F476817

General Info

Members Datasets Scaffolds Average Seq Length
712 266 1424 354

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100077919|Ga0070713_1000779192
Length 373
Sequence VCYDFSQPQSMTQGKPTVVVTGVSGNLGLRLLPHLAEFSVIGIDIAAPKTDAPIRFVRMDLGVEDSCRSLYNLFKETRPFSVVHLAFVIDPVRTGVIDVDQMWHINVAGTARVMEAITEANRNEDSGIRQFVYPSSVSVYGPDLPGPVLEDFALDAHTLPYAVHKRESDRVVQQRAPALRGCSAYVLRPHIFAGASVDNYLIGAFRGSPNGKGKRAAQMRQQGKRLPCMLPYGQRYLDNQIQFVHVDDMARLLAWILTREPEARRLTILNVAGRGEPLTFAQCIEMAHAKLIRVPGQWGMRIVLEFLWKFGISAIPPDAVPYMSGQYIMNTDRLKKFLGDDYEKVIRYTVADAFADSFKAPAPVGEAQKLAVR

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
119 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
122 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
123 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
184 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
189 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
193 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
194 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
195 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
196 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
200 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
201 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
202 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
205 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
206 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
207 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
208 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
209 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
210 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
211 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
213 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
215 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
216 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
217 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
219 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
220 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
221 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
224 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
225 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
226 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
227 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
228 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
229 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
230 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
231 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
232 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
233 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
234 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
235 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
236 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
237 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
238 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
239 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
240 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
241 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
244 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
253 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
254 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
255 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
258 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
259 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
260 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
261 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
262 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
263 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
266 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0.98
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.78
Rhizosphere 94.94
Stem 0
Stem Tuber 0
Unclassified 21.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100077919 3300005436 Unclassified 2820
2 MBSR1b_contig_1721814 2162886012 Bacteria 2865
3 LJNas_1000068 3300000546 Bacteria 14265
4 JGI24752J21851_1001651 3300001976 Bacteria 2993
5 JGI24737J22298_10011780 3300001990 Bacteria 2859
6 JGI24743J22301_10015246 3300001991 Bacteria 1423
7 JGI24034J26672_10001971 3300002239 Bacteria 2780
8 JGI24751J29686_10003861 3300002459 Bacteria 3027
9 rootL2_10297114 3300003322 Bacteria 3833
10 Ga0065712_10093816 3300005290 Bacteria 2278
11 Ga0065715_10144766 3300005293 Bacteria 1803
12 Ga0070676_10013218 3300005328 Bacteria 4521
13 Ga0070676_10030559 3300005328 Bacteria 3073
14 Ga0070683_100005697 3300005329 Bacteria 10406
15 Ga0070683_100024184 3300005329 Bacteria 5438
16 Ga0070683_100045301 3300005329 Unclassified 4059
17 Ga0070683_100365604 3300005329 Bacteria 1374
18 Ga0070690_100017896 3300005330 Unclassified 4272
19 Ga0070690_100128369 3300005330 Unclassified 1710
20 Ga0070670_100003453 3300005331 Bacteria 13117
21 Ga0070670_100014577 3300005331 Bacteria 6750
22 Ga0068869_100001697 3300005334 Bacteria 13164
23 Ga0068869_100013410 3300005334 Bacteria 5451
24 Ga0070666_10015704 3300005335 Unclassified 4833
25 Ga0070666_10025337 3300005335 Unclassified 3865
26 Ga0070680_100213985 3300005336 Bacteria 1626
27 Ga0070680_100296233 3300005336 Unclassified 1371
28 Ga0070682_100018815 3300005337 Unclassified 4044
29 Ga0068868_100002852 3300005338 Bacteria 11984
30 Ga0068868_100013787 3300005338 Bacteria 5939
31 Ga0068868_100092520 3300005338 Bacteria 2437
32 Ga0070660_100006500 3300005339 Bacteria 8108
33 Ga0070660_100035673 3300005339 Unclassified 3765
34 Ga0070660_100162774 3300005339 Bacteria 1798
35 Ga0070689_100006512 3300005340 Bacteria 8096
36 Ga0070689_100193240 3300005340 Unclassified 1658
37 Ga0070691_10097699 3300005341 Bacteria 1455
38 Ga0070687_100043771 3300005343 Bacteria 2277
39 Ga0070687_100074674 3300005343 Unclassified 1831
40 Ga0070661_100015178 3300005344 Bacteria 5435
41 Ga0070661_100045631 3300005344 Unclassified 3204
42 Ga0070668_100011344 3300005347 Bacteria 6639
43 Ga0070669_100013115 3300005353 Bacteria 5889
44 Ga0070669_100092672 3300005353 Unclassified 2268
45 Ga0070675_100076229 3300005354 Unclassified 2789
46 Ga0070675_100087836 3300005354 Bacteria 2600
47 Ga0070671_100048959 3300005355 Unclassified 3516
48 Ga0070671_100192808 3300005355 Bacteria 1727
49 Ga0070674_100097347 3300005356 Bacteria 2137
50 Ga0070673_100035010 3300005364 Bacteria 3805
51 Ga0070688_100002680 3300005365 Bacteria 9041
52 Ga0070688_100079167 3300005365 Bacteria 2122
53 Ga0070659_100003497 3300005366 Bacteria 11186
54 Ga0070667_100204659 3300005367 Bacteria 1752
55 Ga0070667_100257931 3300005367 Unclassified 1560
56 Ga0070709_10005788 3300005434 Bacteria 6699
57 Ga0070709_10046988 3300005434 Unclassified 2687
58 Ga0070709_10050621 3300005434 Bacteria 2603
59 Ga0070709_10114783 3300005434 Bacteria 1815
60 Ga0070709_10117046 3300005434 Unclassified 1800
61 Ga0070709_10155224 3300005434 Bacteria 1586
62 Ga0070709_10222700 3300005434 Bacteria 1346
63 Ga0070714_100000069 3300005435 Bacteria 93567
64 Ga0070714_100002836 3300005435 Bacteria 12794
65 Ga0070714_100009246 3300005435 Bacteria 7743
66 Ga0070714_100010671 3300005435 Bacteria 7269
67 Ga0070714_100060682 3300005435 Bacteria 3246
68 Ga0070713_100000432 3300005436 Bacteria 26764
69 Ga0070713_100004168 3300005436 Bacteria 9645
70 Ga0070713_100015996 3300005436 Bacteria 5629
71 Ga0070713_100033020 3300005436 Bacteria 4142
72 Ga0070713_100038249 3300005436 Unclassified 3885
73 Ga0070713_100045351 3300005436 Bacteria 3602
74 Ga0070713_100162784 3300005436 Bacteria 1993
75 Ga0070713_100177584 3300005436 Bacteria 1912
76 Ga0070713_100250601 3300005436 Bacteria 1615
77 Ga0070713_100283995 3300005436 Unclassified 1519
78 Ga0070710_10002730 3300005437 Bacteria 8401
79 Ga0070710_10018901 3300005437 Unclassified 3553
80 Ga0070710_10035148 3300005437 Unclassified 2731
81 Ga0070710_10047859 3300005437 Bacteria 2387
82 Ga0070710_10050340 3300005437 Bacteria 2335
83 Ga0070710_10086402 3300005437 Unclassified 1842
84 Ga0070710_10111427 3300005437 Bacteria 1644
85 Ga0070710_10201400 3300005437 Unclassified 1257
86 Ga0070711_100000340 3300005439 Bacteria 24038
87 Ga0070711_100001263 3300005439 Bacteria 13724
88 Ga0070711_100009672 3300005439 Bacteria 5941
89 Ga0070711_100019911 3300005439 Bacteria 4315
90 Ga0070711_100024778 3300005439 Unclassified 3919
91 Ga0070711_100036060 3300005439 Unclassified 3312
92 Ga0070711_100080308 3300005439 Bacteria 2322
93 Ga0070700_100030985 3300005441 Bacteria 3201
94 Ga0070708_100001602 3300005445 Bacteria 17338
95 Ga0070708_100003146 3300005445 Bacteria 12861
96 Ga0070708_100003488 3300005445 Bacteria 12311
97 Ga0070708_100004955 3300005445 Bacteria 10526
98 Ga0070708_100015660 3300005445 Bacteria 6267
99 Ga0070708_100095672 3300005445 Unclassified 2712
100 Ga0070708_100103560 3300005445 Bacteria 2609
101 Ga0070708_100163350 3300005445 Unclassified 2076
102 Ga0070663_100004820 3300005455 Bacteria 7954
103 Ga0070663_100093588 3300005455 Bacteria 2230
104 Ga0070678_100001279 3300005456 Bacteria 13335
105 Ga0070662_100016350 3300005457 Unclassified 4981
106 Ga0070662_100070338 3300005457 Bacteria 2578
107 Ga0070681_10000988 3300005458 Bacteria 24052
108 Ga0070681_10012121 3300005458 Bacteria 8551
109 Ga0070681_10026962 3300005458 Bacteria 5777
110 Ga0070681_10247551 3300005458 Unclassified 1695
111 Ga0068867_100005388 3300005459 Bacteria 9048
112 Ga0068867_100017345 3300005459 Bacteria 5114
113 Ga0068867_100059384 3300005459 Unclassified 2835
114 Ga0068867_100100981 3300005459 Unclassified 2203
115 Ga0070685_10006488 3300005466 Bacteria 5966
116 Ga0070706_100000499 3300005467 Bacteria 45986
117 Ga0070706_100006009 3300005467 Bacteria 11472
118 Ga0070706_100010487 3300005467 Bacteria 8600
119 Ga0070706_100029859 3300005467 Bacteria 5021
120 Ga0070706_100087439 3300005467 Unclassified 2889
121 Ga0070707_100006096 3300005468 Bacteria 11241
122 Ga0070707_100023364 3300005468 Bacteria 5849
123 Ga0070707_100029235 3300005468 Bacteria 5247
124 Ga0070707_100041410 3300005468 Bacteria 4409
125 Ga0070698_100001333 3300005471 Bacteria 27479
126 Ga0070698_100093902 3300005471 Bacteria 2979
127 Ga0070699_100001027 3300005518 Bacteria 25921
128 Ga0070699_100008978 3300005518 Bacteria 8658
129 Ga0070699_100026520 3300005518 Unclassified 4996
130 Ga0070699_100048802 3300005518 Bacteria 3664
131 Ga0070699_100048858 3300005518 Bacteria 3661
132 Ga0070679_100017175 3300005530 Bacteria 6999
133 Ga0070679_100074052 3300005530 Bacteria 3396
134 Ga0070679_100173580 3300005530 Bacteria 2128
135 Ga0070684_100006948 3300005535 Bacteria 8791
136 Ga0070684_100020470 3300005535 Bacteria 5489
137 Ga0070684_100060294 3300005535 Bacteria 3318
138 Ga0070684_100066145 3300005535 Bacteria 3173
139 Ga0070684_100103423 3300005535 Unclassified 2548
140 Ga0070697_100000237 3300005536 Bacteria 44549
141 Ga0070697_100000345 3300005536 Bacteria 36544
142 Ga0070697_100005318 3300005536 Bacteria 9892
143 Ga0070697_100005514 3300005536 Bacteria 9753
144 Ga0070697_100034477 3300005536 Bacteria 4081
145 Ga0068853_100007763 3300005539 Bacteria 8605
146 Ga0068853_100008970 3300005539 Bacteria 8057
147 Ga0068853_100132065 3300005539 Bacteria 2236
148 Ga0068853_100148208 3300005539 Unclassified 2111
149 Ga0068853_100172863 3300005539 Bacteria 1955
150 Ga0070672_100003170 3300005543 Bacteria 10631
151 Ga0070686_100070320 3300005544 Bacteria 2288
152 Ga0070693_100049870 3300005547 Unclassified 2390
153 Ga0070693_100064655 3300005547 Bacteria 2136
154 Ga0070665_100171339 3300005548 Unclassified 2172
155 Ga0070665_100341878 3300005548 Bacteria 1501
156 Ga0068855_100000440 3300005563 Bacteria 51346
157 Ga0068855_100001467 3300005563 Bacteria 29462
158 Ga0068855_100028962 3300005563 Bacteria 6625
159 Ga0068855_100092660 3300005563 Unclassified 3484
160 Ga0068855_100243518 3300005563 Unclassified 2008
161 Ga0070664_100000079 3300005564 Bacteria 61393
162 Ga0070664_100020164 3300005564 Bacteria 5489
163 Ga0070664_100110929 3300005564 Bacteria 2394
164 Ga0068857_100005472 3300005577 Bacteria 10830
165 Ga0068857_100014158 3300005577 Bacteria 6946
166 Ga0068857_100313107 3300005577 Unclassified 1448
167 Ga0068854_100023351 3300005578 Unclassified 4223
168 Ga0068854_100039340 3300005578 Unclassified 3331
169 Ga0068854_100043980 3300005578 Unclassified 3168
170 Ga0068854_100123180 3300005578 Bacteria 1971
171 Ga0068856_100000314 3300005614 Bacteria 53174
172 Ga0068856_100000884 3300005614 Bacteria 32074
173 Ga0068856_100001689 3300005614 Bacteria 23073
174 Ga0068856_100002427 3300005614 Bacteria 19176
175 Ga0068856_100005971 3300005614 Bacteria 11986
176 Ga0068856_100012736 3300005614 Bacteria 8142
177 Ga0068856_100021784 3300005614 Bacteria 6229
178 Ga0068856_100039877 3300005614 Bacteria 4611
179 Ga0068856_100097053 3300005614 Bacteria 2936
180 Ga0068856_100240129 3300005614 Bacteria 1827
181 Ga0070702_100009303 3300005615 Unclassified 4806
182 Ga0068852_100025232 3300005616 Unclassified 4814
183 Ga0068852_100124241 3300005616 Bacteria 2367
184 Ga0068852_100144560 3300005616 Unclassified 2205
185 Ga0068859_100000743 3300005617 Bacteria 32840
186 Ga0068859_100057749 3300005617 Bacteria 3908
187 Ga0068859_100068455 3300005617 Bacteria 3584
188 Ga0068864_100001188 3300005618 Bacteria 21660
189 Ga0068864_100018692 3300005618 Bacteria 5792
190 Ga0068866_10000598 3300005718 Bacteria 16433
191 Ga0068866_10004876 3300005718 Bacteria 5510
192 Ga0068861_100007953 3300005719 Bacteria 7296
193 Ga0068861_100107557 3300005719 Bacteria 2230
194 Ga0068861_100431345 3300005719 Bacteria 1177
195 Ga0068851_10063885 3300005834 Unclassified 1891
196 Ga0068870_10004535 3300005840 Bacteria 5984
197 Ga0068870_10004937 3300005840 Bacteria 5778
198 Ga0068863_100013078 3300005841 Bacteria 8006
199 Ga0068863_100013754 3300005841 Bacteria 7800
200 Ga0068863_100017153 3300005841 Bacteria 6945
201 Ga0068863_100117898 3300005841 Bacteria 2530
202 Ga0068858_100007110 3300005842 Bacteria 10866
203 Ga0068858_100010215 3300005842 Bacteria 8907
204 Ga0068858_100010361 3300005842 Bacteria 8830
205 Ga0068858_100023370 3300005842 Bacteria 5759
206 Ga0068858_100053973 3300005842 Bacteria 3717
207 Ga0068858_100100969 3300005842 Unclassified 2691
208 Ga0068860_100029714 3300005843 Bacteria 5258
209 Ga0068862_100028772 3300005844 Unclassified 4680
210 Ga0068862_100094370 3300005844 Unclassified 2610
211 Ga0081455_10233363 3300005937 Bacteria 1356
212 Ga0081540_1062394 3300005983 Bacteria 1770
213 Ga0070717_10000535 3300006028 Bacteria 24038
214 Ga0070717_10000774 3300006028 Bacteria 20927
215 Ga0070717_10001917 3300006028 Bacteria 14536
216 Ga0070717_10001986 3300006028 Bacteria 14301
217 Ga0070717_10002964 3300006028 Bacteria 12068
218 Ga0070717_10003179 3300006028 Bacteria 11734
219 Ga0070717_10005116 3300006028 Bacteria 9568
220 Ga0070717_10009302 3300006028 Bacteria 7384
221 Ga0070717_10053757 3300006028 Bacteria 3320
222 Ga0070717_10134131 3300006028 Bacteria 2131
223 Ga0070717_10241720 3300006028 Unclassified 1592
224 Ga0070717_10469326 3300006028 Bacteria 1136
225 Ga0070715_10004537 3300006163 Bacteria 4567
226 Ga0070716_100000792 3300006173 Bacteria 13578
227 Ga0070716_100000963 3300006173 Bacteria 12483
228 Ga0070716_100002978 3300006173 Bacteria 7895
229 Ga0070716_100003222 3300006173 Bacteria 7658
230 Ga0070712_100000042 3300006175 Bacteria 66639
231 Ga0070712_100001489 3300006175 Bacteria 14297
232 Ga0070712_100018579 3300006175 Bacteria 4519
233 Ga0070712_100221985 3300006175 Bacteria 1497
234 Ga0097621_100000088 3300006237 Bacteria 49698
235 Ga0097621_100000731 3300006237 Bacteria 22963
236 Ga0097621_100016919 3300006237 Bacteria 5528
237 Ga0097621_100018541 3300006237 Bacteria 5319
238 Ga0097621_100028548 3300006237 Bacteria 4398
239 Ga0097621_100055485 3300006237 Unclassified 3235
240 Ga0097621_100189522 3300006237 Bacteria 1780
241 Ga0068871_100000266 3300006358 Bacteria 35937
242 Ga0068871_100000428 3300006358 Bacteria 29019
243 Ga0068871_100001484 3300006358 Bacteria 15731
244 Ga0068871_100027364 3300006358 Bacteria 4459
245 Ga0068871_100046773 3300006358 Unclassified 3486
246 Ga0075433_10026059 3300006852 Unclassified 4946
247 Ga0075433_10043002 3300006852 Unclassified 3921
248 Ga0075434_100000123 3300006871 Bacteria 45651
249 Ga0075434_100005455 3300006871 Bacteria 11589
250 Ga0075434_100020739 3300006871 Bacteria 6378
251 Ga0068865_100012574 3300006881 Bacteria 5332
252 Ga0068865_100021538 3300006881 Unclassified 4193
253 Ga0075436_100082065 3300006914 Bacteria 2236
254 Ga0075436_100151389 3300006914 Bacteria 1633
255 Ga0097620_100000743 3300006931 Bacteria 32840
256 Ga0097620_100057750 3300006931 Bacteria 3908
257 Ga0097620_100068461 3300006931 Bacteria 3584
258 Ga0075435_100000170 3300007076 Bacteria 38099
259 Ga0075435_100047396 3300007076 Bacteria 3450
260 Ga0075435_100072434 3300007076 Bacteria 2815
261 Ga0105240_10004147 3300009093 Bacteria 22200
262 Ga0105240_10005076 3300009093 Bacteria 19734
263 Ga0105240_10029627 3300009093 Bacteria 7126
264 Ga0105240_10089835 3300009093 Bacteria 3756
265 Ga0105240_10102427 3300009093 Bacteria 3479
266 Ga0105240_10105918 3300009093 Bacteria 3412
267 Ga0105240_10210921 3300009093 Unclassified 2270
268 Ga0105240_10491743 3300009093 Unclassified 1366
269 Ga0111539_10238232 3300009094 Bacteria 2118
270 Ga0105245_10006526 3300009098 Bacteria 10246
271 Ga0105245_10032318 3300009098 Unclassified 4633
272 Ga0105245_10078898 3300009098 Bacteria 3005
273 Ga0105247_10009548 3300009101 Bacteria 5887
274 Ga0105247_10098251 3300009101 Bacteria 1869
275 Ga0105247_10140927 3300009101 Bacteria 1580
276 Ga0105243_10015615 3300009148 Bacteria 5741
277 Ga0105243_10155596 3300009148 Bacteria 1965
278 Ga0105241_10001732 3300009174 Bacteria 16560
279 Ga0105241_10005799 3300009174 Bacteria 9118
280 Ga0105241_10017495 3300009174 Bacteria 5271
281 Ga0105241_10028999 3300009174 Unclassified 4125
282 Ga0105241_10062460 3300009174 Bacteria 2872
283 Ga0105241_10135425 3300009174 Unclassified 1999
284 Ga0105241_10239519 3300009174 Unclassified 1533
285 Ga0105242_10011382 3300009176 Bacteria 6839
286 Ga0105242_10058540 3300009176 Bacteria 3159
287 Ga0105242_10095067 3300009176 Unclassified 2515
288 Ga0105242_10099448 3300009176 Unclassified 2462
289 Ga0105248_10002754 3300009177 Bacteria 19526
290 Ga0105248_10056144 3300009177 Unclassified 4417
291 Ga0105248_10101957 3300009177 Bacteria 3235
292 Ga0105248_10194298 3300009177 Bacteria 2286
293 Ga0105237_10010940 3300009545 Bacteria 9628
294 Ga0105237_10016208 3300009545 Bacteria 7750
295 Ga0105237_10269109 3300009545 Bacteria 1707
296 Ga0105237_10290302 3300009545 Bacteria 1638
297 Ga0105238_10001256 3300009551 Bacteria 25520
298 Ga0105238_10029280 3300009551 Bacteria 5610
299 Ga0105238_10048212 3300009551 Unclassified 4294
300 Ga0105249_10019161 3300009553 Bacteria 6102
301 Ga0105249_10032850 3300009553 Bacteria 4696
302 Ga0105249_10078747 3300009553 Bacteria 3058
303 Ga0099796_10005997 3300010159 Bacteria 3080
304 Ga0105239_10007204 3300010375 Bacteria 12783
305 Ga0105239_10009713 3300010375 Bacteria 10818
306 Ga0105239_10047871 3300010375 Unclassified 4686
307 Ga0105239_10048717 3300010375 Unclassified 4646
308 Ga0105239_10083446 3300010375 Bacteria 3519
309 Ga0105239_10155424 3300010375 Bacteria 2554
310 Ga0105246_10008559 3300011119 Bacteria 6293
311 Ga0105246_10009350 3300011119 Bacteria 6040
312 Ga0105246_10020579 3300011119 Unclassified 4234
313 Ga0157373_10000869 3300013100 Bacteria 23380
314 Ga0157373_10025837 3300013100 Unclassified 4245
315 Ga0157373_10035233 3300013100 Bacteria 3594
316 Ga0157373_10179584 3300013100 Bacteria 1490
317 Ga0157371_10027867 3300013102 Unclassified 4094
318 Ga0157371_10060933 3300013102 Bacteria 2675
319 Ga0157370_10063358 3300013104 Bacteria 3503
320 Ga0157369_10000196 3300013105 Bacteria 84536
321 Ga0157369_10030283 3300013105 Bacteria 5970
322 Ga0157369_10043009 3300013105 Unclassified 4925
323 Ga0157369_10056780 3300013105 Bacteria 4224
324 Ga0157369_10087561 3300013105 Unclassified 3325
325 Ga0157369_10103711 3300013105 Bacteria 3029
326 Ga0157369_10136272 3300013105 Bacteria 2599
327 Ga0157374_10000989 3300013296 Bacteria 24633
328 Ga0157374_10001078 3300013296 Bacteria 23634
329 Ga0157374_10001572 3300013296 Bacteria 19190
330 Ga0157374_10003563 3300013296 Bacteria 13110
331 Ga0157374_10031960 3300013296 Unclassified 4788
332 Ga0157374_10194153 3300013296 Bacteria 1986
333 Ga0157374_10196670 3300013296 Bacteria 1973
334 Ga0157378_10000057 3300013297 Bacteria 96589
335 Ga0157378_10000058 3300013297 Bacteria 96172
336 Ga0157378_10004484 3300013297 Bacteria 12259
337 Ga0157378_10087649 3300013297 Bacteria 2823
338 Ga0157378_10200557 3300013297 Bacteria 1887
339 Ga0163162_10028765 3300013306 Bacteria 5501
340 Ga0163162_10128200 3300013306 Unclassified 2645
341 Ga0163162_10461708 3300013306 Bacteria 1401
342 Ga0157372_10000200 3300013307 Bacteria 66086
343 Ga0157372_10000379 3300013307 Bacteria 49273
344 Ga0157372_10003854 3300013307 Bacteria 16121
345 Ga0157372_10004695 3300013307 Bacteria 14508
346 Ga0157372_10006238 3300013307 Bacteria 12676
347 Ga0157372_10012309 3300013307 Bacteria 9116
348 Ga0157372_10034567 3300013307 Bacteria 5557
349 Ga0157372_10045541 3300013307 Bacteria 4867
350 Ga0157375_10018772 3300013308 Bacteria 6275
351 Ga0157375_10085629 3300013308 Unclassified 3201
352 Ga0157375_10091066 3300013308 Bacteria 3110
353 Ga0163163_10008354 3300014325 Bacteria 9195
354 Ga0163163_10035017 3300014325 Bacteria 4868
355 Ga0182008_10003836 3300014497 Bacteria 8935
356 Ga0182008_10028083 3300014497 Bacteria 2846
357 Ga0157377_10000586 3300014745 Bacteria 15141
358 Ga0157379_10002438 3300014968 Bacteria 15569
359 Ga0157379_10006714 3300014968 Bacteria 9940
360 Ga0157379_10051045 3300014968 Bacteria 3694
361 Ga0157379_10217281 3300014968 Unclassified 1732
362 Ga0157379_10277088 3300014968 Bacteria 1526
363 Ga0157376_10003037 3300014969 Bacteria 11495
364 Ga0157376_10025014 3300014969 Bacteria 4697
365 Ga0157376_10039227 3300014969 Bacteria 3861
366 Ga0157376_10067173 3300014969 Bacteria 3032
367 Ga0157376_10172932 3300014969 Bacteria 1968
368 Ga0157376_10184465 3300014969 Bacteria 1909
369 Ga0182006_1009258 3300015261 Unclassified 4422
370 Ga0182006_1010681 3300015261 Unclassified 4069
371 Ga0182007_10003201 3300015262 Bacteria 7812
372 Ga0163161_10001547 3300017792 Bacteria 16984
373 Ga0224570_100448 3300022730 Bacteria 3229
374 Ga0224572_1005230 3300024225 Unclassified 2305
375 Ga0224572_1008971 3300024225 Unclassified 1859
376 Ga0228598_1000482 3300024227 Bacteria 8191
377 Ga0228598_1000734 3300024227 Bacteria 7005
378 Ga0207656_10011131 3300025321 Bacteria 3390
379 Ga0207682_10051808 3300025893 Bacteria 1700
380 Ga0207692_10001160 3300025898 Bacteria 9728
381 Ga0207692_10002644 3300025898 Bacteria 6892
382 Ga0207692_10005161 3300025898 Bacteria 5213
383 Ga0207642_10096855 3300025899 Unclassified 1472
384 Ga0207710_10005097 3300025900 Bacteria 5683
385 Ga0207680_10017425 3300025903 Unclassified 3795
386 Ga0207680_10129025 3300025903 Unclassified 1664
387 Ga0207647_10003396 3300025904 Bacteria 11930
388 Ga0207647_10013377 3300025904 Bacteria 5692
389 Ga0207685_10050906 3300025905 Bacteria 1597
390 Ga0207699_10011839 3300025906 Bacteria 4420
391 Ga0207699_10014346 3300025906 Bacteria 4082
392 Ga0207699_10015643 3300025906 Unclassified 3946
393 Ga0207699_10021495 3300025906 Bacteria 3479
394 Ga0207699_10036152 3300025906 Unclassified 2814
395 Ga0207699_10143950 3300025906 Bacteria 1569
396 Ga0207699_10155135 3300025906 Bacteria 1519
397 Ga0207645_10000551 3300025907 Bacteria 31119
398 Ga0207645_10054517 3300025907 Unclassified 2553
399 Ga0207643_10005881 3300025908 Bacteria 6552
400 Ga0207684_10002771 3300025910 Bacteria 17451
401 Ga0207684_10003513 3300025910 Bacteria 15292
402 Ga0207684_10008622 3300025910 Bacteria 9059
403 Ga0207684_10025610 3300025910 Bacteria 5028
404 Ga0207684_10071885 3300025910 Unclassified 2939
405 Ga0207684_10113344 3300025910 Unclassified 2321
406 Ga0207654_10047941 3300025911 Bacteria 2443
407 Ga0207654_10055058 3300025911 Unclassified 2301
408 Ga0207707_10000617 3300025912 Bacteria 35411
409 Ga0207707_10002456 3300025912 Bacteria 16676
410 Ga0207707_10150309 3300025912 Unclassified 2036
411 Ga0207695_10005582 3300025913 Bacteria 16616
412 Ga0207695_10016407 3300025913 Bacteria 8665
413 Ga0207695_10026809 3300025913 Bacteria 6426
414 Ga0207695_10041882 3300025913 Bacteria 4898
415 Ga0207695_10075460 3300025913 Bacteria 3430
416 Ga0207695_10088028 3300025913 Bacteria 3127
417 Ga0207693_10000010 3300025915 Bacteria 162031
418 Ga0207693_10000076 3300025915 Bacteria 88185
419 Ga0207693_10000689 3300025915 Bacteria 30320
420 Ga0207693_10003255 3300025915 Bacteria 13927
421 Ga0207693_10037974 3300025915 Bacteria 3794
422 Ga0207693_10068427 3300025915 Bacteria 2779
423 Ga0207693_10241327 3300025915 Bacteria 1418
424 Ga0207663_10000541 3300025916 Bacteria 16618
425 Ga0207663_10005938 3300025916 Bacteria 6197
426 Ga0207663_10014476 3300025916 Bacteria 4320
427 Ga0207663_10018035 3300025916 Unclassified 3945
428 Ga0207663_10049676 3300025916 Bacteria 2603
429 Ga0207663_10068199 3300025916 Bacteria 2284
430 Ga0207663_10072953 3300025916 Bacteria 2220
431 Ga0207663_10149992 3300025916 Bacteria 1635
432 Ga0207660_10174946 3300025917 Bacteria 1664
433 Ga0207662_10000359 3300025918 Bacteria 20504
434 Ga0207657_10006439 3300025919 Bacteria 12168
435 Ga0207657_10009009 3300025919 Bacteria 10078
436 Ga0207657_10014017 3300025919 Bacteria 7844
437 Ga0207649_10000546 3300025920 Bacteria 26008
438 Ga0207652_10008089 3300025921 Bacteria 8443
439 Ga0207652_10015654 3300025921 Bacteria 6174
440 Ga0207646_10002047 3300025922 Bacteria 24227
441 Ga0207646_10010353 3300025922 Bacteria 9120
442 Ga0207646_10016435 3300025922 Bacteria 6943
443 Ga0207646_10020901 3300025922 Bacteria 6056
444 Ga0207646_10036059 3300025922 Bacteria 4465
445 Ga0207646_10036812 3300025922 Bacteria 4416
446 Ga0207681_10037905 3300025923 Unclassified 3190
447 Ga0207681_10211963 3300025923 Bacteria 1493
448 Ga0207694_10033298 3300025924 Unclassified 3948
449 Ga0207694_10043723 3300025924 Bacteria 3457
450 Ga0207694_10052747 3300025924 Unclassified 3152
451 Ga0207694_10157742 3300025924 Bacteria 1831
452 Ga0207650_10000045 3300025925 Bacteria 181507
453 Ga0207650_10028985 3300025925 Unclassified 3974
454 Ga0207650_10099273 3300025925 Bacteria 2238
455 Ga0207659_10019123 3300025926 Unclassified 4501
456 Ga0207687_10044178 3300025927 Unclassified 3073
457 Ga0207687_10172849 3300025927 Bacteria 1668
458 Ga0207700_10000121 3300025928 Bacteria 46080
459 Ga0207700_10002500 3300025928 Bacteria 10534
460 Ga0207700_10014223 3300025928 Bacteria 5208
461 Ga0207700_10022051 3300025928 Unclassified 4362
462 Ga0207700_10024805 3300025928 Unclassified 4155
463 Ga0207700_10066685 3300025928 Bacteria 2752
464 Ga0207700_10083429 3300025928 Bacteria 2502
465 Ga0207700_10112523 3300025928 Bacteria 2193
466 Ga0207700_10126947 3300025928 Bacteria 2077
467 Ga0207700_10153648 3300025928 Bacteria 1904
468 Ga0207700_10234552 3300025928 Unclassified 1561
469 Ga0207664_10000084 3300025929 Bacteria 93564
470 Ga0207664_10001858 3300025929 Bacteria 13932
471 Ga0207664_10026317 3300025929 Unclassified 4395
472 Ga0207664_10148899 3300025929 Unclassified 1987
473 Ga0207664_10165530 3300025929 Unclassified 1889
474 Ga0207664_10328887 3300025929 Unclassified 1349
475 Ga0207644_10018085 3300025931 Unclassified 4765
476 Ga0207690_10162875 3300025932 Bacteria 1664
477 Ga0207706_10001067 3300025933 Bacteria 27853
478 Ga0207706_10001085 3300025933 Bacteria 27637
479 Ga0207706_10015387 3300025933 Bacteria 6911
480 Ga0207686_10022874 3300025934 Bacteria 3603
481 Ga0207686_10098383 3300025934 Unclassified 1948
482 Ga0207670_10004567 3300025936 Bacteria 7479
483 Ga0207669_10160041 3300025937 Bacteria 1589
484 Ga0207704_10043852 3300025938 Bacteria 2645
485 Ga0207665_10001046 3300025939 Bacteria 18599
486 Ga0207665_10001295 3300025939 Bacteria 16905
487 Ga0207665_10003917 3300025939 Bacteria 9965
488 Ga0207665_10015791 3300025939 Bacteria 4955
489 Ga0207665_10074790 3300025939 Bacteria 2319
490 Ga0207691_10001782 3300025940 Bacteria 21176
491 Ga0207691_10146285 3300025940 Unclassified 2080
492 Ga0207711_10018805 3300025941 Bacteria 5744
493 Ga0207711_10018874 3300025941 Bacteria 5733
494 Ga0207689_10000185 3300025942 Bacteria 54094
495 Ga0207689_10001473 3300025942 Bacteria 22547
496 Ga0207689_10006133 3300025942 Bacteria 10637
497 Ga0207689_10092321 3300025942 Bacteria 2487
498 Ga0207661_10000131 3300025944 Bacteria 47673
499 Ga0207661_10036911 3300025944 Unclassified 3818
500 Ga0207661_10056239 3300025944 Bacteria 3158
501 Ga0207661_10083674 3300025944 Unclassified 2641
502 Ga0207679_10000283 3300025945 Bacteria 38405
503 Ga0207679_10000766 3300025945 Bacteria 21148
504 Ga0207679_10170642 3300025945 Bacteria 1790
505 Ga0207667_10001753 3300025949 Bacteria 27293
506 Ga0207667_10017467 3300025949 Bacteria 8071
507 Ga0207667_10059895 3300025949 Unclassified 3986
508 Ga0207668_10080213 3300025972 Bacteria 2363
509 Ga0207668_10087758 3300025972 Unclassified 2276
510 Ga0207640_10024085 3300025981 Bacteria 3667
511 Ga0207640_10042696 3300025981 Bacteria 2893
512 Ga0207658_10202386 3300025986 Bacteria 1658
513 Ga0207677_10004651 3300026023 Bacteria 7387
514 Ga0207677_10197503 3300026023 Bacteria 1596
515 Ga0207677_10236038 3300026023 Bacteria 1476
516 Ga0207703_10013381 3300026035 Bacteria 6394
517 Ga0207703_10033938 3300026035 Unclassified 4047
518 Ga0207703_10061950 3300026035 Bacteria 3064
519 Ga0207703_10075567 3300026035 Bacteria 2793
520 Ga0207639_10006272 3300026041 Bacteria 8075
521 Ga0207639_10013564 3300026041 Bacteria 5709
522 Ga0207639_10049256 3300026041 Unclassified 3194
523 Ga0207639_10071785 3300026041 Bacteria 2709
524 Ga0207639_10317586 3300026041 Bacteria 1382
525 Ga0207678_10001378 3300026067 Bacteria 22391
526 Ga0207678_10001488 3300026067 Bacteria 21502
527 Ga0207702_10001299 3300026078 Bacteria 25024
528 Ga0207702_10010170 3300026078 Bacteria 7876
529 Ga0207702_10024223 3300026078 Bacteria 5036
530 Ga0207702_10051469 3300026078 Bacteria 3480
531 Ga0207702_10055582 3300026078 Bacteria 3357
532 Ga0207702_10397618 3300026078 Unclassified 1328
533 Ga0207641_10000021 3300026088 Bacteria 279851
534 Ga0207641_10009919 3300026088 Bacteria 7840
535 Ga0207641_10041494 3300026088 Unclassified 3856
536 Ga0207641_10126250 3300026088 Bacteria 2291
537 Ga0207641_10313637 3300026088 Bacteria 1485
538 Ga0207648_10000611 3300026089 Bacteria 40065
539 Ga0207648_10052073 3300026089 Bacteria 3579
540 Ga0207648_10053626 3300026089 Bacteria 3524
541 Ga0207648_10130469 3300026089 Unclassified 2212
542 Ga0207676_10000096 3300026095 Bacteria 80353
543 Ga0207676_10005664 3300026095 Bacteria 8843
544 Ga0207674_10000246 3300026116 Bacteria 67486
545 Ga0207674_10043972 3300026116 Bacteria 4603
546 Ga0207674_10107936 3300026116 Unclassified 2760
547 Ga0207674_10133865 3300026116 Unclassified 2441
548 Ga0207675_100007864 3300026118 Bacteria 10061
549 Ga0207675_100035294 3300026118 Unclassified 4664
550 Ga0207683_10001457 3300026121 Bacteria 21339
551 Ga0207698_10120102 3300026142 Unclassified 2222
552 Ga0207698_10125337 3300026142 Bacteria 2183
553 Ga0207698_10278271 3300026142 Bacteria 1546
554 Ga0265354_1001671 3300028016 Unclassified 3076
555 Ga0265356_1001344 3300028017 Bacteria 3666
556 Ga0268266_10005064 3300028379 Bacteria 12430
557 Ga0268266_10422668 3300028379 Unclassified 1263
558 Ga0268265_10003076 3300028380 Bacteria 12174
559 Ga0268265_10087263 3300028380 Bacteria 2482
560 Ga0268264_10010583 3300028381 Bacteria 7625
561 Ga0268264_10065933 3300028381 Bacteria 3052
562 Ga0265338_10001963 3300028800 Bacteria 32066
563 Ga0265338_10022202 3300028800 Bacteria 6581
564 Ga0265762_1007636 3300030760 Unclassified 1927
565 Ga0265770_1005094 3300030878 Bacteria 1803
566 Ga0265760_10001472 3300031090 Bacteria 6935
567 Ga0265760_10002452 3300031090 Bacteria 5411
568 Ga0265760_10003647 3300031090 Bacteria 4465
569 Ga0265760_10005687 3300031090 Unclassified 3566
570 Ga0265760_10006535 3300031090 Bacteria 3334
571 Ga0265330_10008453 3300031235 Bacteria 4954
572 Ga0265340_10016675 3300031247 Bacteria 3802
573 Ga0265339_10028080 3300031249 Bacteria 3203
574 Ga0265339_10052979 3300031249 Unclassified 2208
575 Ga0265316_10001005 3300031344 Bacteria 30618
576 Ga0265316_10026308 3300031344 Bacteria 4842
577 Ga0265314_10001994 3300031711 Bacteria 21660
578 Ga0265314_10032997 3300031711 Bacteria 3802
579 Ga0307409_100009469 3300031995 Bacteria 5987
580 Ga0307416_100061448 3300032002 Unclassified 3066
581 Ga0307415_100003240 3300032126 Bacteria 8260
582 Ga0373934_0017088 3300035086 Bacteria 2765
583 Ga0373951_0013764 3300035091 Bacteria 1818
584 Ga0373923_0030100 3300035111 Bacteria 2181
585 Ga0373923_0085172 3300035111 Bacteria 1376
586 Ga0373936_0004722 3300035113 Bacteria 5147
587 Ga0373936_0006650 3300035113 Bacteria 4353
588 Ga0373945_0026742 3300035116 Bacteria 2011
589 Ga0373953_0027024 3300035117 Bacteria 2202
590 Ga0373954_0015186 3300035118 Bacteria 3440
591 Ga0373956_0129617 3300035119 Bacteria 1180
592 Ga0373957_0019856 3300035120 Bacteria 2368
593 Ga0373943_0000009 3300035170 Bacteria 67175
594 Ga0373943_0010538 3300035170 Bacteria 4143
595 Ga0373946_0003102 3300035171 Bacteria 5888
596 Ga0373946_0016178 3300035171 Bacteria 2839
597 Ga0373924_0016665 3300035410 Bacteria 2808
598 Ga0373931_0008667 3300035691 Unclassified 4835
599 Ga0373931_0055051 3300035691 Unclassified 2127
600 Ga0373935_0015339 3300035692 Bacteria 4630
601 Ga0373935_0046653 3300035692 Bacteria 2737
602 Ga0373927_0000539 3300035695 Bacteria 28719
603 Ga0373927_0014597 3300035695 Bacteria 5196
604 Ga0373927_0017759 3300035695 Bacteria 4681
605 Ga0373927_0054534 3300035695 Bacteria 2586
606 Ga0373927_0109676 3300035695 Bacteria 1798
607 Ga0373933_0041793 3300035724 Unclassified 2708
608 Ga0373947_0049530 3300035725 Bacteria 2523
609 Ga0373947_0093405 3300035725 Bacteria 1880
610 Ga0373947_0169723 3300035725 Bacteria 1415
611 Ga0373937_0006927 3300036401 Bacteria 9787
612 Ga0373937_0008946 3300036401 Bacteria 8691
613 Ga0373937_0149471 3300036401 Bacteria 2188
614 Ga0373925_0001229 3300037068 Bacteria 22656
615 Ga0373925_0001274 3300037068 Bacteria 22247
616 Ga0373925_0005162 3300037068 Bacteria 9784
617 Ga0373925_0018740 3300037068 Bacteria 5030
618 Ga0373925_0217571 3300037068 Bacteria 1524
619 Ga0373925_0335984 3300037068 Bacteria 1225
620 Ga0436363_0070523 3300039450 Unclassified 1149
621 Ga0466966_0207109 3300044684 Bacteria 1186
622 Ga0466961_0048378 3300044693 Bacteria 2718
623 Ga0466963_0088960 3300044694 Bacteria 2100
624 Ga0466971_0097512 3300044719 Unclassified 1349
625 Ga0466957_0037338 3300044842 Bacteria 2925
626 Ga0451576_0346997 3300045051 Unclassified 1554
627 Ga0466967_0051306 3300045976 Bacteria 3615
628 Ga0495629_0008433 3300046459 Bacteria 7586
629 Ga0495580_0001237 3300046472 Bacteria 22525
630 Ga0495580_0001858 3300046472 Bacteria 18574
631 Ga0495580_0002538 3300046472 Bacteria 15898
632 Ga0495580_0003245 3300046472 Bacteria 13908
633 Ga0495580_0004308 3300046472 Bacteria 11967
634 Ga0495580_0004470 3300046472 Bacteria 11745
635 Ga0495580_0005568 3300046472 Bacteria 10385
636 Ga0495580_0014786 3300046472 Bacteria 5914
637 Ga0495580_0020936 3300046472 Unclassified 4830
638 Ga0495580_0042229 3300046472 Bacteria 3249
639 Ga0495580_0052133 3300046472 Bacteria 2890
640 Ga0495582_0002444 3300046473 Bacteria 10357
641 Ga0495582_0009610 3300046473 Bacteria 5325
642 Ga0495664_0004337 3300046477 Bacteria 7747
643 Ga0495584_0033049 3300046491 Bacteria 2617
644 Ga0495594_0169180 3300046499 Unclassified 1243
645 Ga0495630_0051919 3300046517 Bacteria 3069
646 Ga0495630_0057160 3300046517 Bacteria 2924
647 Ga0495630_0058096 3300046517 Unclassified 2900
648 Ga0495665_0011829 3300046531 Unclassified 4727
649 Ga0495665_0015425 3300046531 Bacteria 4114
650 Ga0495586_0087823 3300046535 Unclassified 1715
651 Ga0495587_0168176 3300046536 Unclassified 1246
652 Ga0495667_0169090 3300046559 Bacteria 1405
653 Ga0495635_0099927 3300046663 Bacteria 1983
654 Ga0495659_0029165 3300046664 Bacteria 1914
655 Ga0495658_0010837 3300046683 Bacteria 4566
656 Ga0495669_0055070 3300046684 Bacteria 1791
657 Ga0495674_0002665 3300047319 Bacteria 17375
658 Ga0495674_0036922 3300047319 Unclassified 4393
659 Ga0495675_0027741 3300047444 Bacteria 3609
660 Ga0495602_0222648 3300048088 Unclassified 1423
661 Ga0495602_0224410 3300048088 Bacteria 1416
662 Ga0496100_0002390 3300048903 Bacteria 9503
663 Ga0496100_0037483 3300048903 Bacteria 3066
664 Ga0496100_0170954 3300048903 Unclassified 1565
665 Ga0496101_0058219 3300048904 Bacteria 2797
666 Ga0496101_0189664 3300048904 Unclassified 1586
667 Ga0496101_0228068 3300048904 Unclassified 1447
668 Ga0496102_0009005 3300048905 Bacteria 8568
669 Ga0496102_0148478 3300048905 Unclassified 2201
670 Ga0496102_0340984 3300048905 Bacteria 1411
671 Ga0496103_0053574 3300048906 Bacteria 2501
672 Ga0496104_0015789 3300048907 Bacteria 6850
673 Ga0496104_0027801 3300048907 Bacteria 5236
674 Ga0496104_0282382 3300048907 Bacteria 1573
675 Ga0496105_0201103 3300048908 Bacteria 1626
676 Ga0496105_0235758 3300048908 Unclassified 1486
677 Ga0496106_0032719 3300048909 Unclassified 3879
678 Ga0496106_0051122 3300048909 Bacteria 3116
679 Ga0496106_0105896 3300048909 Unclassified 2185
680 Ga0496108_0000605 3300048911 Bacteria 28095
681 Ga0496109_0000749 3300048912 Bacteria 27009
682 Ga0496109_0192169 3300048912 Bacteria 1918
683 Ga0496110_0001050 3300048913 Bacteria 19502
684 Ga0496110_0045530 3300048913 Unclassified 3835
685 Ga0496111_0009969 3300048914 Bacteria 6355
686 Ga0496112_0000399 3300048915 Bacteria 28374
687 Ga0496112_0001655 3300048915 Bacteria 17320
688 Ga0496112_0003294 3300048915 Bacteria 13329
689 Ga0496112_0021217 3300048915 Bacteria 6174
690 Ga0496112_0258934 3300048915 Bacteria 1689
691 Ga0496113_0000468 3300048916 Bacteria 19787
692 Ga0496113_0020271 3300048916 Bacteria 4672
693 Ga0496114_0015710 3300048917 Bacteria 6091
694 Ga0496115_0004144 3300048918 Bacteria 10466
695 Ga0496115_0019372 3300048918 Bacteria 5234
696 Ga0501083_0100248 3300049744 Bacteria 1910
697 Ga0501083_0148644 3300049744 Bacteria 1534
698 nmdc:mga0n895_1448_c1 3300050512 Bacteria 17728
699 nmdc:mga0n895_194_c1 3300050512 Bacteria 37839
700 nmdc:mga0n895_2844_c1 3300050512 Bacteria 13712
701 nmdc:mga0rr50_122273_c1 3300050513 Bacteria 2074
702 nmdc:mga0rr50_1647_c1 3300050513 Bacteria 12304
703 nmdc:mga0rr50_410_c1 3300050513 Bacteria 23330
704 nmdc:mga08x19_135245_c1 3300050514 Unclassified 1661
705 nmdc:mga08x19_14839_c1 3300050514 Unclassified 4731
706 nmdc:mga08x19_2739_c1 3300050514 Bacteria 10644
707 nmdc:mga08x19_73045_c1 3300050514 Unclassified 2238
708 nmdc:mga08x19_80522_c1 3300050514 Bacteria 2137
709 nmdc:mga0a205_11064_c1 3300050515 Bacteria 6692
710 nmdc:mga0a205_20440_c1 3300050515 Bacteria 6246
711 Ga0495612_0094099 3300053078 Bacteria 1272
712 Ga0466962_0083840 3300061719 Unclassified 1525
713 Ga0070713_100077919
714 MBSR1b_contig_1721814
715 LJNas_1000068
716 JGI24752J21851_1001651
717 JGI24737J22298_10011780
718 JGI24743J22301_10015246
719 JGI24034J26672_10001971
720 JGI24751J29686_10003861
721 rootL2_10297114
722 Ga0065712_10093816
723 Ga0065715_10144766
724 Ga0070676_10013218
725 Ga0070676_10030559
726 Ga0070683_100005697
727 Ga0070683_100024184
728 Ga0070683_100045301
729 Ga0070683_100365604
730 Ga0070690_100017896
731 Ga0070690_100128369
732 Ga0070670_100003453
733 Ga0070670_100014577
734 Ga0068869_100001697
735 Ga0068869_100013410
736 Ga0070666_10015704
737 Ga0070666_10025337
738 Ga0070680_100213985
739 Ga0070680_100296233
740 Ga0070682_100018815
741 Ga0068868_100002852
742 Ga0068868_100013787
743 Ga0068868_100092520
744 Ga0070660_100006500
745 Ga0070660_100035673
746 Ga0070660_100162774
747 Ga0070689_100006512
748 Ga0070689_100193240
749 Ga0070691_10097699
750 Ga0070687_100043771
751 Ga0070687_100074674
752 Ga0070661_100015178
753 Ga0070661_100045631
754 Ga0070668_100011344
755 Ga0070669_100013115
756 Ga0070669_100092672
757 Ga0070675_100076229
758 Ga0070675_100087836
759 Ga0070671_100048959
760 Ga0070671_100192808
761 Ga0070674_100097347
762 Ga0070673_100035010
763 Ga0070688_100002680
764 Ga0070688_100079167
765 Ga0070659_100003497
766 Ga0070667_100204659
767 Ga0070667_100257931
768 Ga0070709_10005788
769 Ga0070709_10046988
770 Ga0070709_10050621
771 Ga0070709_10114783
772 Ga0070709_10117046
773 Ga0070709_10155224
774 Ga0070709_10222700
775 Ga0070714_100000069
776 Ga0070714_100002836
777 Ga0070714_100009246
778 Ga0070714_100010671
779 Ga0070714_100060682
780 Ga0070713_100000432
781 Ga0070713_100004168
782 Ga0070713_100015996
783 Ga0070713_100033020
784 Ga0070713_100038249
785 Ga0070713_100045351
786 Ga0070713_100162784
787 Ga0070713_100177584
788 Ga0070713_100250601
789 Ga0070713_100283995
790 Ga0070710_10002730
791 Ga0070710_10018901
792 Ga0070710_10035148
793 Ga0070710_10047859
794 Ga0070710_10050340
795 Ga0070710_10086402
796 Ga0070710_10111427
797 Ga0070710_10201400
798 Ga0070711_100000340
799 Ga0070711_100001263
800 Ga0070711_100009672
801 Ga0070711_100019911
802 Ga0070711_100024778
803 Ga0070711_100036060
804 Ga0070711_100080308
805 Ga0070700_100030985
806 Ga0070708_100001602
807 Ga0070708_100003146
808 Ga0070708_100003488
809 Ga0070708_100004955
810 Ga0070708_100015660
811 Ga0070708_100095672
812 Ga0070708_100103560
813 Ga0070708_100163350
814 Ga0070663_100004820
815 Ga0070663_100093588
816 Ga0070678_100001279
817 Ga0070662_100016350
818 Ga0070662_100070338
819 Ga0070681_10000988
820 Ga0070681_10012121
821 Ga0070681_10026962
822 Ga0070681_10247551
823 Ga0068867_100005388
824 Ga0068867_100017345
825 Ga0068867_100059384
826 Ga0068867_100100981
827 Ga0070685_10006488
828 Ga0070706_100000499
829 Ga0070706_100006009
830 Ga0070706_100010487
831 Ga0070706_100029859
832 Ga0070706_100087439
833 Ga0070707_100006096
834 Ga0070707_100023364
835 Ga0070707_100029235
836 Ga0070707_100041410
837 Ga0070698_100001333
838 Ga0070698_100093902
839 Ga0070699_100001027
840 Ga0070699_100008978
841 Ga0070699_100026520
842 Ga0070699_100048802
843 Ga0070699_100048858
844 Ga0070679_100017175
845 Ga0070679_100074052
846 Ga0070679_100173580
847 Ga0070684_100006948
848 Ga0070684_100020470
849 Ga0070684_100060294
850 Ga0070684_100066145
851 Ga0070684_100103423
852 Ga0070697_100000237
853 Ga0070697_100000345
854 Ga0070697_100005318
855 Ga0070697_100005514
856 Ga0070697_100034477
857 Ga0068853_100007763
858 Ga0068853_100008970
859 Ga0068853_100132065
860 Ga0068853_100148208
861 Ga0068853_100172863
862 Ga0070672_100003170
863 Ga0070686_100070320
864 Ga0070693_100049870
865 Ga0070693_100064655
866 Ga0070665_100171339
867 Ga0070665_100341878
868 Ga0068855_100000440
869 Ga0068855_100001467
870 Ga0068855_100028962
871 Ga0068855_100092660
872 Ga0068855_100243518
873 Ga0070664_100000079
874 Ga0070664_100020164
875 Ga0070664_100110929
876 Ga0068857_100005472
877 Ga0068857_100014158
878 Ga0068857_100313107
879 Ga0068854_100023351
880 Ga0068854_100039340
881 Ga0068854_100043980
882 Ga0068854_100123180
883 Ga0068856_100000314
884 Ga0068856_100000884
885 Ga0068856_100001689
886 Ga0068856_100002427
887 Ga0068856_100005971
888 Ga0068856_100012736
889 Ga0068856_100021784
890 Ga0068856_100039877
891 Ga0068856_100097053
892 Ga0068856_100240129
893 Ga0070702_100009303
894 Ga0068852_100025232
895 Ga0068852_100124241
896 Ga0068852_100144560
897 Ga0068859_100000743
898 Ga0068859_100057749
899 Ga0068859_100068455
900 Ga0068864_100001188
901 Ga0068864_100018692
902 Ga0068866_10000598
903 Ga0068866_10004876
904 Ga0068861_100007953
905 Ga0068861_100107557
906 Ga0068861_100431345
907 Ga0068851_10063885
908 Ga0068870_10004535
909 Ga0068870_10004937
910 Ga0068863_100013078
911 Ga0068863_100013754
912 Ga0068863_100017153
913 Ga0068863_100117898
914 Ga0068858_100007110
915 Ga0068858_100010215
916 Ga0068858_100010361
917 Ga0068858_100023370
918 Ga0068858_100053973
919 Ga0068858_100100969
920 Ga0068860_100029714
921 Ga0068862_100028772
922 Ga0068862_100094370
923 Ga0081455_10233363
924 Ga0081540_1062394
925 Ga0070717_10000535
926 Ga0070717_10000774
927 Ga0070717_10001917
928 Ga0070717_10001986
929 Ga0070717_10002964
930 Ga0070717_10003179
931 Ga0070717_10005116
932 Ga0070717_10009302
933 Ga0070717_10053757
934 Ga0070717_10134131
935 Ga0070717_10241720
936 Ga0070717_10469326
937 Ga0070715_10004537
938 Ga0070716_100000792
939 Ga0070716_100000963
940 Ga0070716_100002978
941 Ga0070716_100003222
942 Ga0070712_100000042
943 Ga0070712_100001489
944 Ga0070712_100018579
945 Ga0070712_100221985
946 Ga0097621_100000088
947 Ga0097621_100000731
948 Ga0097621_100016919
949 Ga0097621_100018541
950 Ga0097621_100028548
951 Ga0097621_100055485
952 Ga0097621_100189522
953 Ga0068871_100000266
954 Ga0068871_100000428
955 Ga0068871_100001484
956 Ga0068871_100027364
957 Ga0068871_100046773
958 Ga0075433_10026059
959 Ga0075433_10043002
960 Ga0075434_100000123
961 Ga0075434_100005455
962 Ga0075434_100020739
963 Ga0068865_100012574
964 Ga0068865_100021538
965 Ga0075436_100082065
966 Ga0075436_100151389
967 Ga0097620_100000743
968 Ga0097620_100057750
969 Ga0097620_100068461
970 Ga0075435_100000170
971 Ga0075435_100047396
972 Ga0075435_100072434
973 Ga0105240_10004147
974 Ga0105240_10005076
975 Ga0105240_10029627
976 Ga0105240_10089835
977 Ga0105240_10102427
978 Ga0105240_10105918
979 Ga0105240_10210921
980 Ga0105240_10491743
981 Ga0111539_10238232
982 Ga0105245_10006526
983 Ga0105245_10032318
984 Ga0105245_10078898
985 Ga0105247_10009548
986 Ga0105247_10098251
987 Ga0105247_10140927
988 Ga0105243_10015615
989 Ga0105243_10155596
990 Ga0105241_10001732
991 Ga0105241_10005799
992 Ga0105241_10017495
993 Ga0105241_10028999
994 Ga0105241_10062460
995 Ga0105241_10135425
996 Ga0105241_10239519
997 Ga0105242_10011382
998 Ga0105242_10058540
999 Ga0105242_10095067
1000 Ga0105242_10099448
1001 Ga0105248_10002754
1002 Ga0105248_10056144
1003 Ga0105248_10101957
1004 Ga0105248_10194298
1005 Ga0105237_10010940
1006 Ga0105237_10016208
1007 Ga0105237_10269109
1008 Ga0105237_10290302
1009 Ga0105238_10001256
1010 Ga0105238_10029280
1011 Ga0105238_10048212
1012 Ga0105249_10019161
1013 Ga0105249_10032850
1014 Ga0105249_10078747
1015 Ga0099796_10005997
1016 Ga0105239_10007204
1017 Ga0105239_10009713
1018 Ga0105239_10047871
1019 Ga0105239_10048717
1020 Ga0105239_10083446
1021 Ga0105239_10155424
1022 Ga0105246_10008559
1023 Ga0105246_10009350
1024 Ga0105246_10020579
1025 Ga0157373_10000869
1026 Ga0157373_10025837
1027 Ga0157373_10035233
1028 Ga0157373_10179584
1029 Ga0157371_10027867
1030 Ga0157371_10060933
1031 Ga0157370_10063358
1032 Ga0157369_10000196
1033 Ga0157369_10030283
1034 Ga0157369_10043009
1035 Ga0157369_10056780
1036 Ga0157369_10087561
1037 Ga0157369_10103711
1038 Ga0157369_10136272
1039 Ga0157374_10000989
1040 Ga0157374_10001078
1041 Ga0157374_10001572
1042 Ga0157374_10003563
1043 Ga0157374_10031960
1044 Ga0157374_10194153
1045 Ga0157374_10196670
1046 Ga0157378_10000057
1047 Ga0157378_10000058
1048 Ga0157378_10004484
1049 Ga0157378_10087649
1050 Ga0157378_10200557
1051 Ga0163162_10028765
1052 Ga0163162_10128200
1053 Ga0163162_10461708
1054 Ga0157372_10000200
1055 Ga0157372_10000379
1056 Ga0157372_10003854
1057 Ga0157372_10004695
1058 Ga0157372_10006238
1059 Ga0157372_10012309
1060 Ga0157372_10034567
1061 Ga0157372_10045541
1062 Ga0157375_10018772
1063 Ga0157375_10085629
1064 Ga0157375_10091066
1065 Ga0163163_10008354
1066 Ga0163163_10035017
1067 Ga0182008_10003836
1068 Ga0182008_10028083
1069 Ga0157377_10000586
1070 Ga0157379_10002438
1071 Ga0157379_10006714
1072 Ga0157379_10051045
1073 Ga0157379_10217281
1074 Ga0157379_10277088
1075 Ga0157376_10003037
1076 Ga0157376_10025014
1077 Ga0157376_10039227
1078 Ga0157376_10067173
1079 Ga0157376_10172932
1080 Ga0157376_10184465
1081 Ga0182006_1009258
1082 Ga0182006_1010681
1083 Ga0182007_10003201
1084 Ga0163161_10001547
1085 Ga0224570_100448
1086 Ga0224572_1005230
1087 Ga0224572_1008971
1088 Ga0228598_1000482
1089 Ga0228598_1000734
1090 Ga0207656_10011131
1091 Ga0207682_10051808
1092 Ga0207692_10001160
1093 Ga0207692_10002644
1094 Ga0207692_10005161
1095 Ga0207642_10096855
1096 Ga0207710_10005097
1097 Ga0207680_10017425
1098 Ga0207680_10129025
1099 Ga0207647_10003396
1100 Ga0207647_10013377
1101 Ga0207685_10050906
1102 Ga0207699_10011839
1103 Ga0207699_10014346
1104 Ga0207699_10015643
1105 Ga0207699_10021495
1106 Ga0207699_10036152
1107 Ga0207699_10143950
1108 Ga0207699_10155135
1109 Ga0207645_10000551
1110 Ga0207645_10054517
1111 Ga0207643_10005881
1112 Ga0207684_10002771
1113 Ga0207684_10003513
1114 Ga0207684_10008622
1115 Ga0207684_10025610
1116 Ga0207684_10071885
1117 Ga0207684_10113344
1118 Ga0207654_10047941
1119 Ga0207654_10055058
1120 Ga0207707_10000617
1121 Ga0207707_10002456
1122 Ga0207707_10150309
1123 Ga0207695_10005582
1124 Ga0207695_10016407
1125 Ga0207695_10026809
1126 Ga0207695_10041882
1127 Ga0207695_10075460
1128 Ga0207695_10088028
1129 Ga0207693_10000010
1130 Ga0207693_10000076
1131 Ga0207693_10000689
1132 Ga0207693_10003255
1133 Ga0207693_10037974
1134 Ga0207693_10068427
1135 Ga0207693_10241327
1136 Ga0207663_10000541
1137 Ga0207663_10005938
1138 Ga0207663_10014476
1139 Ga0207663_10018035
1140 Ga0207663_10049676
1141 Ga0207663_10068199
1142 Ga0207663_10072953
1143 Ga0207663_10149992
1144 Ga0207660_10174946
1145 Ga0207662_10000359
1146 Ga0207657_10006439
1147 Ga0207657_10009009
1148 Ga0207657_10014017
1149 Ga0207649_10000546
1150 Ga0207652_10008089
1151 Ga0207652_10015654
1152 Ga0207646_10002047
1153 Ga0207646_10010353
1154 Ga0207646_10016435
1155 Ga0207646_10020901
1156 Ga0207646_10036059
1157 Ga0207646_10036812
1158 Ga0207681_10037905
1159 Ga0207681_10211963
1160 Ga0207694_10033298
1161 Ga0207694_10043723
1162 Ga0207694_10052747
1163 Ga0207694_10157742
1164 Ga0207650_10000045
1165 Ga0207650_10028985
1166 Ga0207650_10099273
1167 Ga0207659_10019123
1168 Ga0207687_10044178
1169 Ga0207687_10172849
1170 Ga0207700_10000121
1171 Ga0207700_10002500
1172 Ga0207700_10014223
1173 Ga0207700_10022051
1174 Ga0207700_10024805
1175 Ga0207700_10066685
1176 Ga0207700_10083429
1177 Ga0207700_10112523
1178 Ga0207700_10126947
1179 Ga0207700_10153648
1180 Ga0207700_10234552
1181 Ga0207664_10000084
1182 Ga0207664_10001858
1183 Ga0207664_10026317
1184 Ga0207664_10148899
1185 Ga0207664_10165530
1186 Ga0207664_10328887
1187 Ga0207644_10018085
1188 Ga0207690_10162875
1189 Ga0207706_10001067
1190 Ga0207706_10001085
1191 Ga0207706_10015387
1192 Ga0207686_10022874
1193 Ga0207686_10098383
1194 Ga0207670_10004567
1195 Ga0207669_10160041
1196 Ga0207704_10043852
1197 Ga0207665_10001046
1198 Ga0207665_10001295
1199 Ga0207665_10003917
1200 Ga0207665_10015791
1201 Ga0207665_10074790
1202 Ga0207691_10001782
1203 Ga0207691_10146285
1204 Ga0207711_10018805
1205 Ga0207711_10018874
1206 Ga0207689_10000185
1207 Ga0207689_10001473
1208 Ga0207689_10006133
1209 Ga0207689_10092321
1210 Ga0207661_10000131
1211 Ga0207661_10036911
1212 Ga0207661_10056239
1213 Ga0207661_10083674
1214 Ga0207679_10000283
1215 Ga0207679_10000766
1216 Ga0207679_10170642
1217 Ga0207667_10001753
1218 Ga0207667_10017467
1219 Ga0207667_10059895
1220 Ga0207668_10080213
1221 Ga0207668_10087758
1222 Ga0207640_10024085
1223 Ga0207640_10042696
1224 Ga0207658_10202386
1225 Ga0207677_10004651
1226 Ga0207677_10197503
1227 Ga0207677_10236038
1228 Ga0207703_10013381
1229 Ga0207703_10033938
1230 Ga0207703_10061950
1231 Ga0207703_10075567
1232 Ga0207639_10006272
1233 Ga0207639_10013564
1234 Ga0207639_10049256
1235 Ga0207639_10071785
1236 Ga0207639_10317586
1237 Ga0207678_10001378
1238 Ga0207678_10001488
1239 Ga0207702_10001299
1240 Ga0207702_10010170
1241 Ga0207702_10024223
1242 Ga0207702_10051469
1243 Ga0207702_10055582
1244 Ga0207702_10397618
1245 Ga0207641_10000021
1246 Ga0207641_10009919
1247 Ga0207641_10041494
1248 Ga0207641_10126250
1249 Ga0207641_10313637
1250 Ga0207648_10000611
1251 Ga0207648_10052073
1252 Ga0207648_10053626
1253 Ga0207648_10130469
1254 Ga0207676_10000096
1255 Ga0207676_10005664
1256 Ga0207674_10000246
1257 Ga0207674_10043972
1258 Ga0207674_10107936
1259 Ga0207674_10133865
1260 Ga0207675_100007864
1261 Ga0207675_100035294
1262 Ga0207683_10001457
1263 Ga0207698_10120102
1264 Ga0207698_10125337
1265 Ga0207698_10278271
1266 Ga0265354_1001671
1267 Ga0265356_1001344
1268 Ga0268266_10005064
1269 Ga0268266_10422668
1270 Ga0268265_10003076
1271 Ga0268265_10087263
1272 Ga0268264_10010583
1273 Ga0268264_10065933
1274 Ga0265338_10001963
1275 Ga0265338_10022202
1276 Ga0265762_1007636
1277 Ga0265770_1005094
1278 Ga0265760_10001472
1279 Ga0265760_10002452
1280 Ga0265760_10003647
1281 Ga0265760_10005687
1282 Ga0265760_10006535
1283 Ga0265330_10008453
1284 Ga0265340_10016675
1285 Ga0265339_10028080
1286 Ga0265339_10052979
1287 Ga0265316_10001005
1288 Ga0265316_10026308
1289 Ga0265314_10001994
1290 Ga0265314_10032997
1291 Ga0307409_100009469
1292 Ga0307416_100061448
1293 Ga0307415_100003240
1294 Ga0373934_0017088
1295 Ga0373951_0013764
1296 Ga0373923_0030100
1297 Ga0373923_0085172
1298 Ga0373936_0004722
1299 Ga0373936_0006650
1300 Ga0373945_0026742
1301 Ga0373953_0027024
1302 Ga0373954_0015186
1303 Ga0373956_0129617
1304 Ga0373957_0019856
1305 Ga0373943_0000009
1306 Ga0373943_0010538
1307 Ga0373946_0003102
1308 Ga0373946_0016178
1309 Ga0373924_0016665
1310 Ga0373931_0008667
1311 Ga0373931_0055051
1312 Ga0373935_0015339
1313 Ga0373935_0046653
1314 Ga0373927_0000539
1315 Ga0373927_0014597
1316 Ga0373927_0017759
1317 Ga0373927_0054534
1318 Ga0373927_0109676
1319 Ga0373933_0041793
1320 Ga0373947_0049530
1321 Ga0373947_0093405
1322 Ga0373947_0169723
1323 Ga0373937_0006927
1324 Ga0373937_0008946
1325 Ga0373937_0149471
1326 Ga0373925_0001229
1327 Ga0373925_0001274
1328 Ga0373925_0005162
1329 Ga0373925_0018740
1330 Ga0373925_0217571
1331 Ga0373925_0335984
1332 Ga0436363_0070523
1333 Ga0466966_0207109
1334 Ga0466961_0048378
1335 Ga0466963_0088960
1336 Ga0466971_0097512
1337 Ga0466957_0037338
1338 Ga0451576_0346997
1339 Ga0466967_0051306
1340 Ga0495629_0008433
1341 Ga0495580_0001237
1342 Ga0495580_0001858
1343 Ga0495580_0002538
1344 Ga0495580_0003245
1345 Ga0495580_0004308
1346 Ga0495580_0004470
1347 Ga0495580_0005568
1348 Ga0495580_0014786
1349 Ga0495580_0020936
1350 Ga0495580_0042229
1351 Ga0495580_0052133
1352 Ga0495582_0002444
1353 Ga0495582_0009610
1354 Ga0495664_0004337
1355 Ga0495584_0033049
1356 Ga0495594_0169180
1357 Ga0495630_0051919
1358 Ga0495630_0057160
1359 Ga0495630_0058096
1360 Ga0495665_0011829
1361 Ga0495665_0015425
1362 Ga0495586_0087823
1363 Ga0495587_0168176
1364 Ga0495667_0169090
1365 Ga0495635_0099927
1366 Ga0495659_0029165
1367 Ga0495658_0010837
1368 Ga0495669_0055070
1369 Ga0495674_0002665
1370 Ga0495674_0036922
1371 Ga0495675_0027741
1372 Ga0495602_0222648
1373 Ga0495602_0224410
1374 Ga0496100_0002390
1375 Ga0496100_0037483
1376 Ga0496100_0170954
1377 Ga0496101_0058219
1378 Ga0496101_0189664
1379 Ga0496101_0228068
1380 Ga0496102_0009005
1381 Ga0496102_0148478
1382 Ga0496102_0340984
1383 Ga0496103_0053574
1384 Ga0496104_0015789
1385 Ga0496104_0027801
1386 Ga0496104_0282382
1387 Ga0496105_0201103
1388 Ga0496105_0235758
1389 Ga0496106_0032719
1390 Ga0496106_0051122
1391 Ga0496106_0105896
1392 Ga0496108_0000605
1393 Ga0496109_0000749
1394 Ga0496109_0192169
1395 Ga0496110_0001050
1396 Ga0496110_0045530
1397 Ga0496111_0009969
1398 Ga0496112_0000399
1399 Ga0496112_0001655
1400 Ga0496112_0003294
1401 Ga0496112_0021217
1402 Ga0496112_0258934
1403 Ga0496113_0000468
1404 Ga0496113_0020271
1405 Ga0496114_0015710
1406 Ga0496115_0004144
1407 Ga0496115_0019372
1408 Ga0501083_0100248
1409 Ga0501083_0148644
1410 nmdc:mga0n895_1448_c1
1411 nmdc:mga0n895_194_c1
1412 nmdc:mga0n895_2844_c1
1413 nmdc:mga0rr50_122273_c1
1414 nmdc:mga0rr50_1647_c1
1415 nmdc:mga0rr50_410_c1
1416 nmdc:mga08x19_135245_c1
1417 nmdc:mga08x19_14839_c1
1418 nmdc:mga08x19_2739_c1
1419 nmdc:mga08x19_73045_c1
1420 nmdc:mga08x19_80522_c1
1421 nmdc:mga0a205_11064_c1
1422 nmdc:mga0a205_20440_c1
1423 Ga0495612_0094099
1424 Ga0466962_0083840

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

18

272

0.85

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

19

188

0.84

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

19

194

0.63

Structural Annotation

Top 5 Hits

ID Description Score Start End
1db3-assembly1.cif.gz_A-2 e.coli gdp-mannose 4,6-dehydratase 0.8111 6 277
2q1w-assembly1.cif.gz_C crystal structure of the bordetella bronchiseptica enzyme wbmh in complex with nad+ 0.7876 6 347
3sc6-assembly5.cif.gz_E 2.65 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose reductase (rfbd) from bacillus anthracis str. ames in complex with nadp 0.7862 5 348
3m2p-assembly1.cif.gz_B the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.7858 6 348
3vvb-assembly1.cif.gz_A crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in apo form 0.7835 5 278
ID Description Score Start End Superfamily
af_P9WKT3_23_337_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.874 6 349 3.40.50.720
af_P9WKT3_23_337_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8687 6 349 3.40.50.720
4id9A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8411 8 263 3.40.50.720
1rkxC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8289 6 178 3.40.50.720
6dntA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8273 5 262 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V9XWG6-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9907 85 349
AF-A0A2V7WSS9-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9898 5 350
AF-A0A2V9TM98-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9881 61 349
AF-A0A2V9V760-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9818 1 246
AF-A0A2V7WSS9-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9758 5 350

Map