219 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.62
Rhizosphere 96.24
Stem 0
Stem Tuber 0
Unclassified 4.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1014536 3300001904 Bacteria 1267
2 JGI24741J21665_1009493 3300001915 Bacteria 1784
3 JGI24740J21852_10001913 3300001979 Bacteria 9554
4 JGI24740J21852_10005256 3300001979 Bacteria 5496
5 JGI24740J21852_10011356 3300001979 Bacteria 3393
6 JGI24740J21852_10013067 3300001979 Bacteria 3113
7 JGI24740J21852_10101819 3300001979 Bacteria 730
8 JGI24739J22299_10043840 3300001989 Bacteria 1477
9 JGI24737J22298_10070957 3300001990 Bacteria 1040
10 JGI24737J22298_10130093 3300001990 Bacteria 744
11 JGI24735J21928_10006011 3300002067 Bacteria 4011
12 JGI24735J21928_10057254 3300002067 Bacteria 1122
13 JGI24738J21930_10034179 3300002075 Bacteria 1035
14 JGI24744J21845_10004290 3300002077 Bacteria 2943
15 JGI24034J26672_10043958 3300002239 Bacteria 755
16 JGI24742J22300_10042834 3300002244 Bacteria 809
17 JGI25406J46586_10177532 3300003203 Bacteria 621
18 Ga0065715_10547121 3300005293 Bacteria 743
19 Ga0070658_10012565 3300005327 Bacteria 6792
20 Ga0070658_10027327 3300005327 Bacteria 4580
21 Ga0070658_10533074 3300005327 Bacteria 1015
22 Ga0070658_10666529 3300005327 Bacteria 903
23 Ga0070658_10984279 3300005327 Bacteria 733
24 Ga0070676_10047109 3300005328 Bacteria 2516
25 Ga0070676_10074140 3300005328 Bacteria 2049
26 Ga0070676_10691564 3300005328 Bacteria 744
27 Ga0070676_11516017 3300005328 Bacteria 516
28 Ga0070683_100025828 3300005329 Bacteria 5282
29 Ga0070683_100355285 3300005329 Bacteria 1395
30 Ga0070683_100397204 3300005329 Bacteria 1315
31 Ga0070683_100405948 3300005329 Bacteria 1299
32 Ga0070690_100016347 3300005330 Bacteria 4443
33 Ga0070690_101223611 3300005330 Bacteria 599
34 Ga0070670_100001616 3300005331 Bacteria 18214
35 Ga0070670_100048422 3300005331 Bacteria 3658
36 Ga0070670_100100760 3300005331 Bacteria 2487
37 Ga0070670_100158725 3300005331 Bacteria 1959
38 Ga0070670_100587361 3300005331 Bacteria 996
39 Ga0070677_10019968 3300005333 Bacteria 2435
40 Ga0070677_10069829 3300005333 Bacteria 1475
41 Ga0068869_100027716 3300005334 Bacteria 3952
42 Ga0070666_10000421 3300005335 Bacteria 26263
43 Ga0070666_10059025 3300005335 Bacteria 2594
44 Ga0070666_10065648 3300005335 Bacteria 2462
45 Ga0070666_10159137 3300005335 Bacteria 1578
46 Ga0070680_100000483 3300005336 Bacteria 27370
47 Ga0070680_100008726 3300005336 Bacteria 7771
48 Ga0070680_100024830 3300005336 Bacteria 4790
49 Ga0070680_100085354 3300005336 Bacteria 2608
50 Ga0070682_101131517 3300005337 Bacteria 657
51 Ga0068868_100000688 3300005338 Bacteria 22698
52 Ga0068868_100085455 3300005338 Bacteria 2535
53 Ga0068868_100298984 3300005338 Bacteria 1367
54 Ga0068868_100589704 3300005338 Bacteria 983
55 Ga0070660_100000490 3300005339 Bacteria 26435
56 Ga0070660_100011472 3300005339 Bacteria 6299
57 Ga0070660_100113832 3300005339 Bacteria 2154
58 Ga0070660_100135841 3300005339 Bacteria 1970
59 Ga0070660_100920627 3300005339 Bacteria 737
60 Ga0070689_100494618 3300005340 Bacteria 1047
61 Ga0070691_10003873 3300005341 Bacteria 6764
62 Ga0070687_100126848 3300005343 Bacteria 1468
63 Ga0070687_100320089 3300005343 Bacteria 991
64 Ga0070661_100051420 3300005344 Bacteria 3016
65 Ga0070661_100119835 3300005344 Bacteria 1970
66 Ga0070661_100355057 3300005344 Bacteria 1151
67 Ga0070661_100636876 3300005344 Bacteria 864
68 Ga0070661_100983132 3300005344 Bacteria 699
69 Ga0070661_101105585 3300005344 Unclassified 660
70 Ga0070692_10124324 3300005345 Bacteria 1442
71 Ga0070692_10404086 3300005345 Bacteria 863
72 Ga0070675_100065802 3300005354 Bacteria 2997
73 Ga0070675_100145668 3300005354 Bacteria 2028
74 Ga0070671_100001670 3300005355 Bacteria 16795
75 Ga0070671_100002301 3300005355 Bacteria 14752
76 Ga0070671_100023437 3300005355 Bacteria 5052
77 Ga0070671_100041234 3300005355 Bacteria 3836
78 Ga0070671_101006050 3300005355 Bacteria 730
79 Ga0070671_101758807 3300005355 Unclassified 550
80 Ga0070674_100007052 3300005356 Bacteria 6608
81 Ga0070674_100030741 3300005356 Bacteria 3552
82 Ga0070674_100276306 3300005356 Bacteria 1330
83 Ga0070674_100426654 3300005356 Bacteria 1089
84 Ga0070673_100038330 3300005364 Bacteria 3659
85 Ga0070673_100040825 3300005364 Bacteria 3562
86 Ga0070673_100074185 3300005364 Bacteria 2741
87 Ga0070673_100181368 3300005364 Bacteria 1803
88 Ga0070673_100269175 3300005364 Bacteria 1491
89 Ga0070673_102134699 3300005364 Unclassified 532
90 Ga0070688_100428402 3300005365 Bacteria 985
91 Ga0070659_100003051 3300005366 Bacteria 11908
92 Ga0070659_100044776 3300005366 Bacteria 3466
93 Ga0070659_100144557 3300005366 Bacteria 1937
94 Ga0070667_100001036 3300005367 Bacteria 25394
95 Ga0070667_100419179 3300005367 Bacteria 1220
96 Ga0070667_100991865 3300005367 Bacteria 784
97 Ga0070709_10039890 3300005434 Bacteria 2884
98 Ga0070709_10409660 3300005434 Bacteria 1014
99 Ga0070714_100040798 3300005435 Bacteria 3913
100 Ga0070714_100062130 3300005435 Bacteria 3210
101 Ga0070714_100207364 3300005435 Bacteria 1795
102 Ga0070714_100620397 3300005435 Bacteria 1039
103 Ga0070714_100744660 3300005435 Bacteria 947
104 Ga0070714_101168662 3300005435 Bacteria 750
105 Ga0070714_101266797 3300005435 Bacteria 720
106 Ga0070713_100042358 3300005436 Bacteria 3715
107 Ga0070713_100097670 3300005436 Bacteria 2538
108 Ga0070713_100496672 3300005436 Bacteria 1151
109 Ga0070713_101111102 3300005436 Bacteria 764
110 Ga0070711_100781046 3300005439 Unclassified 809
111 Ga0070663_100001084 3300005455 Bacteria 14909
112 Ga0070663_100060432 3300005455 Bacteria 2726
113 Ga0070663_100067138 3300005455 Bacteria 2600
114 Ga0070663_100217762 3300005455 Bacteria 1498
115 Ga0070663_100251220 3300005455 Bacteria 1399
116 Ga0070663_100748065 3300005455 Unclassified 834
117 Ga0070678_100031099 3300005456 Bacteria 3677
118 Ga0070678_100083261 3300005456 Bacteria 2431
119 Ga0070678_100358946 3300005456 Bacteria 1255
120 Ga0070678_100873525 3300005456 Bacteria 821
121 Ga0070678_101678017 3300005456 Bacteria 598
122 Ga0070662_100006947 3300005457 Bacteria 7325
123 Ga0070662_100067705 3300005457 Bacteria 2623
124 Ga0070662_100182175 3300005457 Bacteria 1656
125 Ga0070662_100209781 3300005457 Bacteria 1549
126 Ga0070662_100349090 3300005457 Bacteria 1212
127 Ga0070681_10148161 3300005458 Bacteria 2274
128 Ga0070681_10149403 3300005458 Bacteria 2264
129 Ga0070681_11050488 3300005458 Bacteria 735
130 Ga0068867_100020204 3300005459 Bacteria 4746
131 Ga0068867_100334459 3300005459 Bacteria 1259
132 Ga0068867_100504347 3300005459 Bacteria 1040
133 Ga0070685_10555903 3300005466 Bacteria 820
134 Ga0070679_100008094 3300005530 Bacteria 9878
135 Ga0070679_100217530 3300005530 Bacteria 1872
136 Ga0070679_100401303 3300005530 Bacteria 1317
137 Ga0070679_100560021 3300005530 Unclassified 1087
138 Ga0070679_100794553 3300005530 Bacteria 889
139 Ga0070684_100020494 3300005535 Bacteria 5485
140 Ga0070684_100138598 3300005535 Bacteria 2199
141 Ga0070684_100430390 3300005535 Bacteria 1218
142 Ga0068853_100131011 3300005539 Bacteria 2245
143 Ga0068853_100136614 3300005539 Bacteria 2198
144 Ga0068853_100416212 3300005539 Bacteria 1260
145 Ga0068853_101096681 3300005539 Bacteria 767
146 Ga0070672_100127635 3300005543 Bacteria 2088
147 Ga0070672_100178257 3300005543 Bacteria 1770
148 Ga0070672_100241441 3300005543 Bacteria 1520
149 Ga0070672_101031769 3300005543 Bacteria 729
150 Ga0070672_101594339 3300005543 Bacteria 586
151 Ga0070686_100098327 3300005544 Bacteria 1972
152 Ga0070686_101255627 3300005544 Bacteria 617
153 Ga0070693_101342863 3300005547 Bacteria 554
154 Ga0070665_100062134 3300005548 Bacteria 3745
155 Ga0070665_100678004 3300005548 Bacteria 1044
156 Ga0068855_100023981 3300005563 Bacteria 7304
157 Ga0068855_100461235 3300005563 Bacteria 1385
158 Ga0068855_100475529 3300005563 Bacteria 1361
159 Ga0068855_100543428 3300005563 Bacteria 1258
160 Ga0068855_100661806 3300005563 Bacteria 1121
161 Ga0068855_100699898 3300005563 Bacteria 1084
162 Ga0068855_101258036 3300005563 Bacteria 767
163 Ga0068855_101987318 3300005563 Bacteria 587
164 Ga0070664_100000675 3300005564 Bacteria 26078
165 Ga0070664_100019938 3300005564 Bacteria 5520
166 Ga0070664_100021493 3300005564 Bacteria 5319
167 Ga0070664_100114553 3300005564 Bacteria 2356
168 Ga0070664_100412484 3300005564 Bacteria 1236
169 Ga0070664_100478735 3300005564 Bacteria 1145
170 Ga0070664_100965038 3300005564 Bacteria 800
171 Ga0068857_100029992 3300005577 Bacteria 4799
172 Ga0068857_100219129 3300005577 Bacteria 1738
173 Ga0068857_101714633 3300005577 Unclassified 614
174 Ga0068857_102336823 3300005577 Unclassified 525
175 Ga0068854_100009141 3300005578 Bacteria 6390
176 Ga0068854_100046527 3300005578 Bacteria 3089
177 Ga0068854_100132830 3300005578 Bacteria 1902
178 Ga0068854_100229931 3300005578 Bacteria 1471
179 Ga0068854_100466196 3300005578 Bacteria 1058
180 Ga0068856_100027085 3300005614 Bacteria 5591
181 Ga0068856_100202634 3300005614 Bacteria 1999
182 Ga0068856_100215090 3300005614 Bacteria 1937
183 Ga0068856_100247568 3300005614 Bacteria 1798
184 Ga0068856_100342034 3300005614 Bacteria 1514
185 Ga0068856_101159383 3300005614 Bacteria 789
186 Ga0068856_101572696 3300005614 Bacteria 671
187 Ga0068856_101600930 3300005614 Bacteria 664
188 Ga0070702_100698660 3300005615 Unclassified 773
189 Ga0068852_100039554 3300005616 Bacteria 3971
190 Ga0068852_100065578 3300005616 Bacteria 3169
191 Ga0068852_100084736 3300005616 Bacteria 2822
192 Ga0068852_100252734 3300005616 Bacteria 1689
193 Ga0068852_100421613 3300005616 Bacteria 1316
194 Ga0068852_100721824 3300005616 Bacteria 1008
195 Ga0068852_100767699 3300005616 Bacteria 977
196 Ga0068852_101238518 3300005616 Bacteria 767
197 Ga0068852_102351446 3300005616 Unclassified 554
198 Ga0068859_100304981 3300005617 Bacteria 1686
199 Ga0068864_100005796 3300005618 Bacteria 10135
200 Ga0068864_100034399 3300005618 Bacteria 4310
201 Ga0068864_100068624 3300005618 Bacteria 3080
202 Ga0068864_100307414 3300005618 Bacteria 1486
203 Ga0068866_10122939 3300005718 Bacteria 1465
204 Ga0068866_10156724 3300005718 Unclassified 1324
205 Ga0068866_10261112 3300005718 Unclassified 1064
206 Ga0068861_101216843 3300005719 Bacteria 729
207 Ga0068851_10012109 3300005834 Bacteria 4061
208 Ga0068851_10039282 3300005834 Bacteria 2377
209 Ga0068851_10099428 3300005834 Bacteria 1541
210 Ga0068851_10119871 3300005834 Bacteria 1413
211 Ga0068851_10563198 3300005834 Bacteria 690
212 Ga0068870_10795728 3300005840 Bacteria 660
213 Ga0068858_100014049 3300005842 Bacteria 7553
214 Ga0068858_101719787 3300005842 Bacteria 619
215 Ga0081539_10043389 3300005985 Bacteria 2608
216 Ga0081539_10115066 3300005985 Bacteria 1346
217 Ga0070717_10014523 3300006028 Bacteria 6061
218 Ga0070717_10549362 3300006028 Bacteria 1046
219 Ga0070717_10663535 3300006028 Bacteria 947
220 Ga0070716_100348136 3300006173 Bacteria 1048
221 Ga0070712_100575343 3300006175 Bacteria 951
222 Ga0097621_100209069 3300006237 Bacteria 1697
223 Ga0097621_101022697 3300006237 Bacteria 774
224 Ga0068871_101361237 3300006358 Bacteria 668
225 Ga0068871_101935649 3300006358 Bacteria 561
226 Ga0068865_100346100 3300006881 Bacteria 1203
227 Ga0068865_100641464 3300006881 Bacteria 902
228 Ga0068865_100942310 3300006881 Bacteria 753
229 Ga0097620_100304995 3300006931 Bacteria 1686
230 Ga0105240_10056830 3300009093 Bacteria 4894
231 Ga0105240_10314542 3300009093 Bacteria 1787
232 Ga0105240_10362388 3300009093 Bacteria 1641
233 Ga0105240_11983649 3300009093 Bacteria 605
234 Ga0105245_10153931 3300009098 Bacteria 2176
235 Ga0105245_10194626 3300009098 Bacteria 1944
236 Ga0105245_11093247 3300009098 Bacteria 843
237 Ga0105245_12743276 3300009098 Bacteria 546
238 Ga0105243_10120972 3300009148 Bacteria 2207
239 Ga0105241_10068600 3300009174 Bacteria 2748
240 Ga0105241_10886607 3300009174 Bacteria 827
241 Ga0105242_10203451 3300009176 Bacteria 1760
242 Ga0105242_10587179 3300009176 Bacteria 1074
243 Ga0105242_12524849 3300009176 Bacteria 562
244 Ga0105248_10004196 3300009177 Bacteria 15932
245 Ga0105248_10025316 3300009177 Bacteria 6597
246 Ga0105248_10057935 3300009177 Bacteria 4349
247 Ga0105248_10610777 3300009177 Bacteria 1230
248 Ga0105248_10867185 3300009177 Bacteria 1019
249 Ga0105237_10076810 3300009545 Bacteria 3330
250 Ga0105237_11482489 3300009545 Bacteria 685
251 Ga0105238_10074809 3300009551 Bacteria 3380
252 Ga0105238_10088199 3300009551 Bacteria 3089
253 Ga0105238_11998568 3300009551 Bacteria 613
254 Ga0105239_11186950 3300010375 Bacteria 879
255 Ga0105239_13613877 3300010375 Bacteria 502
256 Ga0157373_10028772 3300013100 Bacteria 4007
257 Ga0157373_10161186 3300013100 Bacteria 1578
258 Ga0157373_10171060 3300013100 Bacteria 1528
259 Ga0157373_10266617 3300013100 Bacteria 1212
260 Ga0157373_10354189 3300013100 Bacteria 1047
261 Ga0157373_10756963 3300013100 Bacteria 714
262 Ga0157371_10119969 3300013102 Bacteria 1869
263 Ga0157371_10226068 3300013102 Bacteria 1344
264 Ga0157371_10449124 3300013102 Bacteria 948
265 Ga0157371_10463235 3300013102 Bacteria 933
266 Ga0157371_11202301 3300013102 Bacteria 584
267 Ga0157371_11375241 3300013102 Unclassified 548
268 Ga0157371_11658107 3300013102 Unclassified 501
269 Ga0157370_10003954 3300013104 Bacteria 17255
270 Ga0157370_10165729 3300013104 Bacteria 2055
271 Ga0157370_10205609 3300013104 Bacteria 1826
272 Ga0157370_10239860 3300013104 Bacteria 1677
273 Ga0157370_10378464 3300013104 Bacteria 1304
274 Ga0157369_10172277 3300013105 Bacteria 2280
275 Ga0157369_10200961 3300013105 Bacteria 2092
276 Ga0157369_10341246 3300013105 Bacteria 1556
277 Ga0157369_10744505 3300013105 Bacteria 1008
278 Ga0157369_11687713 3300013105 Bacteria 644
279 Ga0157369_11843872 3300013105 Bacteria 614
280 Ga0157369_12029793 3300013105 Unclassified 583
281 Ga0157374_10029839 3300013296 Bacteria 4946
282 Ga0157374_10071225 3300013296 Bacteria 3277
283 Ga0157374_10222778 3300013296 Bacteria 1851
284 Ga0157378_10067442 3300013297 Bacteria 3206
285 Ga0157378_10101185 3300013297 Bacteria 2632
286 Ga0157378_10316468 3300013297 Bacteria 1515
287 Ga0163162_10170799 3300013306 Bacteria 2299
288 Ga0163162_10521551 3300013306 Bacteria 1318
289 Ga0163162_10664436 3300013306 Bacteria 1165
290 Ga0157372_10147231 3300013307 Bacteria 2716
291 Ga0157372_10283831 3300013307 Bacteria 1925
292 Ga0157372_10832502 3300013307 Bacteria 1071
293 Ga0157372_11233394 3300013307 Bacteria 864
294 Ga0157372_12819592 3300013307 Bacteria 557
295 Ga0157375_10168812 3300013308 Bacteria 2334
296 Ga0157375_10231528 3300013308 Bacteria 2007
297 Ga0157375_11223855 3300013308 Bacteria 881
298 Ga0157375_11589292 3300013308 Bacteria 773
299 Ga0163163_10468819 3300014325 Bacteria 1320
300 Ga0163163_10505972 3300014325 Bacteria 1270
301 Ga0157380_10741544 3300014326 Bacteria 992
302 Ga0157377_10438544 3300014745 Bacteria 899
303 Ga0157379_10416128 3300014968 Bacteria 1237
304 Ga0157379_10868176 3300014968 Bacteria 854
305 Ga0157376_11173028 3300014969 Bacteria 796
306 Ga0163161_10236357 3300017792 Unclassified 1420
307 Ga0163161_11157095 3300017792 Bacteria 667
308 Ga0206356_11735975 3300020070 Bacteria 2143
309 Ga0207697_10299691 3300025315 Bacteria 713
310 Ga0207656_10015490 3300025321 Bacteria 2951
311 Ga0207656_10062470 3300025321 Bacteria 1637
312 Ga0207656_10069986 3300025321 Bacteria 1557
313 Ga0207682_10007585 3300025893 Bacteria 4321
314 Ga0207682_10218669 3300025893 Bacteria 881
315 Ga0207642_10013418 3300025899 Bacteria 2989
316 Ga0207642_10024842 3300025899 Bacteria 2415
317 Ga0207642_10345332 3300025899 Bacteria 876
318 Ga0207688_10201456 3300025901 Bacteria 1193
319 Ga0207680_10000396 3300025903 Bacteria 20730
320 Ga0207680_10076398 3300025903 Bacteria 2092
321 Ga0207680_10124774 3300025903 Bacteria 1689
322 Ga0207680_10720606 3300025903 Bacteria 715
323 Ga0207680_10842499 3300025903 Unclassified 657
324 Ga0207647_10005921 3300025904 Bacteria 8915
325 Ga0207647_10007890 3300025904 Bacteria 7655
326 Ga0207647_10017146 3300025904 Bacteria 4930
327 Ga0207647_10051584 3300025904 Bacteria 2542
328 Ga0207647_10523872 3300025904 Bacteria 659
329 Ga0207699_10270176 3300025906 Bacteria 1178
330 Ga0207699_10407695 3300025906 Bacteria 969
331 Ga0207645_10009815 3300025907 Bacteria 6601
332 Ga0207645_10086179 3300025907 Bacteria 2018
333 Ga0207643_10155062 3300025908 Bacteria 1375
334 Ga0207643_10282344 3300025908 Bacteria 1030
335 Ga0207705_10001584 3300025909 Bacteria 18067
336 Ga0207705_10006763 3300025909 Bacteria 8476
337 Ga0207705_10016143 3300025909 Bacteria 5359
338 Ga0207705_10028498 3300025909 Bacteria 3982
339 Ga0207705_10034705 3300025909 Bacteria 3608
340 Ga0207705_10041216 3300025909 Bacteria 3312
341 Ga0207705_10116382 3300025909 Bacteria 1979
342 Ga0207705_10122704 3300025909 Bacteria 1929
343 Ga0207705_10829510 3300025909 Bacteria 717
344 Ga0207654_10225667 3300025911 Bacteria 1245
345 Ga0207707_10072278 3300025912 Bacteria 3007
346 Ga0207695_10006228 3300025913 Bacteria 15537
347 Ga0207695_11188095 3300025913 Bacteria 643
348 Ga0207671_10031488 3300025914 Bacteria 3952
349 Ga0207693_10006845 3300025915 Bacteria 9416
350 Ga0207663_10715125 3300025916 Bacteria 794
351 Ga0207660_10000415 3300025917 Bacteria 28231
352 Ga0207660_10002538 3300025917 Bacteria 11983
353 Ga0207660_10034166 3300025917 Bacteria 3522
354 Ga0207660_10406148 3300025917 Bacteria 1097
355 Ga0207662_10184166 3300025918 Bacteria 1345
356 Ga0207657_10001223 3300025919 Bacteria 27391
357 Ga0207657_10005516 3300025919 Bacteria 13209
358 Ga0207657_10009219 3300025919 Bacteria 9948
359 Ga0207657_10020708 3300025919 Bacteria 6208
360 Ga0207657_10043311 3300025919 Bacteria 3966
361 Ga0207657_10086085 3300025919 Bacteria 2631
362 Ga0207657_10267140 3300025919 Bacteria 1360
363 Ga0207657_10504155 3300025919 Bacteria 948
364 Ga0207657_11503268 3300025919 Bacteria 503
365 Ga0207649_10024819 3300025920 Bacteria 3488
366 Ga0207649_10024882 3300025920 Bacteria 3484
367 Ga0207649_10200545 3300025920 Bacteria 1409
368 Ga0207649_10419173 3300025920 Bacteria 1005
369 Ga0207649_10642527 3300025920 Bacteria 819
370 Ga0207652_10000594 3300025921 Bacteria 36239
371 Ga0207652_10429617 3300025921 Bacteria 1191
372 Ga0207652_10455156 3300025921 Unclassified 1153
373 Ga0207652_10636867 3300025921 Bacteria 954
374 Ga0207652_10961239 3300025921 Bacteria 752
375 Ga0207694_10012435 3300025924 Bacteria 6415
376 Ga0207650_10068323 3300025925 Bacteria 2668
377 Ga0207650_10289998 3300025925 Bacteria 1334
378 Ga0207650_10376015 3300025925 Bacteria 1172
379 Ga0207650_11032058 3300025925 Bacteria 700
380 Ga0207659_10178241 3300025926 Bacteria 1682
381 Ga0207687_10060861 3300025927 Bacteria 2665
382 Ga0207687_10213528 3300025927 Bacteria 1515
383 Ga0207687_10542101 3300025927 Bacteria 975
384 Ga0207700_10031292 3300025928 Bacteria 3778
385 Ga0207664_10118609 3300025929 Bacteria 2211
386 Ga0207664_10121275 3300025929 Bacteria 2188
387 Ga0207664_10180863 3300025929 Bacteria 1810
388 Ga0207664_10595303 3300025929 Bacteria 993
389 Ga0207664_10742398 3300025929 Bacteria 883
390 Ga0207664_10826296 3300025929 Bacteria 833
391 Ga0207664_11314538 3300025929 Bacteria 643
392 Ga0207644_10000090 3300025931 Bacteria 65122
393 Ga0207644_10000230 3300025931 Bacteria 38307
394 Ga0207644_10004166 3300025931 Bacteria 9377
395 Ga0207644_10005099 3300025931 Bacteria 8577
396 Ga0207644_10016545 3300025931 Bacteria 4962
397 Ga0207644_10337596 3300025931 Bacteria 1221
398 Ga0207644_11058108 3300025931 Bacteria 681
399 Ga0207690_10002599 3300025932 Bacteria 10892
400 Ga0207690_10037959 3300025932 Bacteria 3131
401 Ga0207690_10052718 3300025932 Bacteria 2726
402 Ga0207690_10183007 3300025932 Bacteria 1579
403 Ga0207690_10195945 3300025932 Bacteria 1531
404 Ga0207690_10210482 3300025932 Bacteria 1482
405 Ga0207690_10243916 3300025932 Bacteria 1385
406 Ga0207690_10913972 3300025932 Bacteria 728
407 Ga0207706_10010174 3300025933 Bacteria 8610
408 Ga0207706_10033854 3300025933 Bacteria 4548
409 Ga0207706_10069644 3300025933 Bacteria 3094
410 Ga0207706_10103115 3300025933 Bacteria 2509
411 Ga0207706_10213120 3300025933 Bacteria 1692
412 Ga0207706_10261551 3300025933 Bacteria 1511
413 Ga0207706_10354274 3300025933 Bacteria 1276
414 Ga0207706_10801993 3300025933 Bacteria 800
415 Ga0207706_10835687 3300025933 Bacteria 781
416 Ga0207706_11268068 3300025933 Bacteria 610
417 Ga0207686_10088929 3300025934 Bacteria 2034
418 Ga0207670_10096980 3300025936 Bacteria 2098
419 Ga0207669_10002423 3300025937 Bacteria 7953
420 Ga0207669_10035330 3300025937 Bacteria 2842
421 Ga0207669_10064898 3300025937 Bacteria 2262
422 Ga0207669_10108936 3300025937 Bacteria 1851
423 Ga0207669_10912782 3300025937 Bacteria 734
424 Ga0207704_10365310 3300025938 Bacteria 1128
425 Ga0207704_10469483 3300025938 Bacteria 1008
426 Ga0207704_10977279 3300025938 Bacteria 715
427 Ga0207665_10028816 3300025939 Bacteria 3670
428 Ga0207691_10047494 3300025940 Bacteria 3939
429 Ga0207691_10081268 3300025940 Bacteria 2913
430 Ga0207691_10200948 3300025940 Bacteria 1735
431 Ga0207691_10209054 3300025940 Bacteria 1696
432 Ga0207691_11406104 3300025940 Bacteria 573
433 Ga0207691_11542480 3300025940 Bacteria 542
434 Ga0207711_10000107 3300025941 Bacteria 87146
435 Ga0207711_10004825 3300025941 Bacteria 11457
436 Ga0207711_10115089 3300025941 Bacteria 2396
437 Ga0207711_10292858 3300025941 Bacteria 1500
438 Ga0207689_10020074 3300025942 Bacteria 5626
439 Ga0207661_10008542 3300025944 Bacteria 7320
440 Ga0207661_10016243 3300025944 Bacteria 5491
441 Ga0207661_10074687 3300025944 Bacteria 2779
442 Ga0207661_10112094 3300025944 Bacteria 2308
443 Ga0207661_11076182 3300025944 Bacteria 740
444 Ga0207661_11756090 3300025944 Bacteria 566
445 Ga0207661_11772983 3300025944 Bacteria 563
446 Ga0207679_10001267 3300025945 Bacteria 16008
447 Ga0207679_10004631 3300025945 Bacteria 8561
448 Ga0207679_10009788 3300025945 Bacteria 6150
449 Ga0207679_10042536 3300025945 Bacteria 3266
450 Ga0207679_10202891 3300025945 Bacteria 1658
451 Ga0207679_10456282 3300025945 Bacteria 1134
452 Ga0207679_10624513 3300025945 Bacteria 973
453 Ga0207667_10014131 3300025949 Bacteria 9112
454 Ga0207667_10028554 3300025949 Bacteria 6058
455 Ga0207667_10044068 3300025949 Bacteria 4730
456 Ga0207667_10488424 3300025949 Bacteria 1250
457 Ga0207667_10642390 3300025949 Bacteria 1067
458 Ga0207667_10710196 3300025949 Bacteria 1007
459 Ga0207651_10053879 3300025960 Bacteria 2752
460 Ga0207651_10127846 3300025960 Bacteria 1939
461 Ga0207651_10318950 3300025960 Bacteria 1298
462 Ga0207651_10912251 3300025960 Bacteria 783
463 Ga0207651_11578365 3300025960 Archaea 591
464 Ga0207640_10054875 3300025981 Bacteria 2607
465 Ga0207640_11192974 3300025981 Bacteria 676
466 Ga0207640_12100720 3300025981 Unclassified 512
467 Ga0207658_10007344 3300025986 Bacteria 7511
468 Ga0207658_10123415 3300025986 Bacteria 2069
469 Ga0207677_10001518 3300026023 Bacteria 12268
470 Ga0207677_10168138 3300026023 Bacteria 1711
471 Ga0207677_10289052 3300026023 Bacteria 1349
472 Ga0207703_10000959 3300026035 Bacteria 27891
473 Ga0207639_10023622 3300026041 Bacteria 4440
474 Ga0207639_10255497 3300026041 Bacteria 1530
475 Ga0207639_10607006 3300026041 Bacteria 1009
476 Ga0207639_11906691 3300026041 Bacteria 555
477 Ga0207678_10010694 3300026067 Bacteria 8061
478 Ga0207678_10014186 3300026067 Bacteria 7006
479 Ga0207678_10027252 3300026067 Bacteria 4983
480 Ga0207678_10081820 3300026067 Bacteria 2764
481 Ga0207678_10090604 3300026067 Bacteria 2613
482 Ga0207678_10164551 3300026067 Bacteria 1894
483 Ga0207678_10212777 3300026067 Bacteria 1654
484 Ga0207678_11212470 3300026067 Bacteria 668
485 Ga0207702_10022001 3300026078 Bacteria 5281
486 Ga0207702_10116514 3300026078 Bacteria 2384
487 Ga0207702_10140561 3300026078 Bacteria 2184
488 Ga0207702_10209807 3300026078 Bacteria 1810
489 Ga0207702_10268977 3300026078 Bacteria 1607
490 Ga0207702_11563369 3300026078 Bacteria 653
491 Ga0207641_11184637 3300026088 Bacteria 763
492 Ga0207648_10005141 3300026089 Bacteria 13247
493 Ga0207648_10392144 3300026089 Bacteria 1257
494 Ga0207676_10015903 3300026095 Bacteria 5442
495 Ga0207676_10067681 3300026095 Bacteria 2853
496 Ga0207676_10433060 3300026095 Bacteria 1236
497 Ga0207676_10895438 3300026095 Bacteria 870
498 Ga0207676_11419780 3300026095 Bacteria 690
499 Ga0207674_10009520 3300026116 Bacteria 11089
500 Ga0207674_10026104 3300026116 Bacteria 6214
501 Ga0207674_10069624 3300026116 Bacteria 3538
502 Ga0207674_10230011 3300026116 Bacteria 1802
503 Ga0207674_10857504 3300026116 Bacteria 876
504 Ga0207674_11753794 3300026116 Unclassified 588
505 Ga0207683_10049854 3300026121 Bacteria 3666
506 Ga0207683_10087696 3300026121 Bacteria 2768
507 Ga0207683_10106999 3300026121 Bacteria 2502
508 Ga0207683_10120187 3300026121 Bacteria 2358
509 Ga0207683_10350789 3300026121 Bacteria 1354
510 Ga0207698_10002465 3300026142 Bacteria 10976
511 Ga0207698_10021471 3300026142 Bacteria 4466
512 Ga0207698_10085709 3300026142 Bacteria 2559
513 Ga0207698_10260349 3300026142 Bacteria 1593
514 Ga0207698_10369892 3300026142 Bacteria 1360
515 Ga0207698_10513175 3300026142 Bacteria 1168
516 Ga0207698_10824651 3300026142 Bacteria 931
517 Ga0207698_11012991 3300026142 Bacteria 842
518 Ga0207698_11475939 3300026142 Bacteria 695
519 Ga0207698_11757181 3300026142 Bacteria 635
520 Ga0207698_12446146 3300026142 Bacteria 533
521 Ga0268266_10105921 3300028379 Bacteria 2485
522 Ga0268266_10998866 3300028379 Unclassified 810
523 Ga0307408_100651202 3300031548 Bacteria 942
524 Ga0307408_101115742 3300031548 Bacteria 732
525 Ga0307405_10135616 3300031731 Bacteria 1708
526 Ga0307413_10082565 3300031824 Bacteria 2065
527 Ga0307410_10027366 3300031852 Bacteria 3604
528 Ga0307406_10321596 3300031901 Bacteria 1197
529 Ga0307406_11685656 3300031901 Bacteria 561
530 Ga0307407_11714381 3300031903 Unclassified 500
531 Ga0307412_10104393 3300031911 Bacteria 2011
532 Ga0307412_10132398 3300031911 Bacteria 1813
533 Ga0307409_100304971 3300031995 Unclassified 1483
534 Ga0307416_100040405 3300032002 Bacteria 3623
535 Ga0307411_10055210 3300032005 Bacteria 2612
536 Ga0307415_100030887 3300032126 Bacteria 3445
537 Ga0307415_100278335 3300032126 Unclassified 1374
538 Ga0307415_100362810 3300032126 Bacteria 1224
539 Ga0373955_0600311 3300035172 Bacteria 674
540 Ga0373931_0620036 3300035691 Bacteria 709
541 Ga0373935_0002697 3300035692 Bacteria 10211
542 Ga0373937_0954977 3300036401 Bacteria 806
543 Ga0395899_0000104 3300037312 Bacteria 147238
544 Ga0395899_0000981 3300037312 Bacteria 26323
545 Ga0395899_0007054 3300037312 Bacteria 8694
546 Ga0395899_0011333 3300037312 Bacteria 6829
547 Ga0395899_0011406 3300037312 Bacteria 6804
548 Ga0395899_0054753 3300037312 Bacteria 2951
549 Ga0395899_0099079 3300037312 Bacteria 2106
550 Ga0395899_0123294 3300037312 Bacteria 1854
551 Ga0395899_0277356 3300037312 Bacteria 1141
552 Ga0395899_0801021 3300037312 Unclassified 582
553 Ga0395900_0000739 3300037418 Bacteria 43430
554 Ga0395900_0003622 3300037418 Bacteria 16610
555 Ga0395900_0014323 3300037418 Bacteria 8096
556 Ga0395900_0020065 3300037418 Bacteria 6816
557 Ga0395900_0038071 3300037418 Bacteria 4958
558 Ga0395900_0045755 3300037418 Bacteria 4507
559 Ga0395900_0050871 3300037418 Bacteria 4267
560 Ga0395900_0097521 3300037418 Bacteria 3020
561 Ga0395900_0124850 3300037418 Bacteria 2639
562 Ga0395900_0136347 3300037418 Bacteria 2514
563 Ga0395900_0151488 3300037418 Bacteria 2369
564 Ga0395900_0178067 3300037418 Bacteria 2162
565 Ga0395900_0181819 3300037418 Bacteria 2136
566 Ga0395900_0354091 3300037418 Bacteria 1441
567 Ga0395900_0487744 3300037418 Bacteria 1184
568 Ga0395900_0580396 3300037418 Bacteria 1063
569 Ga0395900_0630589 3300037418 Bacteria 1010
570 Ga0395900_0718342 3300037418 Bacteria 931
571 Ga0395900_1527282 3300037418 Bacteria 580
572 Ga0395898_0000169 3300037466 Bacteria 168667
573 Ga0395898_0004083 3300037466 Bacteria 16011
574 Ga0395898_0006331 3300037466 Bacteria 12650
575 Ga0395898_0013658 3300037466 Bacteria 8355
576 Ga0395898_0022731 3300037466 Bacteria 6347
577 Ga0395898_0043084 3300037466 Bacteria 4448
578 Ga0395898_0090569 3300037466 Bacteria 2943
579 Ga0395898_0099374 3300037466 Bacteria 2794
580 Ga0395898_0152298 3300037466 Bacteria 2212
581 Ga0395898_0268600 3300037466 Bacteria 1627
582 Ga0395898_0546232 3300037466 Bacteria 1100
583 Ga0395898_0974169 3300037466 Bacteria 784
584 Ga0395898_1110806 3300037466 Bacteria 724
585 Ga0395905_0000109 3300037471 Bacteria 137754
586 Ga0395905_0003687 3300037471 Bacteria 16217
587 Ga0395905_0007538 3300037471 Bacteria 10820
588 Ga0395905_0017575 3300037471 Bacteria 6786
589 Ga0395905_0024667 3300037471 Bacteria 5674
590 Ga0395905_0025023 3300037471 Bacteria 5630
591 Ga0395905_0026524 3300037471 Bacteria 5462
592 Ga0395905_0071421 3300037471 Bacteria 3254
593 Ga0395905_0075662 3300037471 Bacteria 3155
594 Ga0395905_0114980 3300037471 Bacteria 2528
595 Ga0395905_0133101 3300037471 Bacteria 2338
596 Ga0395905_0347315 3300037471 Bacteria 1375
597 Ga0395905_0347823 3300037471 Bacteria 1374
598 Ga0395905_0408781 3300037471 Bacteria 1252
599 Ga0395905_0455888 3300037471 Bacteria 1177
600 Ga0395905_0605504 3300037471 Bacteria 997
601 Ga0395905_0716981 3300037471 Bacteria 902
602 Ga0395905_0911503 3300037471 Bacteria 782
603 Ga0395905_1011576 3300037471 Unclassified 734
604 Ga0395901_0011647 3300038443 Bacteria 8907
605 Ga0395901_0013974 3300038443 Bacteria 8170
606 Ga0395901_0018414 3300038443 Bacteria 7128
607 Ga0395901_0030129 3300038443 Bacteria 5589
608 Ga0395901_0032051 3300038443 Bacteria 5422
609 Ga0395901_0101765 3300038443 Bacteria 3015
610 Ga0395901_0138830 3300038443 Bacteria 2554
611 Ga0395901_0259839 3300038443 Bacteria 1808
612 Ga0395901_0269316 3300038443 Bacteria 1772
613 Ga0395901_0290031 3300038443 Bacteria 1698
614 Ga0395901_0605504 3300038443 Bacteria 1104
615 Ga0395901_0644397 3300038443 Bacteria 1063
616 Ga0395901_1187192 3300038443 Bacteria 729
617 Ga0395901_1212779 3300038443 Bacteria 720
618 Ga0395901_1345651 3300038443 Bacteria 674
619 Ga0395901_1414616 3300038443 Unclassified 653
620 Ga0451853_3429965 3300041512 Bacteria 742
621 Ga0439448_0001631 3300042005 Bacteria 5878
622 Ga0439432_007807 3300042006 Bacteria 3773
623 Ga0439455_0128539 3300042012 Bacteria 713
624 Ga0439458_0000629 3300042157 Bacteria 9140
625 Ga0439458_0002133 3300042157 Bacteria 4891
626 Ga0466969_0010066 3300044656 Bacteria 5015
627 Ga0466969_0153857 3300044656 Bacteria 1059
628 Ga0466969_0446828 3300044656 Bacteria 588
629 Ga0466972_0072014 3300044658 Bacteria 1648
630 Ga0466965_0060010 3300044683 Bacteria 1899
631 Ga0466965_0429346 3300044683 Bacteria 733
632 Ga0466965_0455059 3300044683 Bacteria 713
633 Ga0466966_0017028 3300044684 Bacteria 4805
634 Ga0466966_0069026 3300044684 Bacteria 2217
635 Ga0466966_0158899 3300044684 Bacteria 1376
636 Ga0466966_0192804 3300044684 Bacteria 1234
637 Ga0466966_0230275 3300044684 Bacteria 1118
638 Ga0466966_0442877 3300044684 Unclassified 781
639 Ga0466961_0009596 3300044693 Bacteria 6160
640 Ga0466961_0123137 3300044693 Bacteria 1627
641 Ga0466961_0194838 3300044693 Bacteria 1255
642 Ga0466961_0390858 3300044693 Bacteria 844
643 Ga0466963_0004423 3300044694 Bacteria 8165
644 Ga0466963_0038934 3300044694 Bacteria 3111
645 Ga0466963_0128562 3300044694 Bacteria 1748
646 Ga0466963_0748412 3300044694 Bacteria 689
647 Ga0466964_0006864 3300044706 Bacteria 4250
648 Ga0466964_0462995 3300044706 Bacteria 674
649 Ga0466971_0002898 3300044719 Bacteria 7274
650 Ga0466971_0003496 3300044719 Bacteria 6710
651 Ga0466971_0240046 3300044719 Unclassified 862
652 Ga0466968_0384110 3300044735 Bacteria 686
653 Ga0466970_0001478 3300044765 Bacteria 11349
654 Ga0466970_0011962 3300044765 Bacteria 4430
655 Ga0466970_0195232 3300044765 Bacteria 1125
656 Ga0466970_0268672 3300044765 Unclassified 958
657 Ga0466957_0014335 3300044842 Bacteria 4614
658 Ga0466957_0020834 3300044842 Bacteria 3857
659 Ga0466957_0116063 3300044842 Bacteria 1703
660 Ga0466957_0552161 3300044842 Bacteria 803
661 Ga0466957_0555069 3300044842 Bacteria 801
662 Ga0466960_0200995 3300044901 Bacteria 1089
663 Ga0466959_0067975 3300045049 Bacteria 2582
664 Ga0466959_0082883 3300045049 Bacteria 2310
665 Ga0466959_0147661 3300045049 Bacteria 1658
666 Ga0466959_0183126 3300045049 Bacteria 1464
667 Ga0466958_0003025 3300045836 Bacteria 8610
668 Ga0466958_0030874 3300045836 Bacteria 3185
669 Ga0466958_0109270 3300045836 Bacteria 1726
670 Ga0466958_0122916 3300045836 Bacteria 1626
671 Ga0466958_0168456 3300045836 Bacteria 1386
672 Ga0466958_0215026 3300045836 Bacteria 1226
673 Ga0466958_0238024 3300045836 Bacteria 1163
674 Ga0466958_1039409 3300045836 Bacteria 535
675 Ga0466967_0024155 3300045976 Bacteria 4993
676 Ga0466967_0403425 3300045976 Bacteria 1330
677 Ga0495585_0248163 3300046492 Bacteria 889
678 Ga0495642_0019884 3300046528 Bacteria 2633
679 Ga0495598_0001392 3300046537 Bacteria 4770
680 Ga0495621_0011897 3300046539 Bacteria 2704
681 Ga0495621_0025556 3300046539 Bacteria 1985
682 Ga0495656_0108285 3300046615 Bacteria 1295
683 Ga0495669_0173757 3300046684 Bacteria 1025
684 Ga0495670_0006982 3300046691 Bacteria 5564
685 Ga0495670_0256238 3300046691 Bacteria 933
686 Ga0496101_1045707 3300048904 Unclassified 642
687 Ga0496102_0198569 3300048905 Bacteria 1890
688 Ga0496102_1045472 3300048905 Bacteria 737
689 Ga0496103_0077935 3300048906 Bacteria 2081
690 Ga0496106_0023848 3300048909 Bacteria 4548
691 Ga0496107_0438841 3300048910 Bacteria 970
692 Ga0496108_0394052 3300048911 Bacteria 1209
693 Ga0496108_0400739 3300048911 Bacteria 1198
694 Ga0496109_0024200 3300048912 Bacteria 5396
695 Ga0496109_0403370 3300048912 Bacteria 1292
696 Ga0496109_0516503 3300048912 Bacteria 1127
697 Ga0496109_1306695 3300048912 Bacteria 661
698 Ga0496110_0420621 3300048913 Bacteria 1218
699 Ga0496111_0017697 3300048914 Bacteria 4928
700 Ga0496111_0787886 3300048914 Bacteria 688
701 Ga0496112_0040863 3300048915 Bacteria 4535
702 Ga0496112_0043307 3300048915 Bacteria 4407
703 Ga0496112_0043809 3300048915 Bacteria 4382
704 Ga0496112_0073581 3300048915 Bacteria 3378
705 Ga0496112_0105572 3300048915 Bacteria 2787
706 Ga0496112_0389336 3300048915 Bacteria 1334
707 Ga0496112_0485761 3300048915 Bacteria 1171
708 Ga0496113_0055110 3300048916 Bacteria 2979
709 Ga0496113_0085546 3300048916 Bacteria 2422
710 Ga0496113_0469972 3300048916 Bacteria 1010
711 Ga0496114_0000006 3300048917 Bacteria 472921
712 Ga0501067_0521121 3300049583 Bacteria 665
713 Ga0501270_016762 3300049767 Bacteria 1064
714 Ga0587083_0281863 3300059505 Unclassified 506
715 Ga0466962_0000637 3300061719 Bacteria 15609
716 Ga0466962_0044171 3300061719 Bacteria 2131
717 Ga0466962_0057550 3300061719 Bacteria 1856
718 Ga0466962_0236231 3300061719 Bacteria 897
719 Ga0466962_0236969 3300061719 Unclassified 895
720 JGI24736J21556_1014536
721 JGI24741J21665_1009493
722 JGI24740J21852_10001913
723 JGI24740J21852_10005256
724 JGI24740J21852_10011356
725 JGI24740J21852_10013067
726 JGI24740J21852_10101819
727 JGI24739J22299_10043840
728 JGI24737J22298_10070957
729 JGI24737J22298_10130093
730 JGI24735J21928_10006011
731 JGI24735J21928_10057254
732 JGI24738J21930_10034179
733 JGI24744J21845_10004290
734 JGI24034J26672_10043958
735 JGI24742J22300_10042834
736 JGI25406J46586_10177532
737 Ga0065715_10547121
738 Ga0070658_10012565
739 Ga0070658_10027327
740 Ga0070658_10533074
741 Ga0070658_10666529
742 Ga0070658_10984279
743 Ga0070676_10047109
744 Ga0070676_10074140
745 Ga0070676_10691564
746 Ga0070676_11516017
747 Ga0070683_100025828
748 Ga0070683_100355285
749 Ga0070683_100397204
750 Ga0070683_100405948
751 Ga0070690_100016347
752 Ga0070690_101223611
753 Ga0070670_100001616
754 Ga0070670_100048422
755 Ga0070670_100100760
756 Ga0070670_100158725
757 Ga0070670_100587361
758 Ga0070677_10019968
759 Ga0070677_10069829
760 Ga0068869_100027716
761 Ga0070666_10000421
762 Ga0070666_10059025
763 Ga0070666_10065648
764 Ga0070666_10159137
765 Ga0070680_100000483
766 Ga0070680_100008726
767 Ga0070680_100024830
768 Ga0070680_100085354
769 Ga0070682_101131517
770 Ga0068868_100000688
771 Ga0068868_100085455
772 Ga0068868_100298984
773 Ga0068868_100589704
774 Ga0070660_100000490
775 Ga0070660_100011472
776 Ga0070660_100113832
777 Ga0070660_100135841
778 Ga0070660_100920627
779 Ga0070689_100494618
780 Ga0070691_10003873
781 Ga0070687_100126848
782 Ga0070687_100320089
783 Ga0070661_100051420
784 Ga0070661_100119835
785 Ga0070661_100355057
786 Ga0070661_100636876
787 Ga0070661_100983132
788 Ga0070661_101105585
789 Ga0070692_10124324
790 Ga0070692_10404086
791 Ga0070675_100065802
792 Ga0070675_100145668
793 Ga0070671_100001670
794 Ga0070671_100002301
795 Ga0070671_100023437
796 Ga0070671_100041234
797 Ga0070671_101006050
798 Ga0070671_101758807
799 Ga0070674_100007052
800 Ga0070674_100030741
801 Ga0070674_100276306
802 Ga0070674_100426654
803 Ga0070673_100038330
804 Ga0070673_100040825
805 Ga0070673_100074185
806 Ga0070673_100181368
807 Ga0070673_100269175
808 Ga0070673_102134699
809 Ga0070688_100428402
810 Ga0070659_100003051
811 Ga0070659_100044776
812 Ga0070659_100144557
813 Ga0070667_100001036
814 Ga0070667_100419179
815 Ga0070667_100991865
816 Ga0070709_10039890
817 Ga0070709_10409660
818 Ga0070714_100040798
819 Ga0070714_100062130
820 Ga0070714_100207364
821 Ga0070714_100620397
822 Ga0070714_100744660
823 Ga0070714_101168662
824 Ga0070714_101266797
825 Ga0070713_100042358
826 Ga0070713_100097670
827 Ga0070713_100496672
828 Ga0070713_101111102
829 Ga0070711_100781046
830 Ga0070663_100001084
831 Ga0070663_100060432
832 Ga0070663_100067138
833 Ga0070663_100217762
834 Ga0070663_100251220
835 Ga0070663_100748065
836 Ga0070678_100031099
837 Ga0070678_100083261
838 Ga0070678_100358946
839 Ga0070678_100873525
840 Ga0070678_101678017
841 Ga0070662_100006947
842 Ga0070662_100067705
843 Ga0070662_100182175
844 Ga0070662_100209781
845 Ga0070662_100349090
846 Ga0070681_10148161
847 Ga0070681_10149403
848 Ga0070681_11050488
849 Ga0068867_100020204
850 Ga0068867_100334459
851 Ga0068867_100504347
852 Ga0070685_10555903
853 Ga0070679_100008094
854 Ga0070679_100217530
855 Ga0070679_100401303
856 Ga0070679_100560021
857 Ga0070679_100794553
858 Ga0070684_100020494
859 Ga0070684_100138598
860 Ga0070684_100430390
861 Ga0068853_100131011
862 Ga0068853_100136614
863 Ga0068853_100416212
864 Ga0068853_101096681
865 Ga0070672_100127635
866 Ga0070672_100178257
867 Ga0070672_100241441
868 Ga0070672_101031769
869 Ga0070672_101594339
870 Ga0070686_100098327
871 Ga0070686_101255627
872 Ga0070693_101342863
873 Ga0070665_100062134
874 Ga0070665_100678004
875 Ga0068855_100023981
876 Ga0068855_100461235
877 Ga0068855_100475529
878 Ga0068855_100543428
879 Ga0068855_100661806
880 Ga0068855_100699898
881 Ga0068855_101258036
882 Ga0068855_101987318
883 Ga0070664_100000675
884 Ga0070664_100019938
885 Ga0070664_100021493
886 Ga0070664_100114553
887 Ga0070664_100412484
888 Ga0070664_100478735
889 Ga0070664_100965038
890 Ga0068857_100029992
891 Ga0068857_100219129
892 Ga0068857_101714633
893 Ga0068857_102336823
894 Ga0068854_100009141
895 Ga0068854_100046527
896 Ga0068854_100132830
897 Ga0068854_100229931
898 Ga0068854_100466196
899 Ga0068856_100027085
900 Ga0068856_100202634
901 Ga0068856_100215090
902 Ga0068856_100247568
903 Ga0068856_100342034
904 Ga0068856_101159383
905 Ga0068856_101572696
906 Ga0068856_101600930
907 Ga0070702_100698660
908 Ga0068852_100039554
909 Ga0068852_100065578
910 Ga0068852_100084736
911 Ga0068852_100252734
912 Ga0068852_100421613
913 Ga0068852_100721824
914 Ga0068852_100767699
915 Ga0068852_101238518
916 Ga0068852_102351446
917 Ga0068859_100304981
918 Ga0068864_100005796
919 Ga0068864_100034399
920 Ga0068864_100068624
921 Ga0068864_100307414
922 Ga0068866_10122939
923 Ga0068866_10156724
924 Ga0068866_10261112
925 Ga0068861_101216843
926 Ga0068851_10012109
927 Ga0068851_10039282
928 Ga0068851_10099428
929 Ga0068851_10119871
930 Ga0068851_10563198
931 Ga0068870_10795728
932 Ga0068858_100014049
933 Ga0068858_101719787
934 Ga0081539_10043389
935 Ga0081539_10115066
936 Ga0070717_10014523
937 Ga0070717_10549362
938 Ga0070717_10663535
939 Ga0070716_100348136
940 Ga0070712_100575343
941 Ga0097621_100209069
942 Ga0097621_101022697
943 Ga0068871_101361237
944 Ga0068871_101935649
945 Ga0068865_100346100
946 Ga0068865_100641464
947 Ga0068865_100942310
948 Ga0097620_100304995
949 Ga0105240_10056830
950 Ga0105240_10314542
951 Ga0105240_10362388
952 Ga0105240_11983649
953 Ga0105245_10153931
954 Ga0105245_10194626
955 Ga0105245_11093247
956 Ga0105245_12743276
957 Ga0105243_10120972
958 Ga0105241_10068600
959 Ga0105241_10886607
960 Ga0105242_10203451
961 Ga0105242_10587179
962 Ga0105242_12524849
963 Ga0105248_10004196
964 Ga0105248_10025316
965 Ga0105248_10057935
966 Ga0105248_10610777
967 Ga0105248_10867185
968 Ga0105237_10076810
969 Ga0105237_11482489
970 Ga0105238_10074809
971 Ga0105238_10088199
972 Ga0105238_11998568
973 Ga0105239_11186950
974 Ga0105239_13613877
975 Ga0157373_10028772
976 Ga0157373_10161186
977 Ga0157373_10171060
978 Ga0157373_10266617
979 Ga0157373_10354189
980 Ga0157373_10756963
981 Ga0157371_10119969
982 Ga0157371_10226068
983 Ga0157371_10449124
984 Ga0157371_10463235
985 Ga0157371_11202301
986 Ga0157371_11375241
987 Ga0157371_11658107
988 Ga0157370_10003954
989 Ga0157370_10165729
990 Ga0157370_10205609
991 Ga0157370_10239860
992 Ga0157370_10378464
993 Ga0157369_10172277
994 Ga0157369_10200961
995 Ga0157369_10341246
996 Ga0157369_10744505
997 Ga0157369_11687713
998 Ga0157369_11843872
999 Ga0157369_12029793
1000 Ga0157374_10029839
1001 Ga0157374_10071225
1002 Ga0157374_10222778
1003 Ga0157378_10067442
1004 Ga0157378_10101185
1005 Ga0157378_10316468
1006 Ga0163162_10170799
1007 Ga0163162_10521551
1008 Ga0163162_10664436
1009 Ga0157372_10147231
1010 Ga0157372_10283831
1011 Ga0157372_10832502
1012 Ga0157372_11233394
1013 Ga0157372_12819592
1014 Ga0157375_10168812
1015 Ga0157375_10231528
1016 Ga0157375_11223855
1017 Ga0157375_11589292
1018 Ga0163163_10468819
1019 Ga0163163_10505972
1020 Ga0157380_10741544
1021 Ga0157377_10438544
1022 Ga0157379_10416128
1023 Ga0157379_10868176
1024 Ga0157376_11173028
1025 Ga0163161_10236357
1026 Ga0163161_11157095
1027 Ga0206356_11735975
1028 Ga0207697_10299691
1029 Ga0207656_10015490
1030 Ga0207656_10062470
1031 Ga0207656_10069986
1032 Ga0207682_10007585
1033 Ga0207682_10218669
1034 Ga0207642_10013418
1035 Ga0207642_10024842
1036 Ga0207642_10345332
1037 Ga0207688_10201456
1038 Ga0207680_10000396
1039 Ga0207680_10076398
1040 Ga0207680_10124774
1041 Ga0207680_10720606
1042 Ga0207680_10842499
1043 Ga0207647_10005921
1044 Ga0207647_10007890
1045 Ga0207647_10017146
1046 Ga0207647_10051584
1047 Ga0207647_10523872
1048 Ga0207699_10270176
1049 Ga0207699_10407695
1050 Ga0207645_10009815
1051 Ga0207645_10086179
1052 Ga0207643_10155062
1053 Ga0207643_10282344
1054 Ga0207705_10001584
1055 Ga0207705_10006763
1056 Ga0207705_10016143
1057 Ga0207705_10028498
1058 Ga0207705_10034705
1059 Ga0207705_10041216
1060 Ga0207705_10116382
1061 Ga0207705_10122704
1062 Ga0207705_10829510
1063 Ga0207654_10225667
1064 Ga0207707_10072278
1065 Ga0207695_10006228
1066 Ga0207695_11188095
1067 Ga0207671_10031488
1068 Ga0207693_10006845
1069 Ga0207663_10715125
1070 Ga0207660_10000415
1071 Ga0207660_10002538
1072 Ga0207660_10034166
1073 Ga0207660_10406148
1074 Ga0207662_10184166
1075 Ga0207657_10001223
1076 Ga0207657_10005516
1077 Ga0207657_10009219
1078 Ga0207657_10020708
1079 Ga0207657_10043311
1080 Ga0207657_10086085
1081 Ga0207657_10267140
1082 Ga0207657_10504155
1083 Ga0207657_11503268
1084 Ga0207649_10024819
1085 Ga0207649_10024882
1086 Ga0207649_10200545
1087 Ga0207649_10419173
1088 Ga0207649_10642527
1089 Ga0207652_10000594
1090 Ga0207652_10429617
1091 Ga0207652_10455156
1092 Ga0207652_10636867
1093 Ga0207652_10961239
1094 Ga0207694_10012435
1095 Ga0207650_10068323
1096 Ga0207650_10289998
1097 Ga0207650_10376015
1098 Ga0207650_11032058
1099 Ga0207659_10178241
1100 Ga0207687_10060861
1101 Ga0207687_10213528
1102 Ga0207687_10542101
1103 Ga0207700_10031292
1104 Ga0207664_10118609
1105 Ga0207664_10121275
1106 Ga0207664_10180863
1107 Ga0207664_10595303
1108 Ga0207664_10742398
1109 Ga0207664_10826296
1110 Ga0207664_11314538
1111 Ga0207644_10000090
1112 Ga0207644_10000230
1113 Ga0207644_10004166
1114 Ga0207644_10005099
1115 Ga0207644_10016545
1116 Ga0207644_10337596
1117 Ga0207644_11058108
1118 Ga0207690_10002599
1119 Ga0207690_10037959
1120 Ga0207690_10052718
1121 Ga0207690_10183007
1122 Ga0207690_10195945
1123 Ga0207690_10210482
1124 Ga0207690_10243916
1125 Ga0207690_10913972
1126 Ga0207706_10010174
1127 Ga0207706_10033854
1128 Ga0207706_10069644
1129 Ga0207706_10103115
1130 Ga0207706_10213120
1131 Ga0207706_10261551
1132 Ga0207706_10354274
1133 Ga0207706_10801993
1134 Ga0207706_10835687
1135 Ga0207706_11268068
1136 Ga0207686_10088929
1137 Ga0207670_10096980
1138 Ga0207669_10002423
1139 Ga0207669_10035330
1140 Ga0207669_10064898
1141 Ga0207669_10108936
1142 Ga0207669_10912782
1143 Ga0207704_10365310
1144 Ga0207704_10469483
1145 Ga0207704_10977279
1146 Ga0207665_10028816
1147 Ga0207691_10047494
1148 Ga0207691_10081268
1149 Ga0207691_10200948
1150 Ga0207691_10209054
1151 Ga0207691_11406104
1152 Ga0207691_11542480
1153 Ga0207711_10000107
1154 Ga0207711_10004825
1155 Ga0207711_10115089
1156 Ga0207711_10292858
1157 Ga0207689_10020074
1158 Ga0207661_10008542
1159 Ga0207661_10016243
1160 Ga0207661_10074687
1161 Ga0207661_10112094
1162 Ga0207661_11076182
1163 Ga0207661_11756090
1164 Ga0207661_11772983
1165 Ga0207679_10001267
1166 Ga0207679_10004631
1167 Ga0207679_10009788
1168 Ga0207679_10042536
1169 Ga0207679_10202891
1170 Ga0207679_10456282
1171 Ga0207679_10624513
1172 Ga0207667_10014131
1173 Ga0207667_10028554
1174 Ga0207667_10044068
1175 Ga0207667_10488424
1176 Ga0207667_10642390
1177 Ga0207667_10710196
1178 Ga0207651_10053879
1179 Ga0207651_10127846
1180 Ga0207651_10318950
1181 Ga0207651_10912251
1182 Ga0207651_11578365
1183 Ga0207640_10054875
1184 Ga0207640_11192974
1185 Ga0207640_12100720
1186 Ga0207658_10007344
1187 Ga0207658_10123415
1188 Ga0207677_10001518
1189 Ga0207677_10168138
1190 Ga0207677_10289052
1191 Ga0207703_10000959
1192 Ga0207639_10023622
1193 Ga0207639_10255497
1194 Ga0207639_10607006
1195 Ga0207639_11906691
1196 Ga0207678_10010694
1197 Ga0207678_10014186
1198 Ga0207678_10027252
1199 Ga0207678_10081820
1200 Ga0207678_10090604
1201 Ga0207678_10164551
1202 Ga0207678_10212777
1203 Ga0207678_11212470
1204 Ga0207702_10022001
1205 Ga0207702_10116514
1206 Ga0207702_10140561
1207 Ga0207702_10209807
1208 Ga0207702_10268977
1209 Ga0207702_11563369
1210 Ga0207641_11184637
1211 Ga0207648_10005141
1212 Ga0207648_10392144
1213 Ga0207676_10015903
1214 Ga0207676_10067681
1215 Ga0207676_10433060
1216 Ga0207676_10895438
1217 Ga0207676_11419780
1218 Ga0207674_10009520
1219 Ga0207674_10026104
1220 Ga0207674_10069624
1221 Ga0207674_10230011
1222 Ga0207674_10857504
1223 Ga0207674_11753794
1224 Ga0207683_10049854
1225 Ga0207683_10087696
1226 Ga0207683_10106999
1227 Ga0207683_10120187
1228 Ga0207683_10350789
1229 Ga0207698_10002465
1230 Ga0207698_10021471
1231 Ga0207698_10085709
1232 Ga0207698_10260349
1233 Ga0207698_10369892
1234 Ga0207698_10513175
1235 Ga0207698_10824651
1236 Ga0207698_11012991
1237 Ga0207698_11475939
1238 Ga0207698_11757181
1239 Ga0207698_12446146
1240 Ga0268266_10105921
1241 Ga0268266_10998866
1242 Ga0307408_100651202
1243 Ga0307408_101115742
1244 Ga0307405_10135616
1245 Ga0307413_10082565
1246 Ga0307410_10027366
1247 Ga0307406_10321596
1248 Ga0307406_11685656
1249 Ga0307407_11714381
1250 Ga0307412_10104393
1251 Ga0307412_10132398
1252 Ga0307409_100304971
1253 Ga0307416_100040405
1254 Ga0307411_10055210
1255 Ga0307415_100030887
1256 Ga0307415_100278335
1257 Ga0307415_100362810
1258 Ga0373955_0600311
1259 Ga0373931_0620036
1260 Ga0373935_0002697
1261 Ga0373937_0954977
1262 Ga0395899_0000104
1263 Ga0395899_0000981
1264 Ga0395899_0007054
1265 Ga0395899_0011333
1266 Ga0395899_0011406
1267 Ga0395899_0054753
1268 Ga0395899_0099079
1269 Ga0395899_0123294
1270 Ga0395899_0277356
1271 Ga0395899_0801021
1272 Ga0395900_0000739
1273 Ga0395900_0003622
1274 Ga0395900_0014323
1275 Ga0395900_0020065
1276 Ga0395900_0038071
1277 Ga0395900_0045755
1278 Ga0395900_0050871
1279 Ga0395900_0097521
1280 Ga0395900_0124850
1281 Ga0395900_0136347
1282 Ga0395900_0151488
1283 Ga0395900_0178067
1284 Ga0395900_0181819
1285 Ga0395900_0354091
1286 Ga0395900_0487744
1287 Ga0395900_0580396
1288 Ga0395900_0630589
1289 Ga0395900_0718342
1290 Ga0395900_1527282
1291 Ga0395898_0000169
1292 Ga0395898_0004083
1293 Ga0395898_0006331
1294 Ga0395898_0013658
1295 Ga0395898_0022731
1296 Ga0395898_0043084
1297 Ga0395898_0090569
1298 Ga0395898_0099374
1299 Ga0395898_0152298
1300 Ga0395898_0268600
1301 Ga0395898_0546232
1302 Ga0395898_0974169
1303 Ga0395898_1110806
1304 Ga0395905_0000109
1305 Ga0395905_0003687
1306 Ga0395905_0007538
1307 Ga0395905_0017575
1308 Ga0395905_0024667
1309 Ga0395905_0025023
1310 Ga0395905_0026524
1311 Ga0395905_0071421
1312 Ga0395905_0075662
1313 Ga0395905_0114980
1314 Ga0395905_0133101
1315 Ga0395905_0347315
1316 Ga0395905_0347823
1317 Ga0395905_0408781
1318 Ga0395905_0455888
1319 Ga0395905_0605504
1320 Ga0395905_0716981
1321 Ga0395905_0911503
1322 Ga0395905_1011576
1323 Ga0395901_0011647
1324 Ga0395901_0013974
1325 Ga0395901_0018414
1326 Ga0395901_0030129
1327 Ga0395901_0032051
1328 Ga0395901_0101765
1329 Ga0395901_0138830
1330 Ga0395901_0259839
1331 Ga0395901_0269316
1332 Ga0395901_0290031
1333 Ga0395901_0605504
1334 Ga0395901_0644397
1335 Ga0395901_1187192
1336 Ga0395901_1212779
1337 Ga0395901_1345651
1338 Ga0395901_1414616
1339 Ga0451853_3429965
1340 Ga0439448_0001631
1341 Ga0439432_007807
1342 Ga0439455_0128539
1343 Ga0439458_0000629
1344 Ga0439458_0002133
1345 Ga0466969_0010066
1346 Ga0466969_0153857
1347 Ga0466969_0446828
1348 Ga0466972_0072014
1349 Ga0466965_0060010
1350 Ga0466965_0429346
1351 Ga0466965_0455059
1352 Ga0466966_0017028
1353 Ga0466966_0069026
1354 Ga0466966_0158899
1355 Ga0466966_0192804
1356 Ga0466966_0230275
1357 Ga0466966_0442877
1358 Ga0466961_0009596
1359 Ga0466961_0123137
1360 Ga0466961_0194838
1361 Ga0466961_0390858
1362 Ga0466963_0004423
1363 Ga0466963_0038934
1364 Ga0466963_0128562
1365 Ga0466963_0748412
1366 Ga0466964_0006864
1367 Ga0466964_0462995
1368 Ga0466971_0002898
1369 Ga0466971_0003496
1370 Ga0466971_0240046
1371 Ga0466968_0384110
1372 Ga0466970_0001478
1373 Ga0466970_0011962
1374 Ga0466970_0195232
1375 Ga0466970_0268672
1376 Ga0466957_0014335
1377 Ga0466957_0020834
1378 Ga0466957_0116063
1379 Ga0466957_0552161
1380 Ga0466957_0555069
1381 Ga0466960_0200995
1382 Ga0466959_0067975
1383 Ga0466959_0082883
1384 Ga0466959_0147661
1385 Ga0466959_0183126
1386 Ga0466958_0003025
1387 Ga0466958_0030874
1388 Ga0466958_0109270
1389 Ga0466958_0122916
1390 Ga0466958_0168456
1391 Ga0466958_0215026
1392 Ga0466958_0238024
1393 Ga0466958_1039409
1394 Ga0466967_0024155
1395 Ga0466967_0403425
1396 Ga0495585_0248163
1397 Ga0495642_0019884
1398 Ga0495598_0001392
1399 Ga0495621_0011897
1400 Ga0495621_0025556
1401 Ga0495656_0108285
1402 Ga0495669_0173757
1403 Ga0495670_0006982
1404 Ga0495670_0256238
1405 Ga0496101_1045707
1406 Ga0496102_0198569
1407 Ga0496102_1045472
1408 Ga0496103_0077935
1409 Ga0496106_0023848
1410 Ga0496107_0438841
1411 Ga0496108_0394052
1412 Ga0496108_0400739
1413 Ga0496109_0024200
1414 Ga0496109_0403370
1415 Ga0496109_0516503
1416 Ga0496109_1306695
1417 Ga0496110_0420621
1418 Ga0496111_0017697
1419 Ga0496111_0787886
1420 Ga0496112_0040863
1421 Ga0496112_0043307
1422 Ga0496112_0043809
1423 Ga0496112_0073581
1424 Ga0496112_0105572
1425 Ga0496112_0389336
1426 Ga0496112_0485761
1427 Ga0496113_0055110
1428 Ga0496113_0085546
1429 Ga0496113_0469972
1430 Ga0496114_0000006
1431 Ga0501067_0521121
1432 Ga0501270_016762
1433 Ga0587083_0281863
1434 Ga0466962_0000637
1435 Ga0466962_0044171
1436 Ga0466962_0057550
1437 Ga0466962_0236231
1438 Ga0466962_0236969

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01127

Sdh_cyt

Succinate dehydrogenase/Fumarate reductase transmembrane subunit

5

115

0.92

Map