F476817
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 712 | 266 | 1424 | 354 |
Family's Representative Sequence
| Representative Sequence | 3300005436|Ga0070713_100077919|Ga0070713_1000779192 |
| Length | 373 |
| Sequence | VCYDFSQPQSMTQGKPTVVVTGVSGNLGLRLLPHLAEFSVIGIDIAAPKTDAPIRFVRMDLGVEDSCRSLYNLFKETRPFSVVHLAFVIDPVRTGVIDVDQMWHINVAGTARVMEAITEANRNEDSGIRQFVYPSSVSVYGPDLPGPVLEDFALDAHTLPYAVHKRESDRVVQQRAPALRGCSAYVLRPHIFAGASVDNYLIGAFRGSPNGKGKRAAQMRQQGKRLPCMLPYGQRYLDNQIQFVHVDDMARLLAWILTREPEARRLTILNVAGRGEPLTFAQCIEMAHAKLIRVPGQWGMRIVLEFLWKFGISAIPPDAVPYMSGQYIMNTDRLKKFLGDDYEKVIRYTVADAFADSFKAPAPVGEAQKLAVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 8 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 122 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 123 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 124 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 184 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 185 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 190 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 191 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 192 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 193 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 194 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 196 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 198 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 199 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 200 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 202 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 204 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 209 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 210 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 212 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 215 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 216 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 217 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 220 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 221 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 222 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 223 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 224 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 225 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 226 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 227 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 248 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 249 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 250 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 251 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 252 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 255 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 256 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 257 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 258 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 259 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 260 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.02 |
| Metatranscriptomes | 0.98 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.78 |
| Rhizosphere | 94.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 21.63 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070713_100077919 | 3300005436 | Unclassified | 2820 |
| 2 | MBSR1b_contig_1721814 | 2162886012 | Bacteria | 2865 |
| 3 | LJNas_1000068 | 3300000546 | Bacteria | 14265 |
| 4 | JGI24752J21851_1001651 | 3300001976 | Bacteria | 2993 |
| 5 | JGI24737J22298_10011780 | 3300001990 | Bacteria | 2859 |
| 6 | JGI24743J22301_10015246 | 3300001991 | Bacteria | 1423 |
| 7 | JGI24034J26672_10001971 | 3300002239 | Bacteria | 2780 |
| 8 | JGI24751J29686_10003861 | 3300002459 | Bacteria | 3027 |
| 9 | rootL2_10297114 | 3300003322 | Bacteria | 3833 |
| 10 | Ga0065712_10093816 | 3300005290 | Bacteria | 2278 |
| 11 | Ga0065715_10144766 | 3300005293 | Bacteria | 1803 |
| 12 | Ga0070676_10013218 | 3300005328 | Bacteria | 4521 |
| 13 | Ga0070676_10030559 | 3300005328 | Bacteria | 3073 |
| 14 | Ga0070683_100005697 | 3300005329 | Bacteria | 10406 |
| 15 | Ga0070683_100024184 | 3300005329 | Bacteria | 5438 |
| 16 | Ga0070683_100045301 | 3300005329 | Unclassified | 4059 |
| 17 | Ga0070683_100365604 | 3300005329 | Bacteria | 1374 |
| 18 | Ga0070690_100017896 | 3300005330 | Unclassified | 4272 |
| 19 | Ga0070690_100128369 | 3300005330 | Unclassified | 1710 |
| 20 | Ga0070670_100003453 | 3300005331 | Bacteria | 13117 |
| 21 | Ga0070670_100014577 | 3300005331 | Bacteria | 6750 |
| 22 | Ga0068869_100001697 | 3300005334 | Bacteria | 13164 |
| 23 | Ga0068869_100013410 | 3300005334 | Bacteria | 5451 |
| 24 | Ga0070666_10015704 | 3300005335 | Unclassified | 4833 |
| 25 | Ga0070666_10025337 | 3300005335 | Unclassified | 3865 |
| 26 | Ga0070680_100213985 | 3300005336 | Bacteria | 1626 |
| 27 | Ga0070680_100296233 | 3300005336 | Unclassified | 1371 |
| 28 | Ga0070682_100018815 | 3300005337 | Unclassified | 4044 |
| 29 | Ga0068868_100002852 | 3300005338 | Bacteria | 11984 |
| 30 | Ga0068868_100013787 | 3300005338 | Bacteria | 5939 |
| 31 | Ga0068868_100092520 | 3300005338 | Bacteria | 2437 |
| 32 | Ga0070660_100006500 | 3300005339 | Bacteria | 8108 |
| 33 | Ga0070660_100035673 | 3300005339 | Unclassified | 3765 |
| 34 | Ga0070660_100162774 | 3300005339 | Bacteria | 1798 |
| 35 | Ga0070689_100006512 | 3300005340 | Bacteria | 8096 |
| 36 | Ga0070689_100193240 | 3300005340 | Unclassified | 1658 |
| 37 | Ga0070691_10097699 | 3300005341 | Bacteria | 1455 |
| 38 | Ga0070687_100043771 | 3300005343 | Bacteria | 2277 |
| 39 | Ga0070687_100074674 | 3300005343 | Unclassified | 1831 |
| 40 | Ga0070661_100015178 | 3300005344 | Bacteria | 5435 |
| 41 | Ga0070661_100045631 | 3300005344 | Unclassified | 3204 |
| 42 | Ga0070668_100011344 | 3300005347 | Bacteria | 6639 |
| 43 | Ga0070669_100013115 | 3300005353 | Bacteria | 5889 |
| 44 | Ga0070669_100092672 | 3300005353 | Unclassified | 2268 |
| 45 | Ga0070675_100076229 | 3300005354 | Unclassified | 2789 |
| 46 | Ga0070675_100087836 | 3300005354 | Bacteria | 2600 |
| 47 | Ga0070671_100048959 | 3300005355 | Unclassified | 3516 |
| 48 | Ga0070671_100192808 | 3300005355 | Bacteria | 1727 |
| 49 | Ga0070674_100097347 | 3300005356 | Bacteria | 2137 |
| 50 | Ga0070673_100035010 | 3300005364 | Bacteria | 3805 |
| 51 | Ga0070688_100002680 | 3300005365 | Bacteria | 9041 |
| 52 | Ga0070688_100079167 | 3300005365 | Bacteria | 2122 |
| 53 | Ga0070659_100003497 | 3300005366 | Bacteria | 11186 |
| 54 | Ga0070667_100204659 | 3300005367 | Bacteria | 1752 |
| 55 | Ga0070667_100257931 | 3300005367 | Unclassified | 1560 |
| 56 | Ga0070709_10005788 | 3300005434 | Bacteria | 6699 |
| 57 | Ga0070709_10046988 | 3300005434 | Unclassified | 2687 |
| 58 | Ga0070709_10050621 | 3300005434 | Bacteria | 2603 |
| 59 | Ga0070709_10114783 | 3300005434 | Bacteria | 1815 |
| 60 | Ga0070709_10117046 | 3300005434 | Unclassified | 1800 |
| 61 | Ga0070709_10155224 | 3300005434 | Bacteria | 1586 |
| 62 | Ga0070709_10222700 | 3300005434 | Bacteria | 1346 |
| 63 | Ga0070714_100000069 | 3300005435 | Bacteria | 93567 |
| 64 | Ga0070714_100002836 | 3300005435 | Bacteria | 12794 |
| 65 | Ga0070714_100009246 | 3300005435 | Bacteria | 7743 |
| 66 | Ga0070714_100010671 | 3300005435 | Bacteria | 7269 |
| 67 | Ga0070714_100060682 | 3300005435 | Bacteria | 3246 |
| 68 | Ga0070713_100000432 | 3300005436 | Bacteria | 26764 |
| 69 | Ga0070713_100004168 | 3300005436 | Bacteria | 9645 |
| 70 | Ga0070713_100015996 | 3300005436 | Bacteria | 5629 |
| 71 | Ga0070713_100033020 | 3300005436 | Bacteria | 4142 |
| 72 | Ga0070713_100038249 | 3300005436 | Unclassified | 3885 |
| 73 | Ga0070713_100045351 | 3300005436 | Bacteria | 3602 |
| 74 | Ga0070713_100162784 | 3300005436 | Bacteria | 1993 |
| 75 | Ga0070713_100177584 | 3300005436 | Bacteria | 1912 |
| 76 | Ga0070713_100250601 | 3300005436 | Bacteria | 1615 |
| 77 | Ga0070713_100283995 | 3300005436 | Unclassified | 1519 |
| 78 | Ga0070710_10002730 | 3300005437 | Bacteria | 8401 |
| 79 | Ga0070710_10018901 | 3300005437 | Unclassified | 3553 |
| 80 | Ga0070710_10035148 | 3300005437 | Unclassified | 2731 |
| 81 | Ga0070710_10047859 | 3300005437 | Bacteria | 2387 |
| 82 | Ga0070710_10050340 | 3300005437 | Bacteria | 2335 |
| 83 | Ga0070710_10086402 | 3300005437 | Unclassified | 1842 |
| 84 | Ga0070710_10111427 | 3300005437 | Bacteria | 1644 |
| 85 | Ga0070710_10201400 | 3300005437 | Unclassified | 1257 |
| 86 | Ga0070711_100000340 | 3300005439 | Bacteria | 24038 |
| 87 | Ga0070711_100001263 | 3300005439 | Bacteria | 13724 |
| 88 | Ga0070711_100009672 | 3300005439 | Bacteria | 5941 |
| 89 | Ga0070711_100019911 | 3300005439 | Bacteria | 4315 |
| 90 | Ga0070711_100024778 | 3300005439 | Unclassified | 3919 |
| 91 | Ga0070711_100036060 | 3300005439 | Unclassified | 3312 |
| 92 | Ga0070711_100080308 | 3300005439 | Bacteria | 2322 |
| 93 | Ga0070700_100030985 | 3300005441 | Bacteria | 3201 |
| 94 | Ga0070708_100001602 | 3300005445 | Bacteria | 17338 |
| 95 | Ga0070708_100003146 | 3300005445 | Bacteria | 12861 |
| 96 | Ga0070708_100003488 | 3300005445 | Bacteria | 12311 |
| 97 | Ga0070708_100004955 | 3300005445 | Bacteria | 10526 |
| 98 | Ga0070708_100015660 | 3300005445 | Bacteria | 6267 |
| 99 | Ga0070708_100095672 | 3300005445 | Unclassified | 2712 |
| 100 | Ga0070708_100103560 | 3300005445 | Bacteria | 2609 |
| 101 | Ga0070708_100163350 | 3300005445 | Unclassified | 2076 |
| 102 | Ga0070663_100004820 | 3300005455 | Bacteria | 7954 |
| 103 | Ga0070663_100093588 | 3300005455 | Bacteria | 2230 |
| 104 | Ga0070678_100001279 | 3300005456 | Bacteria | 13335 |
| 105 | Ga0070662_100016350 | 3300005457 | Unclassified | 4981 |
| 106 | Ga0070662_100070338 | 3300005457 | Bacteria | 2578 |
| 107 | Ga0070681_10000988 | 3300005458 | Bacteria | 24052 |
| 108 | Ga0070681_10012121 | 3300005458 | Bacteria | 8551 |
| 109 | Ga0070681_10026962 | 3300005458 | Bacteria | 5777 |
| 110 | Ga0070681_10247551 | 3300005458 | Unclassified | 1695 |
| 111 | Ga0068867_100005388 | 3300005459 | Bacteria | 9048 |
| 112 | Ga0068867_100017345 | 3300005459 | Bacteria | 5114 |
| 113 | Ga0068867_100059384 | 3300005459 | Unclassified | 2835 |
| 114 | Ga0068867_100100981 | 3300005459 | Unclassified | 2203 |
| 115 | Ga0070685_10006488 | 3300005466 | Bacteria | 5966 |
| 116 | Ga0070706_100000499 | 3300005467 | Bacteria | 45986 |
| 117 | Ga0070706_100006009 | 3300005467 | Bacteria | 11472 |
| 118 | Ga0070706_100010487 | 3300005467 | Bacteria | 8600 |
| 119 | Ga0070706_100029859 | 3300005467 | Bacteria | 5021 |
| 120 | Ga0070706_100087439 | 3300005467 | Unclassified | 2889 |
| 121 | Ga0070707_100006096 | 3300005468 | Bacteria | 11241 |
| 122 | Ga0070707_100023364 | 3300005468 | Bacteria | 5849 |
| 123 | Ga0070707_100029235 | 3300005468 | Bacteria | 5247 |
| 124 | Ga0070707_100041410 | 3300005468 | Bacteria | 4409 |
| 125 | Ga0070698_100001333 | 3300005471 | Bacteria | 27479 |
| 126 | Ga0070698_100093902 | 3300005471 | Bacteria | 2979 |
| 127 | Ga0070699_100001027 | 3300005518 | Bacteria | 25921 |
| 128 | Ga0070699_100008978 | 3300005518 | Bacteria | 8658 |
| 129 | Ga0070699_100026520 | 3300005518 | Unclassified | 4996 |
| 130 | Ga0070699_100048802 | 3300005518 | Bacteria | 3664 |
| 131 | Ga0070699_100048858 | 3300005518 | Bacteria | 3661 |
| 132 | Ga0070679_100017175 | 3300005530 | Bacteria | 6999 |
| 133 | Ga0070679_100074052 | 3300005530 | Bacteria | 3396 |
| 134 | Ga0070679_100173580 | 3300005530 | Bacteria | 2128 |
| 135 | Ga0070684_100006948 | 3300005535 | Bacteria | 8791 |
| 136 | Ga0070684_100020470 | 3300005535 | Bacteria | 5489 |
| 137 | Ga0070684_100060294 | 3300005535 | Bacteria | 3318 |
| 138 | Ga0070684_100066145 | 3300005535 | Bacteria | 3173 |
| 139 | Ga0070684_100103423 | 3300005535 | Unclassified | 2548 |
| 140 | Ga0070697_100000237 | 3300005536 | Bacteria | 44549 |
| 141 | Ga0070697_100000345 | 3300005536 | Bacteria | 36544 |
| 142 | Ga0070697_100005318 | 3300005536 | Bacteria | 9892 |
| 143 | Ga0070697_100005514 | 3300005536 | Bacteria | 9753 |
| 144 | Ga0070697_100034477 | 3300005536 | Bacteria | 4081 |
| 145 | Ga0068853_100007763 | 3300005539 | Bacteria | 8605 |
| 146 | Ga0068853_100008970 | 3300005539 | Bacteria | 8057 |
| 147 | Ga0068853_100132065 | 3300005539 | Bacteria | 2236 |
| 148 | Ga0068853_100148208 | 3300005539 | Unclassified | 2111 |
| 149 | Ga0068853_100172863 | 3300005539 | Bacteria | 1955 |
| 150 | Ga0070672_100003170 | 3300005543 | Bacteria | 10631 |
| 151 | Ga0070686_100070320 | 3300005544 | Bacteria | 2288 |
| 152 | Ga0070693_100049870 | 3300005547 | Unclassified | 2390 |
| 153 | Ga0070693_100064655 | 3300005547 | Bacteria | 2136 |
| 154 | Ga0070665_100171339 | 3300005548 | Unclassified | 2172 |
| 155 | Ga0070665_100341878 | 3300005548 | Bacteria | 1501 |
| 156 | Ga0068855_100000440 | 3300005563 | Bacteria | 51346 |
| 157 | Ga0068855_100001467 | 3300005563 | Bacteria | 29462 |
| 158 | Ga0068855_100028962 | 3300005563 | Bacteria | 6625 |
| 159 | Ga0068855_100092660 | 3300005563 | Unclassified | 3484 |
| 160 | Ga0068855_100243518 | 3300005563 | Unclassified | 2008 |
| 161 | Ga0070664_100000079 | 3300005564 | Bacteria | 61393 |
| 162 | Ga0070664_100020164 | 3300005564 | Bacteria | 5489 |
| 163 | Ga0070664_100110929 | 3300005564 | Bacteria | 2394 |
| 164 | Ga0068857_100005472 | 3300005577 | Bacteria | 10830 |
| 165 | Ga0068857_100014158 | 3300005577 | Bacteria | 6946 |
| 166 | Ga0068857_100313107 | 3300005577 | Unclassified | 1448 |
| 167 | Ga0068854_100023351 | 3300005578 | Unclassified | 4223 |
| 168 | Ga0068854_100039340 | 3300005578 | Unclassified | 3331 |
| 169 | Ga0068854_100043980 | 3300005578 | Unclassified | 3168 |
| 170 | Ga0068854_100123180 | 3300005578 | Bacteria | 1971 |
| 171 | Ga0068856_100000314 | 3300005614 | Bacteria | 53174 |
| 172 | Ga0068856_100000884 | 3300005614 | Bacteria | 32074 |
| 173 | Ga0068856_100001689 | 3300005614 | Bacteria | 23073 |
| 174 | Ga0068856_100002427 | 3300005614 | Bacteria | 19176 |
| 175 | Ga0068856_100005971 | 3300005614 | Bacteria | 11986 |
| 176 | Ga0068856_100012736 | 3300005614 | Bacteria | 8142 |
| 177 | Ga0068856_100021784 | 3300005614 | Bacteria | 6229 |
| 178 | Ga0068856_100039877 | 3300005614 | Bacteria | 4611 |
| 179 | Ga0068856_100097053 | 3300005614 | Bacteria | 2936 |
| 180 | Ga0068856_100240129 | 3300005614 | Bacteria | 1827 |
| 181 | Ga0070702_100009303 | 3300005615 | Unclassified | 4806 |
| 182 | Ga0068852_100025232 | 3300005616 | Unclassified | 4814 |
| 183 | Ga0068852_100124241 | 3300005616 | Bacteria | 2367 |
| 184 | Ga0068852_100144560 | 3300005616 | Unclassified | 2205 |
| 185 | Ga0068859_100000743 | 3300005617 | Bacteria | 32840 |
| 186 | Ga0068859_100057749 | 3300005617 | Bacteria | 3908 |
| 187 | Ga0068859_100068455 | 3300005617 | Bacteria | 3584 |
| 188 | Ga0068864_100001188 | 3300005618 | Bacteria | 21660 |
| 189 | Ga0068864_100018692 | 3300005618 | Bacteria | 5792 |
| 190 | Ga0068866_10000598 | 3300005718 | Bacteria | 16433 |
| 191 | Ga0068866_10004876 | 3300005718 | Bacteria | 5510 |
| 192 | Ga0068861_100007953 | 3300005719 | Bacteria | 7296 |
| 193 | Ga0068861_100107557 | 3300005719 | Bacteria | 2230 |
| 194 | Ga0068861_100431345 | 3300005719 | Bacteria | 1177 |
| 195 | Ga0068851_10063885 | 3300005834 | Unclassified | 1891 |
| 196 | Ga0068870_10004535 | 3300005840 | Bacteria | 5984 |
| 197 | Ga0068870_10004937 | 3300005840 | Bacteria | 5778 |
| 198 | Ga0068863_100013078 | 3300005841 | Bacteria | 8006 |
| 199 | Ga0068863_100013754 | 3300005841 | Bacteria | 7800 |
| 200 | Ga0068863_100017153 | 3300005841 | Bacteria | 6945 |
| 201 | Ga0068863_100117898 | 3300005841 | Bacteria | 2530 |
| 202 | Ga0068858_100007110 | 3300005842 | Bacteria | 10866 |
| 203 | Ga0068858_100010215 | 3300005842 | Bacteria | 8907 |
| 204 | Ga0068858_100010361 | 3300005842 | Bacteria | 8830 |
| 205 | Ga0068858_100023370 | 3300005842 | Bacteria | 5759 |
| 206 | Ga0068858_100053973 | 3300005842 | Bacteria | 3717 |
| 207 | Ga0068858_100100969 | 3300005842 | Unclassified | 2691 |
| 208 | Ga0068860_100029714 | 3300005843 | Bacteria | 5258 |
| 209 | Ga0068862_100028772 | 3300005844 | Unclassified | 4680 |
| 210 | Ga0068862_100094370 | 3300005844 | Unclassified | 2610 |
| 211 | Ga0081455_10233363 | 3300005937 | Bacteria | 1356 |
| 212 | Ga0081540_1062394 | 3300005983 | Bacteria | 1770 |
| 213 | Ga0070717_10000535 | 3300006028 | Bacteria | 24038 |
| 214 | Ga0070717_10000774 | 3300006028 | Bacteria | 20927 |
| 215 | Ga0070717_10001917 | 3300006028 | Bacteria | 14536 |
| 216 | Ga0070717_10001986 | 3300006028 | Bacteria | 14301 |
| 217 | Ga0070717_10002964 | 3300006028 | Bacteria | 12068 |
| 218 | Ga0070717_10003179 | 3300006028 | Bacteria | 11734 |
| 219 | Ga0070717_10005116 | 3300006028 | Bacteria | 9568 |
| 220 | Ga0070717_10009302 | 3300006028 | Bacteria | 7384 |
| 221 | Ga0070717_10053757 | 3300006028 | Bacteria | 3320 |
| 222 | Ga0070717_10134131 | 3300006028 | Bacteria | 2131 |
| 223 | Ga0070717_10241720 | 3300006028 | Unclassified | 1592 |
| 224 | Ga0070717_10469326 | 3300006028 | Bacteria | 1136 |
| 225 | Ga0070715_10004537 | 3300006163 | Bacteria | 4567 |
| 226 | Ga0070716_100000792 | 3300006173 | Bacteria | 13578 |
| 227 | Ga0070716_100000963 | 3300006173 | Bacteria | 12483 |
| 228 | Ga0070716_100002978 | 3300006173 | Bacteria | 7895 |
| 229 | Ga0070716_100003222 | 3300006173 | Bacteria | 7658 |
| 230 | Ga0070712_100000042 | 3300006175 | Bacteria | 66639 |
| 231 | Ga0070712_100001489 | 3300006175 | Bacteria | 14297 |
| 232 | Ga0070712_100018579 | 3300006175 | Bacteria | 4519 |
| 233 | Ga0070712_100221985 | 3300006175 | Bacteria | 1497 |
| 234 | Ga0097621_100000088 | 3300006237 | Bacteria | 49698 |
| 235 | Ga0097621_100000731 | 3300006237 | Bacteria | 22963 |
| 236 | Ga0097621_100016919 | 3300006237 | Bacteria | 5528 |
| 237 | Ga0097621_100018541 | 3300006237 | Bacteria | 5319 |
| 238 | Ga0097621_100028548 | 3300006237 | Bacteria | 4398 |
| 239 | Ga0097621_100055485 | 3300006237 | Unclassified | 3235 |
| 240 | Ga0097621_100189522 | 3300006237 | Bacteria | 1780 |
| 241 | Ga0068871_100000266 | 3300006358 | Bacteria | 35937 |
| 242 | Ga0068871_100000428 | 3300006358 | Bacteria | 29019 |
| 243 | Ga0068871_100001484 | 3300006358 | Bacteria | 15731 |
| 244 | Ga0068871_100027364 | 3300006358 | Bacteria | 4459 |
| 245 | Ga0068871_100046773 | 3300006358 | Unclassified | 3486 |
| 246 | Ga0075433_10026059 | 3300006852 | Unclassified | 4946 |
| 247 | Ga0075433_10043002 | 3300006852 | Unclassified | 3921 |
| 248 | Ga0075434_100000123 | 3300006871 | Bacteria | 45651 |
| 249 | Ga0075434_100005455 | 3300006871 | Bacteria | 11589 |
| 250 | Ga0075434_100020739 | 3300006871 | Bacteria | 6378 |
| 251 | Ga0068865_100012574 | 3300006881 | Bacteria | 5332 |
| 252 | Ga0068865_100021538 | 3300006881 | Unclassified | 4193 |
| 253 | Ga0075436_100082065 | 3300006914 | Bacteria | 2236 |
| 254 | Ga0075436_100151389 | 3300006914 | Bacteria | 1633 |
| 255 | Ga0097620_100000743 | 3300006931 | Bacteria | 32840 |
| 256 | Ga0097620_100057750 | 3300006931 | Bacteria | 3908 |
| 257 | Ga0097620_100068461 | 3300006931 | Bacteria | 3584 |
| 258 | Ga0075435_100000170 | 3300007076 | Bacteria | 38099 |
| 259 | Ga0075435_100047396 | 3300007076 | Bacteria | 3450 |
| 260 | Ga0075435_100072434 | 3300007076 | Bacteria | 2815 |
| 261 | Ga0105240_10004147 | 3300009093 | Bacteria | 22200 |
| 262 | Ga0105240_10005076 | 3300009093 | Bacteria | 19734 |
| 263 | Ga0105240_10029627 | 3300009093 | Bacteria | 7126 |
| 264 | Ga0105240_10089835 | 3300009093 | Bacteria | 3756 |
| 265 | Ga0105240_10102427 | 3300009093 | Bacteria | 3479 |
| 266 | Ga0105240_10105918 | 3300009093 | Bacteria | 3412 |
| 267 | Ga0105240_10210921 | 3300009093 | Unclassified | 2270 |
| 268 | Ga0105240_10491743 | 3300009093 | Unclassified | 1366 |
| 269 | Ga0111539_10238232 | 3300009094 | Bacteria | 2118 |
| 270 | Ga0105245_10006526 | 3300009098 | Bacteria | 10246 |
| 271 | Ga0105245_10032318 | 3300009098 | Unclassified | 4633 |
| 272 | Ga0105245_10078898 | 3300009098 | Bacteria | 3005 |
| 273 | Ga0105247_10009548 | 3300009101 | Bacteria | 5887 |
| 274 | Ga0105247_10098251 | 3300009101 | Bacteria | 1869 |
| 275 | Ga0105247_10140927 | 3300009101 | Bacteria | 1580 |
| 276 | Ga0105243_10015615 | 3300009148 | Bacteria | 5741 |
| 277 | Ga0105243_10155596 | 3300009148 | Bacteria | 1965 |
| 278 | Ga0105241_10001732 | 3300009174 | Bacteria | 16560 |
| 279 | Ga0105241_10005799 | 3300009174 | Bacteria | 9118 |
| 280 | Ga0105241_10017495 | 3300009174 | Bacteria | 5271 |
| 281 | Ga0105241_10028999 | 3300009174 | Unclassified | 4125 |
| 282 | Ga0105241_10062460 | 3300009174 | Bacteria | 2872 |
| 283 | Ga0105241_10135425 | 3300009174 | Unclassified | 1999 |
| 284 | Ga0105241_10239519 | 3300009174 | Unclassified | 1533 |
| 285 | Ga0105242_10011382 | 3300009176 | Bacteria | 6839 |
| 286 | Ga0105242_10058540 | 3300009176 | Bacteria | 3159 |
| 287 | Ga0105242_10095067 | 3300009176 | Unclassified | 2515 |
| 288 | Ga0105242_10099448 | 3300009176 | Unclassified | 2462 |
| 289 | Ga0105248_10002754 | 3300009177 | Bacteria | 19526 |
| 290 | Ga0105248_10056144 | 3300009177 | Unclassified | 4417 |
| 291 | Ga0105248_10101957 | 3300009177 | Bacteria | 3235 |
| 292 | Ga0105248_10194298 | 3300009177 | Bacteria | 2286 |
| 293 | Ga0105237_10010940 | 3300009545 | Bacteria | 9628 |
| 294 | Ga0105237_10016208 | 3300009545 | Bacteria | 7750 |
| 295 | Ga0105237_10269109 | 3300009545 | Bacteria | 1707 |
| 296 | Ga0105237_10290302 | 3300009545 | Bacteria | 1638 |
| 297 | Ga0105238_10001256 | 3300009551 | Bacteria | 25520 |
| 298 | Ga0105238_10029280 | 3300009551 | Bacteria | 5610 |
| 299 | Ga0105238_10048212 | 3300009551 | Unclassified | 4294 |
| 300 | Ga0105249_10019161 | 3300009553 | Bacteria | 6102 |
| 301 | Ga0105249_10032850 | 3300009553 | Bacteria | 4696 |
| 302 | Ga0105249_10078747 | 3300009553 | Bacteria | 3058 |
| 303 | Ga0099796_10005997 | 3300010159 | Bacteria | 3080 |
| 304 | Ga0105239_10007204 | 3300010375 | Bacteria | 12783 |
| 305 | Ga0105239_10009713 | 3300010375 | Bacteria | 10818 |
| 306 | Ga0105239_10047871 | 3300010375 | Unclassified | 4686 |
| 307 | Ga0105239_10048717 | 3300010375 | Unclassified | 4646 |
| 308 | Ga0105239_10083446 | 3300010375 | Bacteria | 3519 |
| 309 | Ga0105239_10155424 | 3300010375 | Bacteria | 2554 |
| 310 | Ga0105246_10008559 | 3300011119 | Bacteria | 6293 |
| 311 | Ga0105246_10009350 | 3300011119 | Bacteria | 6040 |
| 312 | Ga0105246_10020579 | 3300011119 | Unclassified | 4234 |
| 313 | Ga0157373_10000869 | 3300013100 | Bacteria | 23380 |
| 314 | Ga0157373_10025837 | 3300013100 | Unclassified | 4245 |
| 315 | Ga0157373_10035233 | 3300013100 | Bacteria | 3594 |
| 316 | Ga0157373_10179584 | 3300013100 | Bacteria | 1490 |
| 317 | Ga0157371_10027867 | 3300013102 | Unclassified | 4094 |
| 318 | Ga0157371_10060933 | 3300013102 | Bacteria | 2675 |
| 319 | Ga0157370_10063358 | 3300013104 | Bacteria | 3503 |
| 320 | Ga0157369_10000196 | 3300013105 | Bacteria | 84536 |
| 321 | Ga0157369_10030283 | 3300013105 | Bacteria | 5970 |
| 322 | Ga0157369_10043009 | 3300013105 | Unclassified | 4925 |
| 323 | Ga0157369_10056780 | 3300013105 | Bacteria | 4224 |
| 324 | Ga0157369_10087561 | 3300013105 | Unclassified | 3325 |
| 325 | Ga0157369_10103711 | 3300013105 | Bacteria | 3029 |
| 326 | Ga0157369_10136272 | 3300013105 | Bacteria | 2599 |
| 327 | Ga0157374_10000989 | 3300013296 | Bacteria | 24633 |
| 328 | Ga0157374_10001078 | 3300013296 | Bacteria | 23634 |
| 329 | Ga0157374_10001572 | 3300013296 | Bacteria | 19190 |
| 330 | Ga0157374_10003563 | 3300013296 | Bacteria | 13110 |
| 331 | Ga0157374_10031960 | 3300013296 | Unclassified | 4788 |
| 332 | Ga0157374_10194153 | 3300013296 | Bacteria | 1986 |
| 333 | Ga0157374_10196670 | 3300013296 | Bacteria | 1973 |
| 334 | Ga0157378_10000057 | 3300013297 | Bacteria | 96589 |
| 335 | Ga0157378_10000058 | 3300013297 | Bacteria | 96172 |
| 336 | Ga0157378_10004484 | 3300013297 | Bacteria | 12259 |
| 337 | Ga0157378_10087649 | 3300013297 | Bacteria | 2823 |
| 338 | Ga0157378_10200557 | 3300013297 | Bacteria | 1887 |
| 339 | Ga0163162_10028765 | 3300013306 | Bacteria | 5501 |
| 340 | Ga0163162_10128200 | 3300013306 | Unclassified | 2645 |
| 341 | Ga0163162_10461708 | 3300013306 | Bacteria | 1401 |
| 342 | Ga0157372_10000200 | 3300013307 | Bacteria | 66086 |
| 343 | Ga0157372_10000379 | 3300013307 | Bacteria | 49273 |
| 344 | Ga0157372_10003854 | 3300013307 | Bacteria | 16121 |
| 345 | Ga0157372_10004695 | 3300013307 | Bacteria | 14508 |
| 346 | Ga0157372_10006238 | 3300013307 | Bacteria | 12676 |
| 347 | Ga0157372_10012309 | 3300013307 | Bacteria | 9116 |
| 348 | Ga0157372_10034567 | 3300013307 | Bacteria | 5557 |
| 349 | Ga0157372_10045541 | 3300013307 | Bacteria | 4867 |
| 350 | Ga0157375_10018772 | 3300013308 | Bacteria | 6275 |
| 351 | Ga0157375_10085629 | 3300013308 | Unclassified | 3201 |
| 352 | Ga0157375_10091066 | 3300013308 | Bacteria | 3110 |
| 353 | Ga0163163_10008354 | 3300014325 | Bacteria | 9195 |
| 354 | Ga0163163_10035017 | 3300014325 | Bacteria | 4868 |
| 355 | Ga0182008_10003836 | 3300014497 | Bacteria | 8935 |
| 356 | Ga0182008_10028083 | 3300014497 | Bacteria | 2846 |
| 357 | Ga0157377_10000586 | 3300014745 | Bacteria | 15141 |
| 358 | Ga0157379_10002438 | 3300014968 | Bacteria | 15569 |
| 359 | Ga0157379_10006714 | 3300014968 | Bacteria | 9940 |
| 360 | Ga0157379_10051045 | 3300014968 | Bacteria | 3694 |
| 361 | Ga0157379_10217281 | 3300014968 | Unclassified | 1732 |
| 362 | Ga0157379_10277088 | 3300014968 | Bacteria | 1526 |
| 363 | Ga0157376_10003037 | 3300014969 | Bacteria | 11495 |
| 364 | Ga0157376_10025014 | 3300014969 | Bacteria | 4697 |
| 365 | Ga0157376_10039227 | 3300014969 | Bacteria | 3861 |
| 366 | Ga0157376_10067173 | 3300014969 | Bacteria | 3032 |
| 367 | Ga0157376_10172932 | 3300014969 | Bacteria | 1968 |
| 368 | Ga0157376_10184465 | 3300014969 | Bacteria | 1909 |
| 369 | Ga0182006_1009258 | 3300015261 | Unclassified | 4422 |
| 370 | Ga0182006_1010681 | 3300015261 | Unclassified | 4069 |
| 371 | Ga0182007_10003201 | 3300015262 | Bacteria | 7812 |
| 372 | Ga0163161_10001547 | 3300017792 | Bacteria | 16984 |
| 373 | Ga0224570_100448 | 3300022730 | Bacteria | 3229 |
| 374 | Ga0224572_1005230 | 3300024225 | Unclassified | 2305 |
| 375 | Ga0224572_1008971 | 3300024225 | Unclassified | 1859 |
| 376 | Ga0228598_1000482 | 3300024227 | Bacteria | 8191 |
| 377 | Ga0228598_1000734 | 3300024227 | Bacteria | 7005 |
| 378 | Ga0207656_10011131 | 3300025321 | Bacteria | 3390 |
| 379 | Ga0207682_10051808 | 3300025893 | Bacteria | 1700 |
| 380 | Ga0207692_10001160 | 3300025898 | Bacteria | 9728 |
| 381 | Ga0207692_10002644 | 3300025898 | Bacteria | 6892 |
| 382 | Ga0207692_10005161 | 3300025898 | Bacteria | 5213 |
| 383 | Ga0207642_10096855 | 3300025899 | Unclassified | 1472 |
| 384 | Ga0207710_10005097 | 3300025900 | Bacteria | 5683 |
| 385 | Ga0207680_10017425 | 3300025903 | Unclassified | 3795 |
| 386 | Ga0207680_10129025 | 3300025903 | Unclassified | 1664 |
| 387 | Ga0207647_10003396 | 3300025904 | Bacteria | 11930 |
| 388 | Ga0207647_10013377 | 3300025904 | Bacteria | 5692 |
| 389 | Ga0207685_10050906 | 3300025905 | Bacteria | 1597 |
| 390 | Ga0207699_10011839 | 3300025906 | Bacteria | 4420 |
| 391 | Ga0207699_10014346 | 3300025906 | Bacteria | 4082 |
| 392 | Ga0207699_10015643 | 3300025906 | Unclassified | 3946 |
| 393 | Ga0207699_10021495 | 3300025906 | Bacteria | 3479 |
| 394 | Ga0207699_10036152 | 3300025906 | Unclassified | 2814 |
| 395 | Ga0207699_10143950 | 3300025906 | Bacteria | 1569 |
| 396 | Ga0207699_10155135 | 3300025906 | Bacteria | 1519 |
| 397 | Ga0207645_10000551 | 3300025907 | Bacteria | 31119 |
| 398 | Ga0207645_10054517 | 3300025907 | Unclassified | 2553 |
| 399 | Ga0207643_10005881 | 3300025908 | Bacteria | 6552 |
| 400 | Ga0207684_10002771 | 3300025910 | Bacteria | 17451 |
| 401 | Ga0207684_10003513 | 3300025910 | Bacteria | 15292 |
| 402 | Ga0207684_10008622 | 3300025910 | Bacteria | 9059 |
| 403 | Ga0207684_10025610 | 3300025910 | Bacteria | 5028 |
| 404 | Ga0207684_10071885 | 3300025910 | Unclassified | 2939 |
| 405 | Ga0207684_10113344 | 3300025910 | Unclassified | 2321 |
| 406 | Ga0207654_10047941 | 3300025911 | Bacteria | 2443 |
| 407 | Ga0207654_10055058 | 3300025911 | Unclassified | 2301 |
| 408 | Ga0207707_10000617 | 3300025912 | Bacteria | 35411 |
| 409 | Ga0207707_10002456 | 3300025912 | Bacteria | 16676 |
| 410 | Ga0207707_10150309 | 3300025912 | Unclassified | 2036 |
| 411 | Ga0207695_10005582 | 3300025913 | Bacteria | 16616 |
| 412 | Ga0207695_10016407 | 3300025913 | Bacteria | 8665 |
| 413 | Ga0207695_10026809 | 3300025913 | Bacteria | 6426 |
| 414 | Ga0207695_10041882 | 3300025913 | Bacteria | 4898 |
| 415 | Ga0207695_10075460 | 3300025913 | Bacteria | 3430 |
| 416 | Ga0207695_10088028 | 3300025913 | Bacteria | 3127 |
| 417 | Ga0207693_10000010 | 3300025915 | Bacteria | 162031 |
| 418 | Ga0207693_10000076 | 3300025915 | Bacteria | 88185 |
| 419 | Ga0207693_10000689 | 3300025915 | Bacteria | 30320 |
| 420 | Ga0207693_10003255 | 3300025915 | Bacteria | 13927 |
| 421 | Ga0207693_10037974 | 3300025915 | Bacteria | 3794 |
| 422 | Ga0207693_10068427 | 3300025915 | Bacteria | 2779 |
| 423 | Ga0207693_10241327 | 3300025915 | Bacteria | 1418 |
| 424 | Ga0207663_10000541 | 3300025916 | Bacteria | 16618 |
| 425 | Ga0207663_10005938 | 3300025916 | Bacteria | 6197 |
| 426 | Ga0207663_10014476 | 3300025916 | Bacteria | 4320 |
| 427 | Ga0207663_10018035 | 3300025916 | Unclassified | 3945 |
| 428 | Ga0207663_10049676 | 3300025916 | Bacteria | 2603 |
| 429 | Ga0207663_10068199 | 3300025916 | Bacteria | 2284 |
| 430 | Ga0207663_10072953 | 3300025916 | Bacteria | 2220 |
| 431 | Ga0207663_10149992 | 3300025916 | Bacteria | 1635 |
| 432 | Ga0207660_10174946 | 3300025917 | Bacteria | 1664 |
| 433 | Ga0207662_10000359 | 3300025918 | Bacteria | 20504 |
| 434 | Ga0207657_10006439 | 3300025919 | Bacteria | 12168 |
| 435 | Ga0207657_10009009 | 3300025919 | Bacteria | 10078 |
| 436 | Ga0207657_10014017 | 3300025919 | Bacteria | 7844 |
| 437 | Ga0207649_10000546 | 3300025920 | Bacteria | 26008 |
| 438 | Ga0207652_10008089 | 3300025921 | Bacteria | 8443 |
| 439 | Ga0207652_10015654 | 3300025921 | Bacteria | 6174 |
| 440 | Ga0207646_10002047 | 3300025922 | Bacteria | 24227 |
| 441 | Ga0207646_10010353 | 3300025922 | Bacteria | 9120 |
| 442 | Ga0207646_10016435 | 3300025922 | Bacteria | 6943 |
| 443 | Ga0207646_10020901 | 3300025922 | Bacteria | 6056 |
| 444 | Ga0207646_10036059 | 3300025922 | Bacteria | 4465 |
| 445 | Ga0207646_10036812 | 3300025922 | Bacteria | 4416 |
| 446 | Ga0207681_10037905 | 3300025923 | Unclassified | 3190 |
| 447 | Ga0207681_10211963 | 3300025923 | Bacteria | 1493 |
| 448 | Ga0207694_10033298 | 3300025924 | Unclassified | 3948 |
| 449 | Ga0207694_10043723 | 3300025924 | Bacteria | 3457 |
| 450 | Ga0207694_10052747 | 3300025924 | Unclassified | 3152 |
| 451 | Ga0207694_10157742 | 3300025924 | Bacteria | 1831 |
| 452 | Ga0207650_10000045 | 3300025925 | Bacteria | 181507 |
| 453 | Ga0207650_10028985 | 3300025925 | Unclassified | 3974 |
| 454 | Ga0207650_10099273 | 3300025925 | Bacteria | 2238 |
| 455 | Ga0207659_10019123 | 3300025926 | Unclassified | 4501 |
| 456 | Ga0207687_10044178 | 3300025927 | Unclassified | 3073 |
| 457 | Ga0207687_10172849 | 3300025927 | Bacteria | 1668 |
| 458 | Ga0207700_10000121 | 3300025928 | Bacteria | 46080 |
| 459 | Ga0207700_10002500 | 3300025928 | Bacteria | 10534 |
| 460 | Ga0207700_10014223 | 3300025928 | Bacteria | 5208 |
| 461 | Ga0207700_10022051 | 3300025928 | Unclassified | 4362 |
| 462 | Ga0207700_10024805 | 3300025928 | Unclassified | 4155 |
| 463 | Ga0207700_10066685 | 3300025928 | Bacteria | 2752 |
| 464 | Ga0207700_10083429 | 3300025928 | Bacteria | 2502 |
| 465 | Ga0207700_10112523 | 3300025928 | Bacteria | 2193 |
| 466 | Ga0207700_10126947 | 3300025928 | Bacteria | 2077 |
| 467 | Ga0207700_10153648 | 3300025928 | Bacteria | 1904 |
| 468 | Ga0207700_10234552 | 3300025928 | Unclassified | 1561 |
| 469 | Ga0207664_10000084 | 3300025929 | Bacteria | 93564 |
| 470 | Ga0207664_10001858 | 3300025929 | Bacteria | 13932 |
| 471 | Ga0207664_10026317 | 3300025929 | Unclassified | 4395 |
| 472 | Ga0207664_10148899 | 3300025929 | Unclassified | 1987 |
| 473 | Ga0207664_10165530 | 3300025929 | Unclassified | 1889 |
| 474 | Ga0207664_10328887 | 3300025929 | Unclassified | 1349 |
| 475 | Ga0207644_10018085 | 3300025931 | Unclassified | 4765 |
| 476 | Ga0207690_10162875 | 3300025932 | Bacteria | 1664 |
| 477 | Ga0207706_10001067 | 3300025933 | Bacteria | 27853 |
| 478 | Ga0207706_10001085 | 3300025933 | Bacteria | 27637 |
| 479 | Ga0207706_10015387 | 3300025933 | Bacteria | 6911 |
| 480 | Ga0207686_10022874 | 3300025934 | Bacteria | 3603 |
| 481 | Ga0207686_10098383 | 3300025934 | Unclassified | 1948 |
| 482 | Ga0207670_10004567 | 3300025936 | Bacteria | 7479 |
| 483 | Ga0207669_10160041 | 3300025937 | Bacteria | 1589 |
| 484 | Ga0207704_10043852 | 3300025938 | Bacteria | 2645 |
| 485 | Ga0207665_10001046 | 3300025939 | Bacteria | 18599 |
| 486 | Ga0207665_10001295 | 3300025939 | Bacteria | 16905 |
| 487 | Ga0207665_10003917 | 3300025939 | Bacteria | 9965 |
| 488 | Ga0207665_10015791 | 3300025939 | Bacteria | 4955 |
| 489 | Ga0207665_10074790 | 3300025939 | Bacteria | 2319 |
| 490 | Ga0207691_10001782 | 3300025940 | Bacteria | 21176 |
| 491 | Ga0207691_10146285 | 3300025940 | Unclassified | 2080 |
| 492 | Ga0207711_10018805 | 3300025941 | Bacteria | 5744 |
| 493 | Ga0207711_10018874 | 3300025941 | Bacteria | 5733 |
| 494 | Ga0207689_10000185 | 3300025942 | Bacteria | 54094 |
| 495 | Ga0207689_10001473 | 3300025942 | Bacteria | 22547 |
| 496 | Ga0207689_10006133 | 3300025942 | Bacteria | 10637 |
| 497 | Ga0207689_10092321 | 3300025942 | Bacteria | 2487 |
| 498 | Ga0207661_10000131 | 3300025944 | Bacteria | 47673 |
| 499 | Ga0207661_10036911 | 3300025944 | Unclassified | 3818 |
| 500 | Ga0207661_10056239 | 3300025944 | Bacteria | 3158 |
| 501 | Ga0207661_10083674 | 3300025944 | Unclassified | 2641 |
| 502 | Ga0207679_10000283 | 3300025945 | Bacteria | 38405 |
| 503 | Ga0207679_10000766 | 3300025945 | Bacteria | 21148 |
| 504 | Ga0207679_10170642 | 3300025945 | Bacteria | 1790 |
| 505 | Ga0207667_10001753 | 3300025949 | Bacteria | 27293 |
| 506 | Ga0207667_10017467 | 3300025949 | Bacteria | 8071 |
| 507 | Ga0207667_10059895 | 3300025949 | Unclassified | 3986 |
| 508 | Ga0207668_10080213 | 3300025972 | Bacteria | 2363 |
| 509 | Ga0207668_10087758 | 3300025972 | Unclassified | 2276 |
| 510 | Ga0207640_10024085 | 3300025981 | Bacteria | 3667 |
| 511 | Ga0207640_10042696 | 3300025981 | Bacteria | 2893 |
| 512 | Ga0207658_10202386 | 3300025986 | Bacteria | 1658 |
| 513 | Ga0207677_10004651 | 3300026023 | Bacteria | 7387 |
| 514 | Ga0207677_10197503 | 3300026023 | Bacteria | 1596 |
| 515 | Ga0207677_10236038 | 3300026023 | Bacteria | 1476 |
| 516 | Ga0207703_10013381 | 3300026035 | Bacteria | 6394 |
| 517 | Ga0207703_10033938 | 3300026035 | Unclassified | 4047 |
| 518 | Ga0207703_10061950 | 3300026035 | Bacteria | 3064 |
| 519 | Ga0207703_10075567 | 3300026035 | Bacteria | 2793 |
| 520 | Ga0207639_10006272 | 3300026041 | Bacteria | 8075 |
| 521 | Ga0207639_10013564 | 3300026041 | Bacteria | 5709 |
| 522 | Ga0207639_10049256 | 3300026041 | Unclassified | 3194 |
| 523 | Ga0207639_10071785 | 3300026041 | Bacteria | 2709 |
| 524 | Ga0207639_10317586 | 3300026041 | Bacteria | 1382 |
| 525 | Ga0207678_10001378 | 3300026067 | Bacteria | 22391 |
| 526 | Ga0207678_10001488 | 3300026067 | Bacteria | 21502 |
| 527 | Ga0207702_10001299 | 3300026078 | Bacteria | 25024 |
| 528 | Ga0207702_10010170 | 3300026078 | Bacteria | 7876 |
| 529 | Ga0207702_10024223 | 3300026078 | Bacteria | 5036 |
| 530 | Ga0207702_10051469 | 3300026078 | Bacteria | 3480 |
| 531 | Ga0207702_10055582 | 3300026078 | Bacteria | 3357 |
| 532 | Ga0207702_10397618 | 3300026078 | Unclassified | 1328 |
| 533 | Ga0207641_10000021 | 3300026088 | Bacteria | 279851 |
| 534 | Ga0207641_10009919 | 3300026088 | Bacteria | 7840 |
| 535 | Ga0207641_10041494 | 3300026088 | Unclassified | 3856 |
| 536 | Ga0207641_10126250 | 3300026088 | Bacteria | 2291 |
| 537 | Ga0207641_10313637 | 3300026088 | Bacteria | 1485 |
| 538 | Ga0207648_10000611 | 3300026089 | Bacteria | 40065 |
| 539 | Ga0207648_10052073 | 3300026089 | Bacteria | 3579 |
| 540 | Ga0207648_10053626 | 3300026089 | Bacteria | 3524 |
| 541 | Ga0207648_10130469 | 3300026089 | Unclassified | 2212 |
| 542 | Ga0207676_10000096 | 3300026095 | Bacteria | 80353 |
| 543 | Ga0207676_10005664 | 3300026095 | Bacteria | 8843 |
| 544 | Ga0207674_10000246 | 3300026116 | Bacteria | 67486 |
| 545 | Ga0207674_10043972 | 3300026116 | Bacteria | 4603 |
| 546 | Ga0207674_10107936 | 3300026116 | Unclassified | 2760 |
| 547 | Ga0207674_10133865 | 3300026116 | Unclassified | 2441 |
| 548 | Ga0207675_100007864 | 3300026118 | Bacteria | 10061 |
| 549 | Ga0207675_100035294 | 3300026118 | Unclassified | 4664 |
| 550 | Ga0207683_10001457 | 3300026121 | Bacteria | 21339 |
| 551 | Ga0207698_10120102 | 3300026142 | Unclassified | 2222 |
| 552 | Ga0207698_10125337 | 3300026142 | Bacteria | 2183 |
| 553 | Ga0207698_10278271 | 3300026142 | Bacteria | 1546 |
| 554 | Ga0265354_1001671 | 3300028016 | Unclassified | 3076 |
| 555 | Ga0265356_1001344 | 3300028017 | Bacteria | 3666 |
| 556 | Ga0268266_10005064 | 3300028379 | Bacteria | 12430 |
| 557 | Ga0268266_10422668 | 3300028379 | Unclassified | 1263 |
| 558 | Ga0268265_10003076 | 3300028380 | Bacteria | 12174 |
| 559 | Ga0268265_10087263 | 3300028380 | Bacteria | 2482 |
| 560 | Ga0268264_10010583 | 3300028381 | Bacteria | 7625 |
| 561 | Ga0268264_10065933 | 3300028381 | Bacteria | 3052 |
| 562 | Ga0265338_10001963 | 3300028800 | Bacteria | 32066 |
| 563 | Ga0265338_10022202 | 3300028800 | Bacteria | 6581 |
| 564 | Ga0265762_1007636 | 3300030760 | Unclassified | 1927 |
| 565 | Ga0265770_1005094 | 3300030878 | Bacteria | 1803 |
| 566 | Ga0265760_10001472 | 3300031090 | Bacteria | 6935 |
| 567 | Ga0265760_10002452 | 3300031090 | Bacteria | 5411 |
| 568 | Ga0265760_10003647 | 3300031090 | Bacteria | 4465 |
| 569 | Ga0265760_10005687 | 3300031090 | Unclassified | 3566 |
| 570 | Ga0265760_10006535 | 3300031090 | Bacteria | 3334 |
| 571 | Ga0265330_10008453 | 3300031235 | Bacteria | 4954 |
| 572 | Ga0265340_10016675 | 3300031247 | Bacteria | 3802 |
| 573 | Ga0265339_10028080 | 3300031249 | Bacteria | 3203 |
| 574 | Ga0265339_10052979 | 3300031249 | Unclassified | 2208 |
| 575 | Ga0265316_10001005 | 3300031344 | Bacteria | 30618 |
| 576 | Ga0265316_10026308 | 3300031344 | Bacteria | 4842 |
| 577 | Ga0265314_10001994 | 3300031711 | Bacteria | 21660 |
| 578 | Ga0265314_10032997 | 3300031711 | Bacteria | 3802 |
| 579 | Ga0307409_100009469 | 3300031995 | Bacteria | 5987 |
| 580 | Ga0307416_100061448 | 3300032002 | Unclassified | 3066 |
| 581 | Ga0307415_100003240 | 3300032126 | Bacteria | 8260 |
| 582 | Ga0373934_0017088 | 3300035086 | Bacteria | 2765 |
| 583 | Ga0373951_0013764 | 3300035091 | Bacteria | 1818 |
| 584 | Ga0373923_0030100 | 3300035111 | Bacteria | 2181 |
| 585 | Ga0373923_0085172 | 3300035111 | Bacteria | 1376 |
| 586 | Ga0373936_0004722 | 3300035113 | Bacteria | 5147 |
| 587 | Ga0373936_0006650 | 3300035113 | Bacteria | 4353 |
| 588 | Ga0373945_0026742 | 3300035116 | Bacteria | 2011 |
| 589 | Ga0373953_0027024 | 3300035117 | Bacteria | 2202 |
| 590 | Ga0373954_0015186 | 3300035118 | Bacteria | 3440 |
| 591 | Ga0373956_0129617 | 3300035119 | Bacteria | 1180 |
| 592 | Ga0373957_0019856 | 3300035120 | Bacteria | 2368 |
| 593 | Ga0373943_0000009 | 3300035170 | Bacteria | 67175 |
| 594 | Ga0373943_0010538 | 3300035170 | Bacteria | 4143 |
| 595 | Ga0373946_0003102 | 3300035171 | Bacteria | 5888 |
| 596 | Ga0373946_0016178 | 3300035171 | Bacteria | 2839 |
| 597 | Ga0373924_0016665 | 3300035410 | Bacteria | 2808 |
| 598 | Ga0373931_0008667 | 3300035691 | Unclassified | 4835 |
| 599 | Ga0373931_0055051 | 3300035691 | Unclassified | 2127 |
| 600 | Ga0373935_0015339 | 3300035692 | Bacteria | 4630 |
| 601 | Ga0373935_0046653 | 3300035692 | Bacteria | 2737 |
| 602 | Ga0373927_0000539 | 3300035695 | Bacteria | 28719 |
| 603 | Ga0373927_0014597 | 3300035695 | Bacteria | 5196 |
| 604 | Ga0373927_0017759 | 3300035695 | Bacteria | 4681 |
| 605 | Ga0373927_0054534 | 3300035695 | Bacteria | 2586 |
| 606 | Ga0373927_0109676 | 3300035695 | Bacteria | 1798 |
| 607 | Ga0373933_0041793 | 3300035724 | Unclassified | 2708 |
| 608 | Ga0373947_0049530 | 3300035725 | Bacteria | 2523 |
| 609 | Ga0373947_0093405 | 3300035725 | Bacteria | 1880 |
| 610 | Ga0373947_0169723 | 3300035725 | Bacteria | 1415 |
| 611 | Ga0373937_0006927 | 3300036401 | Bacteria | 9787 |
| 612 | Ga0373937_0008946 | 3300036401 | Bacteria | 8691 |
| 613 | Ga0373937_0149471 | 3300036401 | Bacteria | 2188 |
| 614 | Ga0373925_0001229 | 3300037068 | Bacteria | 22656 |
| 615 | Ga0373925_0001274 | 3300037068 | Bacteria | 22247 |
| 616 | Ga0373925_0005162 | 3300037068 | Bacteria | 9784 |
| 617 | Ga0373925_0018740 | 3300037068 | Bacteria | 5030 |
| 618 | Ga0373925_0217571 | 3300037068 | Bacteria | 1524 |
| 619 | Ga0373925_0335984 | 3300037068 | Bacteria | 1225 |
| 620 | Ga0436363_0070523 | 3300039450 | Unclassified | 1149 |
| 621 | Ga0466966_0207109 | 3300044684 | Bacteria | 1186 |
| 622 | Ga0466961_0048378 | 3300044693 | Bacteria | 2718 |
| 623 | Ga0466963_0088960 | 3300044694 | Bacteria | 2100 |
| 624 | Ga0466971_0097512 | 3300044719 | Unclassified | 1349 |
| 625 | Ga0466957_0037338 | 3300044842 | Bacteria | 2925 |
| 626 | Ga0451576_0346997 | 3300045051 | Unclassified | 1554 |
| 627 | Ga0466967_0051306 | 3300045976 | Bacteria | 3615 |
| 628 | Ga0495629_0008433 | 3300046459 | Bacteria | 7586 |
| 629 | Ga0495580_0001237 | 3300046472 | Bacteria | 22525 |
| 630 | Ga0495580_0001858 | 3300046472 | Bacteria | 18574 |
| 631 | Ga0495580_0002538 | 3300046472 | Bacteria | 15898 |
| 632 | Ga0495580_0003245 | 3300046472 | Bacteria | 13908 |
| 633 | Ga0495580_0004308 | 3300046472 | Bacteria | 11967 |
| 634 | Ga0495580_0004470 | 3300046472 | Bacteria | 11745 |
| 635 | Ga0495580_0005568 | 3300046472 | Bacteria | 10385 |
| 636 | Ga0495580_0014786 | 3300046472 | Bacteria | 5914 |
| 637 | Ga0495580_0020936 | 3300046472 | Unclassified | 4830 |
| 638 | Ga0495580_0042229 | 3300046472 | Bacteria | 3249 |
| 639 | Ga0495580_0052133 | 3300046472 | Bacteria | 2890 |
| 640 | Ga0495582_0002444 | 3300046473 | Bacteria | 10357 |
| 641 | Ga0495582_0009610 | 3300046473 | Bacteria | 5325 |
| 642 | Ga0495664_0004337 | 3300046477 | Bacteria | 7747 |
| 643 | Ga0495584_0033049 | 3300046491 | Bacteria | 2617 |
| 644 | Ga0495594_0169180 | 3300046499 | Unclassified | 1243 |
| 645 | Ga0495630_0051919 | 3300046517 | Bacteria | 3069 |
| 646 | Ga0495630_0057160 | 3300046517 | Bacteria | 2924 |
| 647 | Ga0495630_0058096 | 3300046517 | Unclassified | 2900 |
| 648 | Ga0495665_0011829 | 3300046531 | Unclassified | 4727 |
| 649 | Ga0495665_0015425 | 3300046531 | Bacteria | 4114 |
| 650 | Ga0495586_0087823 | 3300046535 | Unclassified | 1715 |
| 651 | Ga0495587_0168176 | 3300046536 | Unclassified | 1246 |
| 652 | Ga0495667_0169090 | 3300046559 | Bacteria | 1405 |
| 653 | Ga0495635_0099927 | 3300046663 | Bacteria | 1983 |
| 654 | Ga0495659_0029165 | 3300046664 | Bacteria | 1914 |
| 655 | Ga0495658_0010837 | 3300046683 | Bacteria | 4566 |
| 656 | Ga0495669_0055070 | 3300046684 | Bacteria | 1791 |
| 657 | Ga0495674_0002665 | 3300047319 | Bacteria | 17375 |
| 658 | Ga0495674_0036922 | 3300047319 | Unclassified | 4393 |
| 659 | Ga0495675_0027741 | 3300047444 | Bacteria | 3609 |
| 660 | Ga0495602_0222648 | 3300048088 | Unclassified | 1423 |
| 661 | Ga0495602_0224410 | 3300048088 | Bacteria | 1416 |
| 662 | Ga0496100_0002390 | 3300048903 | Bacteria | 9503 |
| 663 | Ga0496100_0037483 | 3300048903 | Bacteria | 3066 |
| 664 | Ga0496100_0170954 | 3300048903 | Unclassified | 1565 |
| 665 | Ga0496101_0058219 | 3300048904 | Bacteria | 2797 |
| 666 | Ga0496101_0189664 | 3300048904 | Unclassified | 1586 |
| 667 | Ga0496101_0228068 | 3300048904 | Unclassified | 1447 |
| 668 | Ga0496102_0009005 | 3300048905 | Bacteria | 8568 |
| 669 | Ga0496102_0148478 | 3300048905 | Unclassified | 2201 |
| 670 | Ga0496102_0340984 | 3300048905 | Bacteria | 1411 |
| 671 | Ga0496103_0053574 | 3300048906 | Bacteria | 2501 |
| 672 | Ga0496104_0015789 | 3300048907 | Bacteria | 6850 |
| 673 | Ga0496104_0027801 | 3300048907 | Bacteria | 5236 |
| 674 | Ga0496104_0282382 | 3300048907 | Bacteria | 1573 |
| 675 | Ga0496105_0201103 | 3300048908 | Bacteria | 1626 |
| 676 | Ga0496105_0235758 | 3300048908 | Unclassified | 1486 |
| 677 | Ga0496106_0032719 | 3300048909 | Unclassified | 3879 |
| 678 | Ga0496106_0051122 | 3300048909 | Bacteria | 3116 |
| 679 | Ga0496106_0105896 | 3300048909 | Unclassified | 2185 |
| 680 | Ga0496108_0000605 | 3300048911 | Bacteria | 28095 |
| 681 | Ga0496109_0000749 | 3300048912 | Bacteria | 27009 |
| 682 | Ga0496109_0192169 | 3300048912 | Bacteria | 1918 |
| 683 | Ga0496110_0001050 | 3300048913 | Bacteria | 19502 |
| 684 | Ga0496110_0045530 | 3300048913 | Unclassified | 3835 |
| 685 | Ga0496111_0009969 | 3300048914 | Bacteria | 6355 |
| 686 | Ga0496112_0000399 | 3300048915 | Bacteria | 28374 |
| 687 | Ga0496112_0001655 | 3300048915 | Bacteria | 17320 |
| 688 | Ga0496112_0003294 | 3300048915 | Bacteria | 13329 |
| 689 | Ga0496112_0021217 | 3300048915 | Bacteria | 6174 |
| 690 | Ga0496112_0258934 | 3300048915 | Bacteria | 1689 |
| 691 | Ga0496113_0000468 | 3300048916 | Bacteria | 19787 |
| 692 | Ga0496113_0020271 | 3300048916 | Bacteria | 4672 |
| 693 | Ga0496114_0015710 | 3300048917 | Bacteria | 6091 |
| 694 | Ga0496115_0004144 | 3300048918 | Bacteria | 10466 |
| 695 | Ga0496115_0019372 | 3300048918 | Bacteria | 5234 |
| 696 | Ga0501083_0100248 | 3300049744 | Bacteria | 1910 |
| 697 | Ga0501083_0148644 | 3300049744 | Bacteria | 1534 |
| 698 | nmdc:mga0n895_1448_c1 | 3300050512 | Bacteria | 17728 |
| 699 | nmdc:mga0n895_194_c1 | 3300050512 | Bacteria | 37839 |
| 700 | nmdc:mga0n895_2844_c1 | 3300050512 | Bacteria | 13712 |
| 701 | nmdc:mga0rr50_122273_c1 | 3300050513 | Bacteria | 2074 |
| 702 | nmdc:mga0rr50_1647_c1 | 3300050513 | Bacteria | 12304 |
| 703 | nmdc:mga0rr50_410_c1 | 3300050513 | Bacteria | 23330 |
| 704 | nmdc:mga08x19_135245_c1 | 3300050514 | Unclassified | 1661 |
| 705 | nmdc:mga08x19_14839_c1 | 3300050514 | Unclassified | 4731 |
| 706 | nmdc:mga08x19_2739_c1 | 3300050514 | Bacteria | 10644 |
| 707 | nmdc:mga08x19_73045_c1 | 3300050514 | Unclassified | 2238 |
| 708 | nmdc:mga08x19_80522_c1 | 3300050514 | Bacteria | 2137 |
| 709 | nmdc:mga0a205_11064_c1 | 3300050515 | Bacteria | 6692 |
| 710 | nmdc:mga0a205_20440_c1 | 3300050515 | Bacteria | 6246 |
| 711 | Ga0495612_0094099 | 3300053078 | Bacteria | 1272 |
| 712 | Ga0466962_0083840 | 3300061719 | Unclassified | 1525 |
| 713 | Ga0070713_100077919 | |||
| 714 | MBSR1b_contig_1721814 | |||
| 715 | LJNas_1000068 | |||
| 716 | JGI24752J21851_1001651 | |||
| 717 | JGI24737J22298_10011780 | |||
| 718 | JGI24743J22301_10015246 | |||
| 719 | JGI24034J26672_10001971 | |||
| 720 | JGI24751J29686_10003861 | |||
| 721 | rootL2_10297114 | |||
| 722 | Ga0065712_10093816 | |||
| 723 | Ga0065715_10144766 | |||
| 724 | Ga0070676_10013218 | |||
| 725 | Ga0070676_10030559 | |||
| 726 | Ga0070683_100005697 | |||
| 727 | Ga0070683_100024184 | |||
| 728 | Ga0070683_100045301 | |||
| 729 | Ga0070683_100365604 | |||
| 730 | Ga0070690_100017896 | |||
| 731 | Ga0070690_100128369 | |||
| 732 | Ga0070670_100003453 | |||
| 733 | Ga0070670_100014577 | |||
| 734 | Ga0068869_100001697 | |||
| 735 | Ga0068869_100013410 | |||
| 736 | Ga0070666_10015704 | |||
| 737 | Ga0070666_10025337 | |||
| 738 | Ga0070680_100213985 | |||
| 739 | Ga0070680_100296233 | |||
| 740 | Ga0070682_100018815 | |||
| 741 | Ga0068868_100002852 | |||
| 742 | Ga0068868_100013787 | |||
| 743 | Ga0068868_100092520 | |||
| 744 | Ga0070660_100006500 | |||
| 745 | Ga0070660_100035673 | |||
| 746 | Ga0070660_100162774 | |||
| 747 | Ga0070689_100006512 | |||
| 748 | Ga0070689_100193240 | |||
| 749 | Ga0070691_10097699 | |||
| 750 | Ga0070687_100043771 | |||
| 751 | Ga0070687_100074674 | |||
| 752 | Ga0070661_100015178 | |||
| 753 | Ga0070661_100045631 | |||
| 754 | Ga0070668_100011344 | |||
| 755 | Ga0070669_100013115 | |||
| 756 | Ga0070669_100092672 | |||
| 757 | Ga0070675_100076229 | |||
| 758 | Ga0070675_100087836 | |||
| 759 | Ga0070671_100048959 | |||
| 760 | Ga0070671_100192808 | |||
| 761 | Ga0070674_100097347 | |||
| 762 | Ga0070673_100035010 | |||
| 763 | Ga0070688_100002680 | |||
| 764 | Ga0070688_100079167 | |||
| 765 | Ga0070659_100003497 | |||
| 766 | Ga0070667_100204659 | |||
| 767 | Ga0070667_100257931 | |||
| 768 | Ga0070709_10005788 | |||
| 769 | Ga0070709_10046988 | |||
| 770 | Ga0070709_10050621 | |||
| 771 | Ga0070709_10114783 | |||
| 772 | Ga0070709_10117046 | |||
| 773 | Ga0070709_10155224 | |||
| 774 | Ga0070709_10222700 | |||
| 775 | Ga0070714_100000069 | |||
| 776 | Ga0070714_100002836 | |||
| 777 | Ga0070714_100009246 | |||
| 778 | Ga0070714_100010671 | |||
| 779 | Ga0070714_100060682 | |||
| 780 | Ga0070713_100000432 | |||
| 781 | Ga0070713_100004168 | |||
| 782 | Ga0070713_100015996 | |||
| 783 | Ga0070713_100033020 | |||
| 784 | Ga0070713_100038249 | |||
| 785 | Ga0070713_100045351 | |||
| 786 | Ga0070713_100162784 | |||
| 787 | Ga0070713_100177584 | |||
| 788 | Ga0070713_100250601 | |||
| 789 | Ga0070713_100283995 | |||
| 790 | Ga0070710_10002730 | |||
| 791 | Ga0070710_10018901 | |||
| 792 | Ga0070710_10035148 | |||
| 793 | Ga0070710_10047859 | |||
| 794 | Ga0070710_10050340 | |||
| 795 | Ga0070710_10086402 | |||
| 796 | Ga0070710_10111427 | |||
| 797 | Ga0070710_10201400 | |||
| 798 | Ga0070711_100000340 | |||
| 799 | Ga0070711_100001263 | |||
| 800 | Ga0070711_100009672 | |||
| 801 | Ga0070711_100019911 | |||
| 802 | Ga0070711_100024778 | |||
| 803 | Ga0070711_100036060 | |||
| 804 | Ga0070711_100080308 | |||
| 805 | Ga0070700_100030985 | |||
| 806 | Ga0070708_100001602 | |||
| 807 | Ga0070708_100003146 | |||
| 808 | Ga0070708_100003488 | |||
| 809 | Ga0070708_100004955 | |||
| 810 | Ga0070708_100015660 | |||
| 811 | Ga0070708_100095672 | |||
| 812 | Ga0070708_100103560 | |||
| 813 | Ga0070708_100163350 | |||
| 814 | Ga0070663_100004820 | |||
| 815 | Ga0070663_100093588 | |||
| 816 | Ga0070678_100001279 | |||
| 817 | Ga0070662_100016350 | |||
| 818 | Ga0070662_100070338 | |||
| 819 | Ga0070681_10000988 | |||
| 820 | Ga0070681_10012121 | |||
| 821 | Ga0070681_10026962 | |||
| 822 | Ga0070681_10247551 | |||
| 823 | Ga0068867_100005388 | |||
| 824 | Ga0068867_100017345 | |||
| 825 | Ga0068867_100059384 | |||
| 826 | Ga0068867_100100981 | |||
| 827 | Ga0070685_10006488 | |||
| 828 | Ga0070706_100000499 | |||
| 829 | Ga0070706_100006009 | |||
| 830 | Ga0070706_100010487 | |||
| 831 | Ga0070706_100029859 | |||
| 832 | Ga0070706_100087439 | |||
| 833 | Ga0070707_100006096 | |||
| 834 | Ga0070707_100023364 | |||
| 835 | Ga0070707_100029235 | |||
| 836 | Ga0070707_100041410 | |||
| 837 | Ga0070698_100001333 | |||
| 838 | Ga0070698_100093902 | |||
| 839 | Ga0070699_100001027 | |||
| 840 | Ga0070699_100008978 | |||
| 841 | Ga0070699_100026520 | |||
| 842 | Ga0070699_100048802 | |||
| 843 | Ga0070699_100048858 | |||
| 844 | Ga0070679_100017175 | |||
| 845 | Ga0070679_100074052 | |||
| 846 | Ga0070679_100173580 | |||
| 847 | Ga0070684_100006948 | |||
| 848 | Ga0070684_100020470 | |||
| 849 | Ga0070684_100060294 | |||
| 850 | Ga0070684_100066145 | |||
| 851 | Ga0070684_100103423 | |||
| 852 | Ga0070697_100000237 | |||
| 853 | Ga0070697_100000345 | |||
| 854 | Ga0070697_100005318 | |||
| 855 | Ga0070697_100005514 | |||
| 856 | Ga0070697_100034477 | |||
| 857 | Ga0068853_100007763 | |||
| 858 | Ga0068853_100008970 | |||
| 859 | Ga0068853_100132065 | |||
| 860 | Ga0068853_100148208 | |||
| 861 | Ga0068853_100172863 | |||
| 862 | Ga0070672_100003170 | |||
| 863 | Ga0070686_100070320 | |||
| 864 | Ga0070693_100049870 | |||
| 865 | Ga0070693_100064655 | |||
| 866 | Ga0070665_100171339 | |||
| 867 | Ga0070665_100341878 | |||
| 868 | Ga0068855_100000440 | |||
| 869 | Ga0068855_100001467 | |||
| 870 | Ga0068855_100028962 | |||
| 871 | Ga0068855_100092660 | |||
| 872 | Ga0068855_100243518 | |||
| 873 | Ga0070664_100000079 | |||
| 874 | Ga0070664_100020164 | |||
| 875 | Ga0070664_100110929 | |||
| 876 | Ga0068857_100005472 | |||
| 877 | Ga0068857_100014158 | |||
| 878 | Ga0068857_100313107 | |||
| 879 | Ga0068854_100023351 | |||
| 880 | Ga0068854_100039340 | |||
| 881 | Ga0068854_100043980 | |||
| 882 | Ga0068854_100123180 | |||
| 883 | Ga0068856_100000314 | |||
| 884 | Ga0068856_100000884 | |||
| 885 | Ga0068856_100001689 | |||
| 886 | Ga0068856_100002427 | |||
| 887 | Ga0068856_100005971 | |||
| 888 | Ga0068856_100012736 | |||
| 889 | Ga0068856_100021784 | |||
| 890 | Ga0068856_100039877 | |||
| 891 | Ga0068856_100097053 | |||
| 892 | Ga0068856_100240129 | |||
| 893 | Ga0070702_100009303 | |||
| 894 | Ga0068852_100025232 | |||
| 895 | Ga0068852_100124241 | |||
| 896 | Ga0068852_100144560 | |||
| 897 | Ga0068859_100000743 | |||
| 898 | Ga0068859_100057749 | |||
| 899 | Ga0068859_100068455 | |||
| 900 | Ga0068864_100001188 | |||
| 901 | Ga0068864_100018692 | |||
| 902 | Ga0068866_10000598 | |||
| 903 | Ga0068866_10004876 | |||
| 904 | Ga0068861_100007953 | |||
| 905 | Ga0068861_100107557 | |||
| 906 | Ga0068861_100431345 | |||
| 907 | Ga0068851_10063885 | |||
| 908 | Ga0068870_10004535 | |||
| 909 | Ga0068870_10004937 | |||
| 910 | Ga0068863_100013078 | |||
| 911 | Ga0068863_100013754 | |||
| 912 | Ga0068863_100017153 | |||
| 913 | Ga0068863_100117898 | |||
| 914 | Ga0068858_100007110 | |||
| 915 | Ga0068858_100010215 | |||
| 916 | Ga0068858_100010361 | |||
| 917 | Ga0068858_100023370 | |||
| 918 | Ga0068858_100053973 | |||
| 919 | Ga0068858_100100969 | |||
| 920 | Ga0068860_100029714 | |||
| 921 | Ga0068862_100028772 | |||
| 922 | Ga0068862_100094370 | |||
| 923 | Ga0081455_10233363 | |||
| 924 | Ga0081540_1062394 | |||
| 925 | Ga0070717_10000535 | |||
| 926 | Ga0070717_10000774 | |||
| 927 | Ga0070717_10001917 | |||
| 928 | Ga0070717_10001986 | |||
| 929 | Ga0070717_10002964 | |||
| 930 | Ga0070717_10003179 | |||
| 931 | Ga0070717_10005116 | |||
| 932 | Ga0070717_10009302 | |||
| 933 | Ga0070717_10053757 | |||
| 934 | Ga0070717_10134131 | |||
| 935 | Ga0070717_10241720 | |||
| 936 | Ga0070717_10469326 | |||
| 937 | Ga0070715_10004537 | |||
| 938 | Ga0070716_100000792 | |||
| 939 | Ga0070716_100000963 | |||
| 940 | Ga0070716_100002978 | |||
| 941 | Ga0070716_100003222 | |||
| 942 | Ga0070712_100000042 | |||
| 943 | Ga0070712_100001489 | |||
| 944 | Ga0070712_100018579 | |||
| 945 | Ga0070712_100221985 | |||
| 946 | Ga0097621_100000088 | |||
| 947 | Ga0097621_100000731 | |||
| 948 | Ga0097621_100016919 | |||
| 949 | Ga0097621_100018541 | |||
| 950 | Ga0097621_100028548 | |||
| 951 | Ga0097621_100055485 | |||
| 952 | Ga0097621_100189522 | |||
| 953 | Ga0068871_100000266 | |||
| 954 | Ga0068871_100000428 | |||
| 955 | Ga0068871_100001484 | |||
| 956 | Ga0068871_100027364 | |||
| 957 | Ga0068871_100046773 | |||
| 958 | Ga0075433_10026059 | |||
| 959 | Ga0075433_10043002 | |||
| 960 | Ga0075434_100000123 | |||
| 961 | Ga0075434_100005455 | |||
| 962 | Ga0075434_100020739 | |||
| 963 | Ga0068865_100012574 | |||
| 964 | Ga0068865_100021538 | |||
| 965 | Ga0075436_100082065 | |||
| 966 | Ga0075436_100151389 | |||
| 967 | Ga0097620_100000743 | |||
| 968 | Ga0097620_100057750 | |||
| 969 | Ga0097620_100068461 | |||
| 970 | Ga0075435_100000170 | |||
| 971 | Ga0075435_100047396 | |||
| 972 | Ga0075435_100072434 | |||
| 973 | Ga0105240_10004147 | |||
| 974 | Ga0105240_10005076 | |||
| 975 | Ga0105240_10029627 | |||
| 976 | Ga0105240_10089835 | |||
| 977 | Ga0105240_10102427 | |||
| 978 | Ga0105240_10105918 | |||
| 979 | Ga0105240_10210921 | |||
| 980 | Ga0105240_10491743 | |||
| 981 | Ga0111539_10238232 | |||
| 982 | Ga0105245_10006526 | |||
| 983 | Ga0105245_10032318 | |||
| 984 | Ga0105245_10078898 | |||
| 985 | Ga0105247_10009548 | |||
| 986 | Ga0105247_10098251 | |||
| 987 | Ga0105247_10140927 | |||
| 988 | Ga0105243_10015615 | |||
| 989 | Ga0105243_10155596 | |||
| 990 | Ga0105241_10001732 | |||
| 991 | Ga0105241_10005799 | |||
| 992 | Ga0105241_10017495 | |||
| 993 | Ga0105241_10028999 | |||
| 994 | Ga0105241_10062460 | |||
| 995 | Ga0105241_10135425 | |||
| 996 | Ga0105241_10239519 | |||
| 997 | Ga0105242_10011382 | |||
| 998 | Ga0105242_10058540 | |||
| 999 | Ga0105242_10095067 | |||
| 1000 | Ga0105242_10099448 | |||
| 1001 | Ga0105248_10002754 | |||
| 1002 | Ga0105248_10056144 | |||
| 1003 | Ga0105248_10101957 | |||
| 1004 | Ga0105248_10194298 | |||
| 1005 | Ga0105237_10010940 | |||
| 1006 | Ga0105237_10016208 | |||
| 1007 | Ga0105237_10269109 | |||
| 1008 | Ga0105237_10290302 | |||
| 1009 | Ga0105238_10001256 | |||
| 1010 | Ga0105238_10029280 | |||
| 1011 | Ga0105238_10048212 | |||
| 1012 | Ga0105249_10019161 | |||
| 1013 | Ga0105249_10032850 | |||
| 1014 | Ga0105249_10078747 | |||
| 1015 | Ga0099796_10005997 | |||
| 1016 | Ga0105239_10007204 | |||
| 1017 | Ga0105239_10009713 | |||
| 1018 | Ga0105239_10047871 | |||
| 1019 | Ga0105239_10048717 | |||
| 1020 | Ga0105239_10083446 | |||
| 1021 | Ga0105239_10155424 | |||
| 1022 | Ga0105246_10008559 | |||
| 1023 | Ga0105246_10009350 | |||
| 1024 | Ga0105246_10020579 | |||
| 1025 | Ga0157373_10000869 | |||
| 1026 | Ga0157373_10025837 | |||
| 1027 | Ga0157373_10035233 | |||
| 1028 | Ga0157373_10179584 | |||
| 1029 | Ga0157371_10027867 | |||
| 1030 | Ga0157371_10060933 | |||
| 1031 | Ga0157370_10063358 | |||
| 1032 | Ga0157369_10000196 | |||
| 1033 | Ga0157369_10030283 | |||
| 1034 | Ga0157369_10043009 | |||
| 1035 | Ga0157369_10056780 | |||
| 1036 | Ga0157369_10087561 | |||
| 1037 | Ga0157369_10103711 | |||
| 1038 | Ga0157369_10136272 | |||
| 1039 | Ga0157374_10000989 | |||
| 1040 | Ga0157374_10001078 | |||
| 1041 | Ga0157374_10001572 | |||
| 1042 | Ga0157374_10003563 | |||
| 1043 | Ga0157374_10031960 | |||
| 1044 | Ga0157374_10194153 | |||
| 1045 | Ga0157374_10196670 | |||
| 1046 | Ga0157378_10000057 | |||
| 1047 | Ga0157378_10000058 | |||
| 1048 | Ga0157378_10004484 | |||
| 1049 | Ga0157378_10087649 | |||
| 1050 | Ga0157378_10200557 | |||
| 1051 | Ga0163162_10028765 | |||
| 1052 | Ga0163162_10128200 | |||
| 1053 | Ga0163162_10461708 | |||
| 1054 | Ga0157372_10000200 | |||
| 1055 | Ga0157372_10000379 | |||
| 1056 | Ga0157372_10003854 | |||
| 1057 | Ga0157372_10004695 | |||
| 1058 | Ga0157372_10006238 | |||
| 1059 | Ga0157372_10012309 | |||
| 1060 | Ga0157372_10034567 | |||
| 1061 | Ga0157372_10045541 | |||
| 1062 | Ga0157375_10018772 | |||
| 1063 | Ga0157375_10085629 | |||
| 1064 | Ga0157375_10091066 | |||
| 1065 | Ga0163163_10008354 | |||
| 1066 | Ga0163163_10035017 | |||
| 1067 | Ga0182008_10003836 | |||
| 1068 | Ga0182008_10028083 | |||
| 1069 | Ga0157377_10000586 | |||
| 1070 | Ga0157379_10002438 | |||
| 1071 | Ga0157379_10006714 | |||
| 1072 | Ga0157379_10051045 | |||
| 1073 | Ga0157379_10217281 | |||
| 1074 | Ga0157379_10277088 | |||
| 1075 | Ga0157376_10003037 | |||
| 1076 | Ga0157376_10025014 | |||
| 1077 | Ga0157376_10039227 | |||
| 1078 | Ga0157376_10067173 | |||
| 1079 | Ga0157376_10172932 | |||
| 1080 | Ga0157376_10184465 | |||
| 1081 | Ga0182006_1009258 | |||
| 1082 | Ga0182006_1010681 | |||
| 1083 | Ga0182007_10003201 | |||
| 1084 | Ga0163161_10001547 | |||
| 1085 | Ga0224570_100448 | |||
| 1086 | Ga0224572_1005230 | |||
| 1087 | Ga0224572_1008971 | |||
| 1088 | Ga0228598_1000482 | |||
| 1089 | Ga0228598_1000734 | |||
| 1090 | Ga0207656_10011131 | |||
| 1091 | Ga0207682_10051808 | |||
| 1092 | Ga0207692_10001160 | |||
| 1093 | Ga0207692_10002644 | |||
| 1094 | Ga0207692_10005161 | |||
| 1095 | Ga0207642_10096855 | |||
| 1096 | Ga0207710_10005097 | |||
| 1097 | Ga0207680_10017425 | |||
| 1098 | Ga0207680_10129025 | |||
| 1099 | Ga0207647_10003396 | |||
| 1100 | Ga0207647_10013377 | |||
| 1101 | Ga0207685_10050906 | |||
| 1102 | Ga0207699_10011839 | |||
| 1103 | Ga0207699_10014346 | |||
| 1104 | Ga0207699_10015643 | |||
| 1105 | Ga0207699_10021495 | |||
| 1106 | Ga0207699_10036152 | |||
| 1107 | Ga0207699_10143950 | |||
| 1108 | Ga0207699_10155135 | |||
| 1109 | Ga0207645_10000551 | |||
| 1110 | Ga0207645_10054517 | |||
| 1111 | Ga0207643_10005881 | |||
| 1112 | Ga0207684_10002771 | |||
| 1113 | Ga0207684_10003513 | |||
| 1114 | Ga0207684_10008622 | |||
| 1115 | Ga0207684_10025610 | |||
| 1116 | Ga0207684_10071885 | |||
| 1117 | Ga0207684_10113344 | |||
| 1118 | Ga0207654_10047941 | |||
| 1119 | Ga0207654_10055058 | |||
| 1120 | Ga0207707_10000617 | |||
| 1121 | Ga0207707_10002456 | |||
| 1122 | Ga0207707_10150309 | |||
| 1123 | Ga0207695_10005582 | |||
| 1124 | Ga0207695_10016407 | |||
| 1125 | Ga0207695_10026809 | |||
| 1126 | Ga0207695_10041882 | |||
| 1127 | Ga0207695_10075460 | |||
| 1128 | Ga0207695_10088028 | |||
| 1129 | Ga0207693_10000010 | |||
| 1130 | Ga0207693_10000076 | |||
| 1131 | Ga0207693_10000689 | |||
| 1132 | Ga0207693_10003255 | |||
| 1133 | Ga0207693_10037974 | |||
| 1134 | Ga0207693_10068427 | |||
| 1135 | Ga0207693_10241327 | |||
| 1136 | Ga0207663_10000541 | |||
| 1137 | Ga0207663_10005938 | |||
| 1138 | Ga0207663_10014476 | |||
| 1139 | Ga0207663_10018035 | |||
| 1140 | Ga0207663_10049676 | |||
| 1141 | Ga0207663_10068199 | |||
| 1142 | Ga0207663_10072953 | |||
| 1143 | Ga0207663_10149992 | |||
| 1144 | Ga0207660_10174946 | |||
| 1145 | Ga0207662_10000359 | |||
| 1146 | Ga0207657_10006439 | |||
| 1147 | Ga0207657_10009009 | |||
| 1148 | Ga0207657_10014017 | |||
| 1149 | Ga0207649_10000546 | |||
| 1150 | Ga0207652_10008089 | |||
| 1151 | Ga0207652_10015654 | |||
| 1152 | Ga0207646_10002047 | |||
| 1153 | Ga0207646_10010353 | |||
| 1154 | Ga0207646_10016435 | |||
| 1155 | Ga0207646_10020901 | |||
| 1156 | Ga0207646_10036059 | |||
| 1157 | Ga0207646_10036812 | |||
| 1158 | Ga0207681_10037905 | |||
| 1159 | Ga0207681_10211963 | |||
| 1160 | Ga0207694_10033298 | |||
| 1161 | Ga0207694_10043723 | |||
| 1162 | Ga0207694_10052747 | |||
| 1163 | Ga0207694_10157742 | |||
| 1164 | Ga0207650_10000045 | |||
| 1165 | Ga0207650_10028985 | |||
| 1166 | Ga0207650_10099273 | |||
| 1167 | Ga0207659_10019123 | |||
| 1168 | Ga0207687_10044178 | |||
| 1169 | Ga0207687_10172849 | |||
| 1170 | Ga0207700_10000121 | |||
| 1171 | Ga0207700_10002500 | |||
| 1172 | Ga0207700_10014223 | |||
| 1173 | Ga0207700_10022051 | |||
| 1174 | Ga0207700_10024805 | |||
| 1175 | Ga0207700_10066685 | |||
| 1176 | Ga0207700_10083429 | |||
| 1177 | Ga0207700_10112523 | |||
| 1178 | Ga0207700_10126947 | |||
| 1179 | Ga0207700_10153648 | |||
| 1180 | Ga0207700_10234552 | |||
| 1181 | Ga0207664_10000084 | |||
| 1182 | Ga0207664_10001858 | |||
| 1183 | Ga0207664_10026317 | |||
| 1184 | Ga0207664_10148899 | |||
| 1185 | Ga0207664_10165530 | |||
| 1186 | Ga0207664_10328887 | |||
| 1187 | Ga0207644_10018085 | |||
| 1188 | Ga0207690_10162875 | |||
| 1189 | Ga0207706_10001067 | |||
| 1190 | Ga0207706_10001085 | |||
| 1191 | Ga0207706_10015387 | |||
| 1192 | Ga0207686_10022874 | |||
| 1193 | Ga0207686_10098383 | |||
| 1194 | Ga0207670_10004567 | |||
| 1195 | Ga0207669_10160041 | |||
| 1196 | Ga0207704_10043852 | |||
| 1197 | Ga0207665_10001046 | |||
| 1198 | Ga0207665_10001295 | |||
| 1199 | Ga0207665_10003917 | |||
| 1200 | Ga0207665_10015791 | |||
| 1201 | Ga0207665_10074790 | |||
| 1202 | Ga0207691_10001782 | |||
| 1203 | Ga0207691_10146285 | |||
| 1204 | Ga0207711_10018805 | |||
| 1205 | Ga0207711_10018874 | |||
| 1206 | Ga0207689_10000185 | |||
| 1207 | Ga0207689_10001473 | |||
| 1208 | Ga0207689_10006133 | |||
| 1209 | Ga0207689_10092321 | |||
| 1210 | Ga0207661_10000131 | |||
| 1211 | Ga0207661_10036911 | |||
| 1212 | Ga0207661_10056239 | |||
| 1213 | Ga0207661_10083674 | |||
| 1214 | Ga0207679_10000283 | |||
| 1215 | Ga0207679_10000766 | |||
| 1216 | Ga0207679_10170642 | |||
| 1217 | Ga0207667_10001753 | |||
| 1218 | Ga0207667_10017467 | |||
| 1219 | Ga0207667_10059895 | |||
| 1220 | Ga0207668_10080213 | |||
| 1221 | Ga0207668_10087758 | |||
| 1222 | Ga0207640_10024085 | |||
| 1223 | Ga0207640_10042696 | |||
| 1224 | Ga0207658_10202386 | |||
| 1225 | Ga0207677_10004651 | |||
| 1226 | Ga0207677_10197503 | |||
| 1227 | Ga0207677_10236038 | |||
| 1228 | Ga0207703_10013381 | |||
| 1229 | Ga0207703_10033938 | |||
| 1230 | Ga0207703_10061950 | |||
| 1231 | Ga0207703_10075567 | |||
| 1232 | Ga0207639_10006272 | |||
| 1233 | Ga0207639_10013564 | |||
| 1234 | Ga0207639_10049256 | |||
| 1235 | Ga0207639_10071785 | |||
| 1236 | Ga0207639_10317586 | |||
| 1237 | Ga0207678_10001378 | |||
| 1238 | Ga0207678_10001488 | |||
| 1239 | Ga0207702_10001299 | |||
| 1240 | Ga0207702_10010170 | |||
| 1241 | Ga0207702_10024223 | |||
| 1242 | Ga0207702_10051469 | |||
| 1243 | Ga0207702_10055582 | |||
| 1244 | Ga0207702_10397618 | |||
| 1245 | Ga0207641_10000021 | |||
| 1246 | Ga0207641_10009919 | |||
| 1247 | Ga0207641_10041494 | |||
| 1248 | Ga0207641_10126250 | |||
| 1249 | Ga0207641_10313637 | |||
| 1250 | Ga0207648_10000611 | |||
| 1251 | Ga0207648_10052073 | |||
| 1252 | Ga0207648_10053626 | |||
| 1253 | Ga0207648_10130469 | |||
| 1254 | Ga0207676_10000096 | |||
| 1255 | Ga0207676_10005664 | |||
| 1256 | Ga0207674_10000246 | |||
| 1257 | Ga0207674_10043972 | |||
| 1258 | Ga0207674_10107936 | |||
| 1259 | Ga0207674_10133865 | |||
| 1260 | Ga0207675_100007864 | |||
| 1261 | Ga0207675_100035294 | |||
| 1262 | Ga0207683_10001457 | |||
| 1263 | Ga0207698_10120102 | |||
| 1264 | Ga0207698_10125337 | |||
| 1265 | Ga0207698_10278271 | |||
| 1266 | Ga0265354_1001671 | |||
| 1267 | Ga0265356_1001344 | |||
| 1268 | Ga0268266_10005064 | |||
| 1269 | Ga0268266_10422668 | |||
| 1270 | Ga0268265_10003076 | |||
| 1271 | Ga0268265_10087263 | |||
| 1272 | Ga0268264_10010583 | |||
| 1273 | Ga0268264_10065933 | |||
| 1274 | Ga0265338_10001963 | |||
| 1275 | Ga0265338_10022202 | |||
| 1276 | Ga0265762_1007636 | |||
| 1277 | Ga0265770_1005094 | |||
| 1278 | Ga0265760_10001472 | |||
| 1279 | Ga0265760_10002452 | |||
| 1280 | Ga0265760_10003647 | |||
| 1281 | Ga0265760_10005687 | |||
| 1282 | Ga0265760_10006535 | |||
| 1283 | Ga0265330_10008453 | |||
| 1284 | Ga0265340_10016675 | |||
| 1285 | Ga0265339_10028080 | |||
| 1286 | Ga0265339_10052979 | |||
| 1287 | Ga0265316_10001005 | |||
| 1288 | Ga0265316_10026308 | |||
| 1289 | Ga0265314_10001994 | |||
| 1290 | Ga0265314_10032997 | |||
| 1291 | Ga0307409_100009469 | |||
| 1292 | Ga0307416_100061448 | |||
| 1293 | Ga0307415_100003240 | |||
| 1294 | Ga0373934_0017088 | |||
| 1295 | Ga0373951_0013764 | |||
| 1296 | Ga0373923_0030100 | |||
| 1297 | Ga0373923_0085172 | |||
| 1298 | Ga0373936_0004722 | |||
| 1299 | Ga0373936_0006650 | |||
| 1300 | Ga0373945_0026742 | |||
| 1301 | Ga0373953_0027024 | |||
| 1302 | Ga0373954_0015186 | |||
| 1303 | Ga0373956_0129617 | |||
| 1304 | Ga0373957_0019856 | |||
| 1305 | Ga0373943_0000009 | |||
| 1306 | Ga0373943_0010538 | |||
| 1307 | Ga0373946_0003102 | |||
| 1308 | Ga0373946_0016178 | |||
| 1309 | Ga0373924_0016665 | |||
| 1310 | Ga0373931_0008667 | |||
| 1311 | Ga0373931_0055051 | |||
| 1312 | Ga0373935_0015339 | |||
| 1313 | Ga0373935_0046653 | |||
| 1314 | Ga0373927_0000539 | |||
| 1315 | Ga0373927_0014597 | |||
| 1316 | Ga0373927_0017759 | |||
| 1317 | Ga0373927_0054534 | |||
| 1318 | Ga0373927_0109676 | |||
| 1319 | Ga0373933_0041793 | |||
| 1320 | Ga0373947_0049530 | |||
| 1321 | Ga0373947_0093405 | |||
| 1322 | Ga0373947_0169723 | |||
| 1323 | Ga0373937_0006927 | |||
| 1324 | Ga0373937_0008946 | |||
| 1325 | Ga0373937_0149471 | |||
| 1326 | Ga0373925_0001229 | |||
| 1327 | Ga0373925_0001274 | |||
| 1328 | Ga0373925_0005162 | |||
| 1329 | Ga0373925_0018740 | |||
| 1330 | Ga0373925_0217571 | |||
| 1331 | Ga0373925_0335984 | |||
| 1332 | Ga0436363_0070523 | |||
| 1333 | Ga0466966_0207109 | |||
| 1334 | Ga0466961_0048378 | |||
| 1335 | Ga0466963_0088960 | |||
| 1336 | Ga0466971_0097512 | |||
| 1337 | Ga0466957_0037338 | |||
| 1338 | Ga0451576_0346997 | |||
| 1339 | Ga0466967_0051306 | |||
| 1340 | Ga0495629_0008433 | |||
| 1341 | Ga0495580_0001237 | |||
| 1342 | Ga0495580_0001858 | |||
| 1343 | Ga0495580_0002538 | |||
| 1344 | Ga0495580_0003245 | |||
| 1345 | Ga0495580_0004308 | |||
| 1346 | Ga0495580_0004470 | |||
| 1347 | Ga0495580_0005568 | |||
| 1348 | Ga0495580_0014786 | |||
| 1349 | Ga0495580_0020936 | |||
| 1350 | Ga0495580_0042229 | |||
| 1351 | Ga0495580_0052133 | |||
| 1352 | Ga0495582_0002444 | |||
| 1353 | Ga0495582_0009610 | |||
| 1354 | Ga0495664_0004337 | |||
| 1355 | Ga0495584_0033049 | |||
| 1356 | Ga0495594_0169180 | |||
| 1357 | Ga0495630_0051919 | |||
| 1358 | Ga0495630_0057160 | |||
| 1359 | Ga0495630_0058096 | |||
| 1360 | Ga0495665_0011829 | |||
| 1361 | Ga0495665_0015425 | |||
| 1362 | Ga0495586_0087823 | |||
| 1363 | Ga0495587_0168176 | |||
| 1364 | Ga0495667_0169090 | |||
| 1365 | Ga0495635_0099927 | |||
| 1366 | Ga0495659_0029165 | |||
| 1367 | Ga0495658_0010837 | |||
| 1368 | Ga0495669_0055070 | |||
| 1369 | Ga0495674_0002665 | |||
| 1370 | Ga0495674_0036922 | |||
| 1371 | Ga0495675_0027741 | |||
| 1372 | Ga0495602_0222648 | |||
| 1373 | Ga0495602_0224410 | |||
| 1374 | Ga0496100_0002390 | |||
| 1375 | Ga0496100_0037483 | |||
| 1376 | Ga0496100_0170954 | |||
| 1377 | Ga0496101_0058219 | |||
| 1378 | Ga0496101_0189664 | |||
| 1379 | Ga0496101_0228068 | |||
| 1380 | Ga0496102_0009005 | |||
| 1381 | Ga0496102_0148478 | |||
| 1382 | Ga0496102_0340984 | |||
| 1383 | Ga0496103_0053574 | |||
| 1384 | Ga0496104_0015789 | |||
| 1385 | Ga0496104_0027801 | |||
| 1386 | Ga0496104_0282382 | |||
| 1387 | Ga0496105_0201103 | |||
| 1388 | Ga0496105_0235758 | |||
| 1389 | Ga0496106_0032719 | |||
| 1390 | Ga0496106_0051122 | |||
| 1391 | Ga0496106_0105896 | |||
| 1392 | Ga0496108_0000605 | |||
| 1393 | Ga0496109_0000749 | |||
| 1394 | Ga0496109_0192169 | |||
| 1395 | Ga0496110_0001050 | |||
| 1396 | Ga0496110_0045530 | |||
| 1397 | Ga0496111_0009969 | |||
| 1398 | Ga0496112_0000399 | |||
| 1399 | Ga0496112_0001655 | |||
| 1400 | Ga0496112_0003294 | |||
| 1401 | Ga0496112_0021217 | |||
| 1402 | Ga0496112_0258934 | |||
| 1403 | Ga0496113_0000468 | |||
| 1404 | Ga0496113_0020271 | |||
| 1405 | Ga0496114_0015710 | |||
| 1406 | Ga0496115_0004144 | |||
| 1407 | Ga0496115_0019372 | |||
| 1408 | Ga0501083_0100248 | |||
| 1409 | Ga0501083_0148644 | |||
| 1410 | nmdc:mga0n895_1448_c1 | |||
| 1411 | nmdc:mga0n895_194_c1 | |||
| 1412 | nmdc:mga0n895_2844_c1 | |||
| 1413 | nmdc:mga0rr50_122273_c1 | |||
| 1414 | nmdc:mga0rr50_1647_c1 | |||
| 1415 | nmdc:mga0rr50_410_c1 | |||
| 1416 | nmdc:mga08x19_135245_c1 | |||
| 1417 | nmdc:mga08x19_14839_c1 | |||
| 1418 | nmdc:mga08x19_2739_c1 | |||
| 1419 | nmdc:mga08x19_73045_c1 | |||
| 1420 | nmdc:mga08x19_80522_c1 | |||
| 1421 | nmdc:mga0a205_11064_c1 | |||
| 1422 | nmdc:mga0a205_20440_c1 | |||
| 1423 | Ga0495612_0094099 | |||
| 1424 | Ga0466962_0083840 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1db3-assembly1.cif.gz_A-2 | e.coli gdp-mannose 4,6-dehydratase | 0.8111 | 6 | 277 |
| 2q1w-assembly1.cif.gz_C | crystal structure of the bordetella bronchiseptica enzyme wbmh in complex with nad+ | 0.7876 | 6 | 347 |
| 3sc6-assembly5.cif.gz_E | 2.65 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose reductase (rfbd) from bacillus anthracis str. ames in complex with nadp | 0.7862 | 5 | 348 |
| 3m2p-assembly1.cif.gz_B | the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus | 0.7858 | 6 | 348 |
| 3vvb-assembly1.cif.gz_A | crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in apo form | 0.7835 | 5 | 278 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WKT3_23_337_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.874 | 6 | 349 | 3.40.50.720 |
| af_P9WKT3_23_337_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8687 | 6 | 349 | 3.40.50.720 |
| 4id9A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8411 | 8 | 263 | 3.40.50.720 |
| 1rkxC01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8289 | 6 | 178 | 3.40.50.720 |
| 6dntA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8273 | 5 | 262 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9XWG6-F1-model_v4 | NAD-dependent epimerase/dehydratase domain-containing protein | 0.9907 | 85 | 349 |
|
| AF-A0A2V7WSS9-F1-model_v4 | NAD-dependent epimerase/dehydratase domain-containing protein | 0.9898 | 5 | 350 |
|
| AF-A0A2V9TM98-F1-model_v4 | NAD-dependent epimerase/dehydratase domain-containing protein | 0.9881 | 61 | 349 |
|
| AF-A0A2V9V760-F1-model_v4 | NAD-dependent epimerase/dehydratase domain-containing protein | 0.9818 | 1 | 246 |
|
| AF-A0A2V7WSS9-F1-model_v4 | NAD-dependent epimerase/dehydratase domain-containing protein | 0.9758 | 5 | 350 |
|