F476752

General Info

Members Datasets Scaffolds Average Seq Length
711 287 1422 249

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10103369|Ga0070709_101033693
Length 281
Sequence MLARLFCRPLRFKAFFNRLHPISCPTNWRDIVRGLANKRVLITGGASGIGAATAARFLEEGSQAVVLDRNEKGCAEIQRQLPKLAGTVAADVSKLEQVEAAFAEAVRLMGAVDVLINNAGISIRHNFLEITPEEWDRTLAVNLTGVFYMAQTAARHMWERGSGAILQTASTNGLVGQPFYADYNATKAGVIELTKTMALELAPRVRVCAIAPGYVLTPMQRAEYTDAMLEEVNRKIPLRRHAKPEEIAALFAYLASEDAAYITGQVFTCDGAETAGGLASR

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
114 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
117 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
118 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
119 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
120 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
121 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
184 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
188 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
189 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
190 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
191 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
192 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
193 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
194 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
195 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
196 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
197 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
198 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
199 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
200 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
201 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
204 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
205 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
207 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
208 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
209 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
210 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
211 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
212 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
213 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
214 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
215 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
217 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
218 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
219 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
220 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
221 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
222 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
225 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
226 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
227 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
228 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
229 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
230 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
231 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
232 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
233 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
234 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
235 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
236 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
237 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
238 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
239 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
240 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
241 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
242 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
243 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
244 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
245 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
246 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
247 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
248 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
249 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
250 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
251 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
252 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
253 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
254 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
255 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
260 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
261 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
262 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
263 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
264 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
265 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
266 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
267 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
268 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
269 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
270 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
271 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
272 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
273 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
274 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
275 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
276 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
277 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
278 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
279 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
280 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
281 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
282 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
283 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
284 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
285 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
286 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
287 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.31
Metatranscriptomes 0.98
Isolates 0.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0.14
Rhizoplane 7.74
Rhizosphere 90.86
Stem 0
Stem Tuber 0
Unclassified 4.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10103369 3300005434 Bacteria 1902
2 LJNas_1002090 3300000546 Bacteria 2523
3 JGI25151J46595_10027924 3300003187 Bacteria 2254
4 Ga0065715_10009720 3300005293 Bacteria 2295
5 Ga0070658_10036315 3300005327 Bacteria 3972
6 Ga0070658_10155084 3300005327 Bacteria 1919
7 Ga0070658_10322706 3300005327 Bacteria 1319
8 Ga0070676_10006347 3300005328 Bacteria 6316
9 Ga0070676_10124301 3300005328 Bacteria 1623
10 Ga0070683_100002634 3300005329 Bacteria 14344
11 Ga0070683_100079868 3300005329 Bacteria 3061
12 Ga0070690_100018812 3300005330 Bacteria 4181
13 Ga0070670_100198177 3300005331 Bacteria 1744
14 Ga0070677_10005282 3300005333 Bacteria 4251
15 Ga0068869_100022425 3300005334 Bacteria 4351
16 Ga0068869_100024527 3300005334 Bacteria 4177
17 Ga0070666_10017198 3300005335 Bacteria 4634
18 Ga0070666_10137397 3300005335 Bacteria 1701
19 Ga0070680_100130490 3300005336 Bacteria 2102
20 Ga0070682_100020786 3300005337 Unclassified 3867
21 Ga0070682_100047705 3300005337 Bacteria 2664
22 Ga0070682_100114486 3300005337 Bacteria 1802
23 Ga0068868_100001732 3300005338 Bacteria 14949
24 Ga0068868_100005079 3300005338 Bacteria 9243
25 Ga0068868_100037089 3300005338 Bacteria 3777
26 Ga0068868_100066267 3300005338 Bacteria 2871
27 Ga0068868_100257495 3300005338 Bacteria 1470
28 Ga0070660_100002663 3300005339 Bacteria 12266
29 Ga0070660_100015316 3300005339 Bacteria 5534
30 Ga0070660_100072836 3300005339 Bacteria 2685
31 Ga0070660_100174860 3300005339 Bacteria 1736
32 Ga0070689_100009733 3300005340 Bacteria 6824
33 Ga0070689_100025654 3300005340 Bacteria 4430
34 Ga0070687_100019056 3300005343 Bacteria 3187
35 Ga0070661_100005786 3300005344 Bacteria 8501
36 Ga0070661_100299413 3300005344 Bacteria 1252
37 Ga0070692_10092564 3300005345 Bacteria 1645
38 Ga0070668_100019735 3300005347 Bacteria 5076
39 Ga0070668_100080607 3300005347 Bacteria 2550
40 Ga0070669_100007505 3300005353 Bacteria 7811
41 Ga0070669_100016363 3300005353 Bacteria 5291
42 Ga0070675_100024719 3300005354 Bacteria 4811
43 Ga0070671_100350631 3300005355 Bacteria 1260
44 Ga0070674_100033875 3300005356 Bacteria 3405
45 Ga0070673_100056861 3300005364 Bacteria 3088
46 Ga0070688_100122853 3300005365 Bacteria 1741
47 Ga0070659_100031295 3300005366 Bacteria 4120
48 Ga0070659_100054051 3300005366 Bacteria 3162
49 Ga0070659_100115492 3300005366 Bacteria 2169
50 Ga0070659_100178331 3300005366 Bacteria 1743
51 Ga0070667_100544642 3300005367 Bacteria 1066
52 Ga0070709_10000171 3300005434 Bacteria 40897
53 Ga0070709_10044338 3300005434 Bacteria 2754
54 Ga0070709_10205656 3300005434 Bacteria 1397
55 Ga0070714_100000074 3300005435 Bacteria 86593
56 Ga0070714_100022978 3300005435 Bacteria 5117
57 Ga0070714_100126423 3300005435 Bacteria 2280
58 Ga0070714_100157153 3300005435 Bacteria 2053
59 Ga0070714_100176199 3300005435 Bacteria 1943
60 Ga0070714_100185757 3300005435 Bacteria 1894
61 Ga0070713_100000029 3300005436 Bacteria 90705
62 Ga0070713_100005399 3300005436 Bacteria 8731
63 Ga0070713_100012824 3300005436 Bacteria 6164
64 Ga0070713_100119636 3300005436 Bacteria 2308
65 Ga0070713_100138251 3300005436 Bacteria 2155
66 Ga0070713_100142244 3300005436 Bacteria 2126
67 Ga0070713_100240950 3300005436 Bacteria 1647
68 Ga0070710_10011275 3300005437 Bacteria 4414
69 Ga0070710_10037703 3300005437 Bacteria 2651
70 Ga0070710_10084338 3300005437 Bacteria 1861
71 Ga0070711_100000079 3300005439 Bacteria 53822
72 Ga0070711_100000531 3300005439 Bacteria 19818
73 Ga0070711_100016610 3300005439 Bacteria 4674
74 Ga0070711_100021958 3300005439 Bacteria 4131
75 Ga0070711_100042256 3300005439 Bacteria 3080
76 Ga0070711_100274261 3300005439 Bacteria 1332
77 Ga0070711_100559123 3300005439 Bacteria 950
78 Ga0070705_100087404 3300005440 Unclassified 1932
79 Ga0070700_100071856 3300005441 Bacteria 2210
80 Ga0070700_100523620 3300005441 Bacteria 916
81 Ga0070694_100147642 3300005444 Bacteria 1714
82 Ga0070708_100024351 3300005445 Bacteria 5163
83 Ga0070708_100028817 3300005445 Bacteria 4781
84 Ga0070708_100044277 3300005445 Bacteria 3913
85 Ga0070708_100058985 3300005445 Bacteria 3420
86 Ga0070708_100102903 3300005445 Bacteria 2617
87 Ga0070708_100121028 3300005445 Bacteria 2415
88 Ga0070663_100045968 3300005455 Bacteria 3086
89 Ga0070663_100131260 3300005455 Bacteria 1902
90 Ga0070662_100001639 3300005457 Bacteria 13806
91 Ga0070662_100138205 3300005457 Bacteria 1886
92 Ga0070681_10072329 3300005458 Bacteria 3411
93 Ga0070681_10151413 3300005458 Bacteria 2246
94 Ga0070681_10285293 3300005458 Bacteria 1562
95 Ga0068867_100027614 3300005459 Bacteria 4081
96 Ga0068867_100139969 3300005459 Bacteria 1890
97 Ga0070685_10005079 3300005466 Bacteria 6676
98 Ga0070706_100000479 3300005467 Bacteria 47131
99 Ga0070706_100035828 3300005467 Bacteria 4582
100 Ga0070706_100046278 3300005467 Bacteria 4017
101 Ga0070707_100143024 3300005468 Bacteria 2328
102 Ga0070707_100384074 3300005468 Bacteria 1364
103 Ga0070698_100121262 3300005471 Bacteria 2575
104 Ga0070698_100148809 3300005471 Bacteria 2290
105 Ga0070699_100035250 3300005518 Bacteria 4325
106 Ga0070699_100123252 3300005518 Bacteria 2280
107 Ga0070679_100041877 3300005530 Bacteria 4559
108 Ga0070679_100073874 3300005530 Bacteria 3401
109 Ga0070679_100263804 3300005530 Bacteria 1677
110 Ga0070679_100300092 3300005530 Bacteria 1557
111 Ga0070684_100013231 3300005535 Bacteria 6646
112 Ga0070684_100033996 3300005535 Bacteria 4356
113 Ga0070684_100149267 3300005535 Bacteria 2117
114 Ga0070684_100284046 3300005535 Bacteria 1516
115 Ga0070697_100000031 3300005536 Bacteria 110959
116 Ga0070697_100000967 3300005536 Bacteria 21694
117 Ga0070697_100032137 3300005536 Bacteria 4222
118 Ga0070697_100087557 3300005536 Bacteria 2572
119 Ga0070697_100190758 3300005536 Bacteria 1739
120 Ga0068853_100039692 3300005539 Bacteria 4015
121 Ga0068853_100058137 3300005539 Bacteria 3338
122 Ga0068853_100099791 3300005539 Bacteria 2565
123 Ga0068853_100164518 3300005539 Bacteria 2004
124 Ga0070672_100008487 3300005543 Bacteria 7032
125 Ga0070686_100004849 3300005544 Bacteria 7428
126 Ga0070686_100309461 3300005544 Bacteria 1174
127 Ga0070696_100048718 3300005546 Bacteria 2941
128 Ga0070693_100023741 3300005547 Bacteria 3282
129 Ga0070693_100039412 3300005547 Bacteria 2646
130 Ga0070693_100125981 3300005547 Bacteria 1595
131 Ga0070665_100324391 3300005548 Bacteria 1544
132 Ga0070665_100482728 3300005548 Bacteria 1250
133 Ga0068855_100021308 3300005563 Bacteria 7772
134 Ga0068855_100056535 3300005563 Bacteria 4604
135 Ga0070664_100009088 3300005564 Bacteria 8065
136 Ga0070664_100014550 3300005564 Bacteria 6418
137 Ga0070664_100174971 3300005564 Bacteria 1905
138 Ga0070664_100208874 3300005564 Bacteria 1744
139 Ga0068857_100092724 3300005577 Bacteria 2704
140 Ga0068854_100017637 3300005578 Bacteria 4780
141 Ga0068854_100039038 3300005578 Bacteria 3342
142 Ga0068854_100065716 3300005578 Bacteria 2637
143 Ga0068854_100074781 3300005578 Bacteria 2486
144 Ga0068856_100006407 3300005614 Bacteria 11549
145 Ga0068856_100009226 3300005614 Bacteria 9593
146 Ga0068856_100063269 3300005614 Bacteria 3655
147 Ga0068856_100249725 3300005614 Bacteria 1789
148 Ga0068856_100309112 3300005614 Unclassified 1598
149 Ga0070702_100015282 3300005615 Bacteria 3917
150 Ga0070702_100035998 3300005615 Bacteria 2738
151 Ga0068852_100003785 3300005616 Bacteria 10607
152 Ga0068852_100007483 3300005616 Bacteria 7971
153 Ga0068852_100372545 3300005616 Bacteria 1399
154 Ga0068859_100137093 3300005617 Bacteria 2520
155 Ga0068864_100176767 3300005618 Bacteria 1949
156 Ga0068864_100328724 3300005618 Bacteria 1438
157 Ga0068866_10015260 3300005718 Bacteria 3410
158 Ga0068866_10110843 3300005718 Bacteria 1531
159 Ga0068866_10127397 3300005718 Bacteria 1443
160 Ga0068866_10341320 3300005718 Bacteria 949
161 Ga0068861_100042909 3300005719 Bacteria 3392
162 Ga0068861_100054860 3300005719 Bacteria 3037
163 Ga0068851_10026790 3300005834 Bacteria 2836
164 Ga0068851_10048805 3300005834 Bacteria 2146
165 Ga0068870_10053948 3300005840 Bacteria 2136
166 Ga0068863_100140351 3300005841 Bacteria 2309
167 Ga0068863_100143148 3300005841 Bacteria 2286
168 Ga0068863_100194556 3300005841 Bacteria 1949
169 Ga0068863_100260441 3300005841 Bacteria 1676
170 Ga0068858_100004943 3300005842 Bacteria 13060
171 Ga0068858_100024973 3300005842 Bacteria 5562
172 Ga0068858_100270680 3300005842 Bacteria 1616
173 Ga0068860_100067128 3300005843 Unclassified 3409
174 Ga0068860_100130119 3300005843 Bacteria 2414
175 Ga0068860_100131383 3300005843 Bacteria 2403
176 Ga0068860_100132011 3300005843 Unclassified 2397
177 Ga0068860_100159088 3300005843 Bacteria 2177
178 Ga0068862_100021739 3300005844 Bacteria 5365
179 Ga0068862_100022898 3300005844 Bacteria 5230
180 Ga0068862_100192210 3300005844 Bacteria 1837
181 Ga0081540_1159728 3300005983 Bacteria 876
182 Ga0070717_10003539 3300006028 Bacteria 11199
183 Ga0070717_10003613 3300006028 Bacteria 11088
184 Ga0070717_10005829 3300006028 Bacteria 9024
185 Ga0070717_10007234 3300006028 Bacteria 8233
186 Ga0070717_10051701 3300006028 Bacteria 3383
187 Ga0070717_10141100 3300006028 Bacteria 2078
188 Ga0070717_10143480 3300006028 Bacteria 2061
189 Ga0070717_10162335 3300006028 Bacteria 1939
190 Ga0070717_10606355 3300006028 Bacteria 993
191 Ga0070717_10755385 3300006028 Bacteria 884
192 Ga0070715_10026697 3300006163 Bacteria 2300
193 Ga0070715_10026835 3300006163 Bacteria 2295
194 Ga0070715_10177028 3300006163 Bacteria 1067
195 Ga0070716_100000682 3300006173 Bacteria 14524
196 Ga0070716_100006656 3300006173 Bacteria 5655
197 Ga0070716_100019619 3300006173 Bacteria 3536
198 Ga0070716_100033201 3300006173 Bacteria 2820
199 Ga0070716_100042929 3300006173 Bacteria 2526
200 Ga0070716_100043280 3300006173 Bacteria 2517
201 Ga0070716_100071084 3300006173 Bacteria 2045
202 Ga0070716_100198377 3300006173 Bacteria 1332
203 Ga0070716_100290683 3300006173 Bacteria 1132
204 Ga0070712_100000211 3300006175 Bacteria 32872
205 Ga0070712_100002276 3300006175 Bacteria 11821
206 Ga0070712_100006922 3300006175 Bacteria 7066
207 Ga0070712_100014961 3300006175 Bacteria 4988
208 Ga0070712_100039622 3300006175 Bacteria 3225
209 Ga0070712_100125419 3300006175 Bacteria 1938
210 Ga0097621_100001039 3300006237 Bacteria 19473
211 Ga0097621_100019199 3300006237 Bacteria 5242
212 Ga0097621_100020291 3300006237 Bacteria 5119
213 Ga0097621_100115237 3300006237 Bacteria 2274
214 Ga0097621_100235025 3300006237 Bacteria 1601
215 Ga0097621_100289746 3300006237 Unclassified 1443
216 Ga0097621_100340003 3300006237 Bacteria 1333
217 Ga0068871_100001689 3300006358 Bacteria 14805
218 Ga0068871_100015528 3300006358 Bacteria 5703
219 Ga0068871_100042900 3300006358 Bacteria 3634
220 Ga0068871_100193376 3300006358 Bacteria 1753
221 Ga0068871_100309429 3300006358 Bacteria 1388
222 Ga0075433_10123222 3300006852 Bacteria 2303
223 Ga0075434_100000041 3300006871 Bacteria 59536
224 Ga0075434_100014319 3300006871 Bacteria 7580
225 Ga0075434_100044495 3300006871 Bacteria 4404
226 Ga0068865_100014673 3300006881 Bacteria 4984
227 Ga0068865_100082641 3300006881 Bacteria 2309
228 Ga0068865_100218907 3300006881 Bacteria 1487
229 Ga0068865_100405399 3300006881 Bacteria 1117
230 Ga0075436_100001699 3300006914 Bacteria 15073
231 Ga0075436_100003352 3300006914 Bacteria 10966
232 Ga0075436_100018543 3300006914 Bacteria 4763
233 Ga0075436_100046923 3300006914 Bacteria 2979
234 Ga0075436_100213360 3300006914 Bacteria 1369
235 Ga0097620_100137082 3300006931 Bacteria 2520
236 Ga0075435_100000105 3300007076 Bacteria 45736
237 Ga0075435_100108825 3300007076 Bacteria 2303
238 Ga0105250_10086019 3300009092 Bacteria 1276
239 Ga0105240_10244883 3300009093 Bacteria 2077
240 Ga0105240_10275300 3300009093 Bacteria 1936
241 Ga0105240_10304138 3300009093 Bacteria 1823
242 Ga0105240_10325513 3300009093 Bacteria 1750
243 Ga0105245_10000563 3300009098 Bacteria 33752
244 Ga0105245_10046124 3300009098 Unclassified 3894
245 Ga0105245_10202962 3300009098 Bacteria 1905
246 Ga0105245_10271936 3300009098 Bacteria 1653
247 Ga0105245_10337389 3300009098 Bacteria 1489
248 Ga0105247_10007660 3300009101 Bacteria 6608
249 Ga0105247_10101070 3300009101 Bacteria 1843
250 Ga0105247_10125500 3300009101 Bacteria 1668
251 Ga0105247_10398093 3300009101 Bacteria 980
252 Ga0105243_10083504 3300009148 Bacteria 2613
253 Ga0105243_10639190 3300009148 Bacteria 1030
254 Ga0105241_10033613 3300009174 Bacteria 3850
255 Ga0105241_10038179 3300009174 Unclassified 3620
256 Ga0105241_10176601 3300009174 Bacteria 1768
257 Ga0105241_10205297 3300009174 Bacteria 1648
258 Ga0105241_10366308 3300009174 Bacteria 1255
259 Ga0105241_10437478 3300009174 Bacteria 1154
260 Ga0105242_10034583 3300009176 Bacteria 4052
261 Ga0105242_10045488 3300009176 Bacteria 3558
262 Ga0105242_10046658 3300009176 Bacteria 3515
263 Ga0105242_10052001 3300009176 Bacteria 3341
264 Ga0105242_10106964 3300009176 Bacteria 2378
265 Ga0105248_10045188 3300009177 Bacteria 4939
266 Ga0105248_10162781 3300009177 Bacteria 2516
267 Ga0105248_10169761 3300009177 Bacteria 2458
268 Ga0105248_10344695 3300009177 Bacteria 1677
269 Ga0105237_10056086 3300009545 Bacteria 3945
270 Ga0105237_10080390 3300009545 Bacteria 3250
271 Ga0105237_10114122 3300009545 Bacteria 2694
272 Ga0105237_10355253 3300009545 Bacteria 1470
273 Ga0105238_10054824 3300009551 Bacteria 4003
274 Ga0105238_10073885 3300009551 Bacteria 3403
275 Ga0105238_10523231 3300009551 Bacteria 1189
276 Ga0105249_10018692 3300009553 Bacteria 6173
277 Ga0105249_10149965 3300009553 Bacteria 2244
278 Ga0105249_10153168 3300009553 Bacteria 2221
279 Ga0105239_10031532 3300010375 Bacteria 5828
280 Ga0105239_10032808 3300010375 Bacteria 5706
281 Ga0105239_10214638 3300010375 Bacteria 2157
282 Ga0105239_10289214 3300010375 Bacteria 1846
283 Ga0105239_10395115 3300010375 Unclassified 1564
284 Ga0105246_10004331 3300011119 Bacteria 8633
285 Ga0105246_10027874 3300011119 Bacteria 3707
286 Ga0157373_10005392 3300013100 Bacteria 9605
287 Ga0157373_10089836 3300013100 Bacteria 2163
288 Ga0157373_10096181 3300013100 Bacteria 2085
289 Ga0157373_10114197 3300013100 Bacteria 1898
290 Ga0157371_10012541 3300013102 Bacteria 6473
291 Ga0157370_10110052 3300013104 Bacteria 2575
292 Ga0157370_10217465 3300013104 Bacteria 1770
293 Ga0157369_10318819 3300013105 Bacteria 1616
294 Ga0157369_10321064 3300013105 Bacteria 1610
295 Ga0157369_10493087 3300013105 Bacteria 1267
296 Ga0157369_10559167 3300013105 Bacteria 1182
297 Ga0157374_10010549 3300013296 Bacteria 7953
298 Ga0157374_10018351 3300013296 Bacteria 6172
299 Ga0157374_10032515 3300013296 Bacteria 4751
300 Ga0157374_10034781 3300013296 Bacteria 4606
301 Ga0157374_10123225 3300013296 Bacteria 2504
302 Ga0157374_10347554 3300013296 Bacteria 1473
303 Ga0157378_10001969 3300013297 Bacteria 18390
304 Ga0157378_10086662 3300013297 Bacteria 2839
305 Ga0157378_10120859 3300013297 Bacteria 2414
306 Ga0157378_10278950 3300013297 Bacteria 1610
307 Ga0163162_10000822 3300013306 Bacteria 28869
308 Ga0163162_10004655 3300013306 Bacteria 13225
309 Ga0163162_10221322 3300013306 Bacteria 2023
310 Ga0163162_10393816 3300013306 Bacteria 1518
311 Ga0163162_10622924 3300013306 Bacteria 1204
312 Ga0157372_10020581 3300013307 Bacteria 7121
313 Ga0157372_10023668 3300013307 Bacteria 6663
314 Ga0157372_10079620 3300013307 Bacteria 3706
315 Ga0157372_10105979 3300013307 Bacteria 3215
316 Ga0157372_10291720 3300013307 Bacteria 1897
317 Ga0157375_10019511 3300013308 Bacteria 6168
318 Ga0157375_10082020 3300013308 Bacteria 3266
319 Ga0157375_10263164 3300013308 Bacteria 1886
320 Ga0163163_10037567 3300014325 Bacteria 4712
321 Ga0163163_10059760 3300014325 Bacteria 3772
322 Ga0163163_10093306 3300014325 Bacteria 3026
323 Ga0163163_11107872 3300014325 Bacteria 855
324 Ga0182008_10022201 3300014497 Unclassified 3251
325 Ga0182008_10030021 3300014497 Bacteria 2743
326 Ga0182008_10122049 3300014497 Bacteria 1295
327 Ga0157377_10020496 3300014745 Bacteria 3465
328 Ga0157377_10084800 3300014745 Bacteria 1859
329 Ga0157379_10009361 3300014968 Bacteria 8535
330 Ga0157379_10028741 3300014968 Bacteria 4944
331 Ga0157379_10075657 3300014968 Bacteria 3015
332 Ga0157379_10093724 3300014968 Bacteria 2694
333 Ga0157379_10107793 3300014968 Bacteria 2501
334 Ga0157379_10174670 3300014968 Bacteria 1939
335 Ga0157376_10050976 3300014969 Bacteria 3436
336 Ga0157376_10075158 3300014969 Bacteria 2883
337 Ga0182006_1028175 3300015261 Unclassified 2286
338 Ga0182007_10008105 3300015262 Bacteria 4337
339 Ga0163161_10513778 3300017792 Bacteria 977
340 Ga0213874_10003840 3300021377 Bacteria 3376
341 Ga0224569_100111 3300022732 Bacteria 5737
342 Ga0224572_1001227 3300024225 Unclassified 3685
343 Ga0228598_1000004 3300024227 Bacteria 30534
344 Ga0228598_1001692 3300024227 Bacteria 4828
345 Ga0228598_1013294 3300024227 Bacteria 1630
346 Ga0209025_1021428 3300025294 Bacteria 3482
347 Ga0207682_10010502 3300025893 Bacteria 3629
348 Ga0207692_10120895 3300025898 Bacteria 1466
349 Ga0207692_10135282 3300025898 Bacteria 1396
350 Ga0207692_10159309 3300025898 Bacteria 1299
351 Ga0207692_10175780 3300025898 Bacteria 1244
352 Ga0207692_10285169 3300025898 Bacteria 1000
353 Ga0207642_10013339 3300025899 Bacteria 2997
354 Ga0207642_10244055 3300025899 Bacteria 1016
355 Ga0207710_10019141 3300025900 Bacteria 2919
356 Ga0207710_10059450 3300025900 Bacteria 1730
357 Ga0207680_10150098 3300025903 Bacteria 1553
358 Ga0207647_10002414 3300025904 Bacteria 14165
359 Ga0207647_10021795 3300025904 Bacteria 4268
360 Ga0207685_10000631 3300025905 Bacteria 6200
361 Ga0207685_10019192 3300025905 Bacteria 2249
362 Ga0207685_10043921 3300025905 Bacteria 1687
363 Ga0207685_10183177 3300025905 Bacteria 972
364 Ga0207699_10000491 3300025906 Bacteria 19853
365 Ga0207699_10131390 3300025906 Bacteria 1634
366 Ga0207699_10171428 3300025906 Bacteria 1452
367 Ga0207699_10254987 3300025906 Bacteria 1210
368 Ga0207645_10005119 3300025907 Bacteria 9591
369 Ga0207645_10007907 3300025907 Bacteria 7473
370 Ga0207643_10000133 3300025908 Bacteria 50506
371 Ga0207705_10168814 3300025909 Bacteria 1647
372 Ga0207705_10275778 3300025909 Bacteria 1286
373 Ga0207684_10004183 3300025910 Bacteria 13705
374 Ga0207654_10001902 3300025911 Bacteria 10835
375 Ga0207654_10002085 3300025911 Bacteria 10239
376 Ga0207707_10006740 3300025912 Bacteria 10028
377 Ga0207707_10217262 3300025912 Bacteria 1664
378 Ga0207707_10461399 3300025912 Bacteria 1086
379 Ga0207695_10006005 3300025913 Bacteria 15875
380 Ga0207695_10157183 3300025913 Bacteria 2208
381 Ga0207695_10281716 3300025913 Bacteria 1556
382 Ga0207695_10371196 3300025913 Bacteria 1317
383 Ga0207671_10035235 3300025914 Bacteria 3716
384 Ga0207693_10000031 3300025915 Bacteria 117500
385 Ga0207693_10001029 3300025915 Bacteria 24949
386 Ga0207693_10004658 3300025915 Bacteria 11565
387 Ga0207693_10005542 3300025915 Bacteria 10501
388 Ga0207693_10010541 3300025915 Bacteria 7501
389 Ga0207693_10087010 3300025915 Bacteria 2449
390 Ga0207663_10001477 3300025916 Bacteria 10951
391 Ga0207663_10001507 3300025916 Bacteria 10874
392 Ga0207663_10003723 3300025916 Bacteria 7510
393 Ga0207663_10139943 3300025916 Unclassified 1684
394 Ga0207663_10165308 3300025916 Bacteria 1566
395 Ga0207660_10270422 3300025917 Bacteria 1346
396 Ga0207660_10292143 3300025917 Bacteria 1296
397 Ga0207660_10416267 3300025917 Bacteria 1083
398 Ga0207662_10073561 3300025918 Bacteria 2073
399 Ga0207657_10001503 3300025919 Bacteria 24928
400 Ga0207657_10001593 3300025919 Bacteria 24379
401 Ga0207649_10000241 3300025920 Bacteria 44222
402 Ga0207649_10031601 3300025920 Bacteria 3148
403 Ga0207652_10013464 3300025921 Bacteria 6619
404 Ga0207652_10130009 3300025921 Bacteria 2245
405 Ga0207652_10409399 3300025921 Bacteria 1223
406 Ga0207646_10119073 3300025922 Bacteria 2372
407 Ga0207646_10351202 3300025922 Bacteria 1333
408 Ga0207646_10507470 3300025922 Bacteria 1086
409 Ga0207694_10061498 3300025924 Bacteria 2923
410 Ga0207650_10000124 3300025925 Bacteria 97031
411 Ga0207659_10094976 3300025926 Bacteria 2235
412 Ga0207687_10008822 3300025927 Bacteria 6591
413 Ga0207687_10056635 3300025927 Bacteria 2750
414 Ga0207687_10072337 3300025927 Unclassified 2466
415 Ga0207687_10096714 3300025927 Bacteria 2165
416 Ga0207700_10000160 3300025928 Bacteria 40173
417 Ga0207700_10006581 3300025928 Bacteria 7036
418 Ga0207700_10032259 3300025928 Bacteria 3734
419 Ga0207700_10047280 3300025928 Bacteria 3188
420 Ga0207700_10096058 3300025928 Bacteria 2352
421 Ga0207700_10103759 3300025928 Bacteria 2274
422 Ga0207700_10177307 3300025928 Bacteria 1782
423 Ga0207700_10282559 3300025928 Bacteria 1428
424 Ga0207664_10000582 3300025929 Bacteria 25512
425 Ga0207664_10128155 3300025929 Bacteria 2133
426 Ga0207664_10191142 3300025929 Bacteria 1762
427 Ga0207664_10271524 3300025929 Bacteria 1486
428 Ga0207664_10310646 3300025929 Bacteria 1389
429 Ga0207644_10115344 3300025931 Bacteria 2037
430 Ga0207690_10030631 3300025932 Bacteria 3434
431 Ga0207706_10000389 3300025933 Bacteria 47573
432 Ga0207706_10006249 3300025933 Bacteria 11073
433 Ga0207706_10056596 3300025933 Bacteria 3457
434 Ga0207686_10028881 3300025934 Bacteria 3265
435 Ga0207686_10133681 3300025934 Bacteria 1704
436 Ga0207686_10276480 3300025934 Bacteria 1238
437 Ga0207670_10074306 3300025936 Bacteria 2359
438 Ga0207670_10455724 3300025936 Bacteria 1032
439 Ga0207704_10086311 3300025938 Bacteria 2046
440 Ga0207665_10000147 3300025939 Bacteria 47628
441 Ga0207665_10005444 3300025939 Bacteria 8497
442 Ga0207665_10008366 3300025939 Bacteria 6827
443 Ga0207665_10017982 3300025939 Bacteria 4647
444 Ga0207665_10021074 3300025939 Bacteria 4284
445 Ga0207665_10023251 3300025939 Bacteria 4082
446 Ga0207665_10027128 3300025939 Bacteria 3784
447 Ga0207665_10091019 3300025939 Bacteria 2115
448 Ga0207665_10243989 3300025939 Bacteria 1325
449 Ga0207711_10004244 3300025941 Bacteria 12262
450 Ga0207711_10035926 3300025941 Bacteria 4202
451 Ga0207689_10009150 3300025942 Bacteria 8573
452 Ga0207689_10011845 3300025942 Bacteria 7469
453 Ga0207689_10062743 3300025942 Bacteria 3056
454 Ga0207661_10001087 3300025944 Bacteria 18062
455 Ga0207661_10017574 3300025944 Bacteria 5296
456 Ga0207679_10000084 3300025945 Bacteria 82946
457 Ga0207679_10140057 3300025945 Bacteria 1954
458 Ga0207667_10087011 3300025949 Bacteria 3233
459 Ga0207667_10161815 3300025949 Bacteria 2302
460 Ga0207651_10118931 3300025960 Bacteria 1999
461 Ga0207712_10009116 3300025961 Bacteria 6278
462 Ga0207712_10208142 3300025961 Bacteria 1556
463 Ga0207668_10013144 3300025972 Bacteria 5087
464 Ga0207668_10040244 3300025972 Unclassified 3152
465 Ga0207640_10411341 3300025981 Bacteria 1104
466 Ga0207658_10014114 3300025986 Bacteria 5471
467 Ga0207658_10077952 3300025986 Bacteria 2530
468 Ga0207703_10003183 3300026035 Bacteria 13813
469 Ga0207703_10178233 3300026035 Bacteria 1874
470 Ga0207703_10248459 3300026035 Bacteria 1602
471 Ga0207703_10474245 3300026035 Bacteria 1172
472 Ga0207678_10001143 3300026067 Bacteria 24340
473 Ga0207708_10028910 3300026075 Bacteria 4198
474 Ga0207702_10008415 3300026078 Bacteria 8703
475 Ga0207702_10027557 3300026078 Unclassified 4718
476 Ga0207641_10000006 3300026088 Bacteria 442569
477 Ga0207641_10177890 3300026088 Bacteria 1946
478 Ga0207641_10179476 3300026088 Bacteria 1938
479 Ga0207648_10001425 3300026089 Bacteria 26347
480 Ga0207648_10031311 3300026089 Bacteria 4703
481 Ga0207676_10000132 3300026095 Bacteria 65936
482 Ga0207676_10286978 3300026095 Bacteria 1497
483 Ga0207674_10000556 3300026116 Bacteria 48859
484 Ga0207674_10017835 3300026116 Bacteria 7738
485 Ga0207675_100033172 3300026118 Bacteria 4811
486 Ga0207675_100095099 3300026118 Bacteria 2803
487 Ga0207675_100097785 3300026118 Bacteria 2764
488 Ga0207683_10007717 3300026121 Bacteria 9215
489 Ga0207698_10017954 3300026142 Bacteria 4810
490 Ga0207698_10019763 3300026142 Bacteria 4619
491 Ga0265356_1000354 3300028017 Bacteria 8373
492 Ga0268266_10179515 3300028379 Bacteria 1927
493 Ga0268265_10031603 3300028380 Bacteria 3824
494 Ga0268265_10108391 3300028380 Bacteria 2261
495 Ga0268265_10167886 3300028380 Bacteria 1872
496 Ga0268264_10021753 3300028381 Bacteria 5235
497 Ga0268264_10022661 3300028381 Bacteria 5125
498 Ga0268264_10165358 3300028381 Bacteria 1997
499 Ga0268264_10231429 3300028381 Unclassified 1707
500 Ga0265338_10060051 3300028800 Bacteria 3345
501 Ga0265338_10084182 3300028800 Unclassified 2656
502 Ga0265338_10157775 3300028800 Bacteria 1755
503 Ga0265338_10332248 3300028800 Unclassified 1097
504 Ga0265762_1000869 3300030760 Bacteria 5386
505 Ga0265765_1008673 3300030879 Bacteria 1110
506 Ga0265760_10000174 3300031090 Bacteria 16947
507 Ga0265760_10001409 3300031090 Bacteria 7074
508 Ga0265760_10003429 3300031090 Unclassified 4607
509 Ga0265760_10003881 3300031090 Unclassified 4329
510 Ga0265760_10108841 3300031090 Bacteria 881
511 Ga0265328_10132170 3300031239 Bacteria 934
512 Ga0265325_10003981 3300031241 Bacteria 9452
513 Ga0265340_10003431 3300031247 Bacteria 8951
514 Ga0265340_10064551 3300031247 Bacteria 1745
515 Ga0265339_10003817 3300031249 Bacteria 10475
516 Ga0265339_10058183 3300031249 Bacteria 2088
517 Ga0265331_10172006 3300031250 Bacteria 980
518 Ga0265327_10022339 3300031251 Bacteria 3787
519 Ga0265316_10038595 3300031344 Bacteria 3846
520 Ga0265316_10048330 3300031344 Bacteria 3359
521 Ga0265316_10202380 3300031344 Bacteria 1471
522 Ga0316575_10021261 3300031665 Bacteria 2496
523 Ga0316575_10043607 3300031665 Bacteria 1778
524 Ga0316579_10001629 3300031691 Bacteria 8228
525 Ga0316579_10012060 3300031691 Bacteria 3690
526 Ga0265314_10049506 3300031711 Bacteria 2941
527 Ga0265342_10083547 3300031712 Bacteria 1840
528 Ga0316576_10022106 3300031727 Bacteria 4413
529 Ga0316576_10087652 3300031727 Bacteria 2316
530 Ga0316576_10193959 3300031727 Bacteria 1531
531 Ga0316576_10238131 3300031727 Bacteria 1368
532 Ga0316576_10269025 3300031727 Unclassified 1278
533 Ga0316578_10027752 3300031728 Bacteria 3201
534 Ga0316578_10087094 3300031728 Bacteria 1862
535 Ga0316578_10200691 3300031728 Bacteria 1201
536 Ga0316578_10202823 3300031728 Bacteria 1194
537 Ga0316578_10208351 3300031728 Bacteria 1176
538 Ga0316577_10000049 3300031733 Bacteria 27873
539 Ga0316577_10000314 3300031733 Bacteria 17713
540 Ga0316577_10002818 3300031733 Bacteria 8675
541 Ga0316577_10005721 3300031733 Bacteria 6528
542 Ga0316577_10009616 3300031733 Bacteria 5204
543 Ga0316577_10016212 3300031733 Bacteria 4103
544 Ga0316577_10136933 3300031733 Bacteria 1379
545 Ga0316577_10241483 3300031733 Bacteria 1022
546 Ga0307413_10000444 3300031824 Bacteria 13439
547 Ga0307416_100681861 3300032002 Bacteria 1115
548 Ga0316585_10002466 3300032137 Bacteria 4987
549 Ga0373934_0012252 3300035086 Bacteria 3237
550 Ga0373923_0034729 3300035111 Bacteria 2048
551 Ga0373923_0073326 3300035111 Bacteria 1474
552 Ga0373936_0067514 3300035113 Unclassified 1470
553 Ga0373953_0019557 3300035117 Bacteria 2521
554 Ga0373954_0008040 3300035118 Bacteria 4622
555 Ga0373943_0031051 3300035170 Unclassified 2532
556 Ga0373943_0147866 3300035170 Bacteria 1271
557 Ga0373946_0025185 3300035171 Bacteria 2338
558 Ga0373955_0130743 3300035172 Bacteria 1465
559 Ga0373942_0023783 3300035207 Bacteria 1567
560 Ga0316574_0079633 3300035398 Bacteria 2078
561 Ga0316574_0151720 3300035398 Bacteria 1493
562 Ga0316574_0256574 3300035398 Bacteria 1117
563 Ga0373924_0140202 3300035410 Unclassified 1055
564 Ga0373935_0006013 3300035692 Bacteria 7207
565 Ga0373935_0151866 3300035692 Bacteria 1572
566 Ga0373935_0311163 3300035692 Bacteria 1115
567 Ga0373927_0000292 3300035695 Bacteria 39594
568 Ga0373933_0025679 3300035724 Bacteria 3379
569 Ga0373933_0035991 3300035724 Bacteria 2895
570 Ga0373933_0216741 3300035724 Bacteria 1227
571 Ga0373947_0025848 3300035725 Bacteria 3425
572 Ga0373937_0055834 3300036401 Bacteria 3626
573 Ga0373937_0103447 3300036401 Bacteria 2645
574 Ga0373937_0196295 3300036401 Bacteria 1897
575 Ga0316582_0001904 3300036647 Bacteria 9501
576 Ga0316582_0023025 3300036647 Bacteria 3707
577 Ga0316582_0035925 3300036647 Bacteria 3064
578 Ga0316582_0070284 3300036647 Bacteria 2265
579 Ga0316582_0133968 3300036647 Bacteria 1666
580 Ga0316584_0002073 3300036712 Bacteria 12550
581 Ga0316584_0005287 3300036712 Bacteria 8648
582 Ga0316584_0005604 3300036712 Bacteria 8450
583 Ga0316584_0020602 3300036712 Bacteria 4784
584 Ga0316584_0025072 3300036712 Bacteria 4371
585 Ga0316584_0077282 3300036712 Bacteria 2494
586 Ga0316584_0180824 3300036712 Bacteria 1561
587 Ga0373925_0001535 3300037068 Bacteria 19685
588 Ga0373925_0026667 3300037068 Bacteria 4229
589 Ga0373925_0297798 3300037068 Bacteria 1302
590 Ga0395905_0503305 3300037471 Bacteria 1112
591 Ga0316581_0000989 3300037588 Bacteria 6070
592 Ga0436365_0726991 3300039437 Bacteria 2270
593 Ga0436360_1345289 3300039438 Bacteria 1690
594 Ga0436363_0557136 3300039450 Bacteria 4864
595 Ga0436362_1272274 3300039453 Bacteria 2302
596 Ga0466963_0026412 3300044694 Bacteria 3714
597 Ga0466964_0080234 3300044706 Unclassified 1399
598 Ga0466964_0082977 3300044706 Bacteria 1379
599 Ga0466971_0210370 3300044719 Bacteria 920
600 Ga0466957_0087019 3300044842 Bacteria 1953
601 Ga0451576_0072825 3300045051 Bacteria 3575
602 Ga0451576_0074752 3300045051 Bacteria 3526
603 Ga0451576_0770455 3300045051 Bacteria 1011
604 Ga0466958_0047968 3300045836 Bacteria 2579
605 Ga0466967_0062580 3300045976 Bacteria 3304
606 Ga0466967_0897600 3300045976 Bacteria 881
607 Ga0495590_0041918 3300046457 Bacteria 1596
608 Ga0495629_0074850 3300046459 Bacteria 2364
609 Ga0495641_0060039 3300046461 Bacteria 1718
610 Ga0495653_0102841 3300046463 Bacteria 2067
611 Ga0495580_0000340 3300046472 Bacteria 38108
612 Ga0495580_0000509 3300046472 Bacteria 32716
613 Ga0495580_0004340 3300046472 Bacteria 11903
614 Ga0495580_0008423 3300046472 Bacteria 8203
615 Ga0495580_0011550 3300046472 Bacteria 6831
616 Ga0495580_0055636 3300046472 Unclassified 2787
617 Ga0495580_0110370 3300046472 Bacteria 1910
618 Ga0495582_0038669 3300046473 Bacteria 2626
619 Ga0495664_0065991 3300046477 Bacteria 2158
620 Ga0495584_0180176 3300046491 Bacteria 1074
621 Ga0495594_0237456 3300046499 Bacteria 1039
622 Ga0495628_0096384 3300046516 Bacteria 2285
623 Ga0495665_0040453 3300046531 Bacteria 2482
624 Ga0495587_0027758 3300046536 Bacteria 3446
625 Ga0495657_0079415 3300046675 Bacteria 2125
626 Ga0495657_0198492 3300046675 Bacteria 1224
627 Ga0495647_0047854 3300046681 Bacteria 1652
628 Ga0495581_0192845 3300047315 Bacteria 1192
629 Ga0495674_0484187 3300047319 Bacteria 991
630 Ga0495675_0062390 3300047444 Bacteria 2360
631 Ga0495602_0108905 3300048088 Bacteria 2255
632 Ga0495602_0176016 3300048088 Bacteria 1655
633 Ga0496100_0073880 3300048903 Bacteria 2283
634 Ga0496100_0271235 3300048903 Bacteria 1262
635 Ga0496101_0017475 3300048904 Bacteria 4866
636 Ga0496101_0177072 3300048904 Bacteria 1641
637 Ga0496101_0179642 3300048904 Bacteria 1629
638 Ga0496101_0280253 3300048904 Bacteria 1303
639 Ga0496102_0016545 3300048905 Bacteria 6445
640 Ga0496102_0056758 3300048905 Unclassified 3573
641 Ga0496102_0092193 3300048905 Bacteria 2805
642 Ga0496102_0128323 3300048905 Bacteria 2372
643 Ga0496102_0144303 3300048905 Bacteria 2233
644 Ga0496102_0195694 3300048905 Bacteria 1905
645 Ga0496102_0439968 3300048905 Bacteria 1223
646 Ga0496102_0707548 3300048905 Bacteria 930
647 Ga0496103_0054240 3300048906 Unclassified 2485
648 Ga0496103_0236080 3300048906 Bacteria 1176
649 Ga0496103_0255987 3300048906 Bacteria 1126
650 Ga0496104_0031320 3300048907 Bacteria 4945
651 Ga0496104_0075030 3300048907 Bacteria 3220
652 Ga0496104_0199958 3300048907 Bacteria 1910
653 Ga0496104_0360605 3300048907 Bacteria 1366
654 Ga0496104_0421854 3300048907 Bacteria 1246
655 Ga0496105_0117049 3300048908 Bacteria 2198
656 Ga0496105_0287545 3300048908 Bacteria 1324
657 Ga0496106_0020771 3300048909 Bacteria 4873
658 Ga0496106_0099109 3300048909 Bacteria 2259
659 Ga0496106_0328431 3300048909 Bacteria 1228
660 Ga0496107_0071442 3300048910 Bacteria 2522
661 Ga0496107_0253921 3300048910 Bacteria 1308
662 Ga0496108_0000495 3300048911 Bacteria 31371
663 Ga0496108_0030375 3300048911 Bacteria 4478
664 Ga0496108_0223831 3300048911 Bacteria 1635
665 Ga0496108_0236207 3300048911 Bacteria 1590
666 Ga0496108_0603984 3300048911 Bacteria 956
667 Ga0496109_0000149 3300048912 Bacteria 68979
668 Ga0496109_0470095 3300048912 Bacteria 1187
669 Ga0496110_0018231 3300048913 Bacteria 5882
670 Ga0496111_0068948 3300048914 Bacteria 2571
671 Ga0496112_0000070 3300048915 Bacteria 67934
672 Ga0496112_0027725 3300048915 Bacteria 5462
673 Ga0496112_0059357 3300048915 Bacteria 3769
674 Ga0496112_0094779 3300048915 Bacteria 2956
675 Ga0496112_0140087 3300048915 Bacteria 2388
676 Ga0496112_0153449 3300048915 Bacteria 2270
677 Ga0496112_0221752 3300048915 Bacteria 1847
678 Ga0496112_0521770 3300048915 Bacteria 1122
679 Ga0496113_0000078 3300048916 Bacteria 42516
680 Ga0496113_0016272 3300048916 Bacteria 5134
681 Ga0496113_0152875 3300048916 Bacteria 1821
682 Ga0496113_0215881 3300048916 Bacteria 1528
683 Ga0496114_0316789 3300048917 Bacteria 1378
684 Ga0496114_0399256 3300048917 Bacteria 1217
685 Ga0496115_0007315 3300048918 Bacteria 8120
686 Ga0496115_0180446 3300048918 Bacteria 1745
687 Ga0496115_0573907 3300048918 Bacteria 899
688 Ga0501067_0000021 3300049583 Bacteria 97413
689 Ga0501067_0060804 3300049583 Bacteria 2091
690 Ga0501068_0000684 3300049584 Bacteria 17330
691 Ga0501069_0000095 3300049585 Bacteria 41483
692 Ga0501070_0069998 3300049586 Bacteria 2905
693 Ga0501076_0537275 3300049592 Bacteria 964
694 nmdc:mga08y16_254489_c1 3300050511 Bacteria 1814
695 nmdc:mga0n895_12227_c2 3300050512 Bacteria 6225
696 nmdc:mga0n895_12481_c1 3300050512 Bacteria 7624
697 nmdc:mga0n895_386_c1 3300050512 Bacteria 29872
698 nmdc:mga0rr50_284_c1 3300050513 Bacteria 27442
699 nmdc:mga0rr50_30680_c1 3300050513 Bacteria 3809
700 nmdc:mga08x19_1022_c1 3300050514 Bacteria 17442
701 nmdc:mga08x19_18945_c1 3300050514 Bacteria 4220
702 nmdc:mga08x19_7561_c1 3300050514 Bacteria 6458
703 nmdc:mga0a205_146440_c1 3300050515 Bacteria 2262
704 Ga0495612_0159311 3300053078 Bacteria 985
705 Ga0495619_0150586 3300053085 Bacteria 1605
706 Ga0530510_0057004 3300061734 Bacteria 2823
707 2513722325 2513237104 Bacteria 10034502
708 2791214025 2788500588 Bacteria 4584915
709 2857467562 2857465823 Bacteria 6772595
710 2857593521 2857591370 Bacteria 6569758
711 2906634160 2906626472 Bacteria 8826946
712 Ga0070709_10103369
713 LJNas_1002090
714 JGI25151J46595_10027924
715 Ga0065715_10009720
716 Ga0070658_10036315
717 Ga0070658_10155084
718 Ga0070658_10322706
719 Ga0070676_10006347
720 Ga0070676_10124301
721 Ga0070683_100002634
722 Ga0070683_100079868
723 Ga0070690_100018812
724 Ga0070670_100198177
725 Ga0070677_10005282
726 Ga0068869_100022425
727 Ga0068869_100024527
728 Ga0070666_10017198
729 Ga0070666_10137397
730 Ga0070680_100130490
731 Ga0070682_100020786
732 Ga0070682_100047705
733 Ga0070682_100114486
734 Ga0068868_100001732
735 Ga0068868_100005079
736 Ga0068868_100037089
737 Ga0068868_100066267
738 Ga0068868_100257495
739 Ga0070660_100002663
740 Ga0070660_100015316
741 Ga0070660_100072836
742 Ga0070660_100174860
743 Ga0070689_100009733
744 Ga0070689_100025654
745 Ga0070687_100019056
746 Ga0070661_100005786
747 Ga0070661_100299413
748 Ga0070692_10092564
749 Ga0070668_100019735
750 Ga0070668_100080607
751 Ga0070669_100007505
752 Ga0070669_100016363
753 Ga0070675_100024719
754 Ga0070671_100350631
755 Ga0070674_100033875
756 Ga0070673_100056861
757 Ga0070688_100122853
758 Ga0070659_100031295
759 Ga0070659_100054051
760 Ga0070659_100115492
761 Ga0070659_100178331
762 Ga0070667_100544642
763 Ga0070709_10000171
764 Ga0070709_10044338
765 Ga0070709_10205656
766 Ga0070714_100000074
767 Ga0070714_100022978
768 Ga0070714_100126423
769 Ga0070714_100157153
770 Ga0070714_100176199
771 Ga0070714_100185757
772 Ga0070713_100000029
773 Ga0070713_100005399
774 Ga0070713_100012824
775 Ga0070713_100119636
776 Ga0070713_100138251
777 Ga0070713_100142244
778 Ga0070713_100240950
779 Ga0070710_10011275
780 Ga0070710_10037703
781 Ga0070710_10084338
782 Ga0070711_100000079
783 Ga0070711_100000531
784 Ga0070711_100016610
785 Ga0070711_100021958
786 Ga0070711_100042256
787 Ga0070711_100274261
788 Ga0070711_100559123
789 Ga0070705_100087404
790 Ga0070700_100071856
791 Ga0070700_100523620
792 Ga0070694_100147642
793 Ga0070708_100024351
794 Ga0070708_100028817
795 Ga0070708_100044277
796 Ga0070708_100058985
797 Ga0070708_100102903
798 Ga0070708_100121028
799 Ga0070663_100045968
800 Ga0070663_100131260
801 Ga0070662_100001639
802 Ga0070662_100138205
803 Ga0070681_10072329
804 Ga0070681_10151413
805 Ga0070681_10285293
806 Ga0068867_100027614
807 Ga0068867_100139969
808 Ga0070685_10005079
809 Ga0070706_100000479
810 Ga0070706_100035828
811 Ga0070706_100046278
812 Ga0070707_100143024
813 Ga0070707_100384074
814 Ga0070698_100121262
815 Ga0070698_100148809
816 Ga0070699_100035250
817 Ga0070699_100123252
818 Ga0070679_100041877
819 Ga0070679_100073874
820 Ga0070679_100263804
821 Ga0070679_100300092
822 Ga0070684_100013231
823 Ga0070684_100033996
824 Ga0070684_100149267
825 Ga0070684_100284046
826 Ga0070697_100000031
827 Ga0070697_100000967
828 Ga0070697_100032137
829 Ga0070697_100087557
830 Ga0070697_100190758
831 Ga0068853_100039692
832 Ga0068853_100058137
833 Ga0068853_100099791
834 Ga0068853_100164518
835 Ga0070672_100008487
836 Ga0070686_100004849
837 Ga0070686_100309461
838 Ga0070696_100048718
839 Ga0070693_100023741
840 Ga0070693_100039412
841 Ga0070693_100125981
842 Ga0070665_100324391
843 Ga0070665_100482728
844 Ga0068855_100021308
845 Ga0068855_100056535
846 Ga0070664_100009088
847 Ga0070664_100014550
848 Ga0070664_100174971
849 Ga0070664_100208874
850 Ga0068857_100092724
851 Ga0068854_100017637
852 Ga0068854_100039038
853 Ga0068854_100065716
854 Ga0068854_100074781
855 Ga0068856_100006407
856 Ga0068856_100009226
857 Ga0068856_100063269
858 Ga0068856_100249725
859 Ga0068856_100309112
860 Ga0070702_100015282
861 Ga0070702_100035998
862 Ga0068852_100003785
863 Ga0068852_100007483
864 Ga0068852_100372545
865 Ga0068859_100137093
866 Ga0068864_100176767
867 Ga0068864_100328724
868 Ga0068866_10015260
869 Ga0068866_10110843
870 Ga0068866_10127397
871 Ga0068866_10341320
872 Ga0068861_100042909
873 Ga0068861_100054860
874 Ga0068851_10026790
875 Ga0068851_10048805
876 Ga0068870_10053948
877 Ga0068863_100140351
878 Ga0068863_100143148
879 Ga0068863_100194556
880 Ga0068863_100260441
881 Ga0068858_100004943
882 Ga0068858_100024973
883 Ga0068858_100270680
884 Ga0068860_100067128
885 Ga0068860_100130119
886 Ga0068860_100131383
887 Ga0068860_100132011
888 Ga0068860_100159088
889 Ga0068862_100021739
890 Ga0068862_100022898
891 Ga0068862_100192210
892 Ga0081540_1159728
893 Ga0070717_10003539
894 Ga0070717_10003613
895 Ga0070717_10005829
896 Ga0070717_10007234
897 Ga0070717_10051701
898 Ga0070717_10141100
899 Ga0070717_10143480
900 Ga0070717_10162335
901 Ga0070717_10606355
902 Ga0070717_10755385
903 Ga0070715_10026697
904 Ga0070715_10026835
905 Ga0070715_10177028
906 Ga0070716_100000682
907 Ga0070716_100006656
908 Ga0070716_100019619
909 Ga0070716_100033201
910 Ga0070716_100042929
911 Ga0070716_100043280
912 Ga0070716_100071084
913 Ga0070716_100198377
914 Ga0070716_100290683
915 Ga0070712_100000211
916 Ga0070712_100002276
917 Ga0070712_100006922
918 Ga0070712_100014961
919 Ga0070712_100039622
920 Ga0070712_100125419
921 Ga0097621_100001039
922 Ga0097621_100019199
923 Ga0097621_100020291
924 Ga0097621_100115237
925 Ga0097621_100235025
926 Ga0097621_100289746
927 Ga0097621_100340003
928 Ga0068871_100001689
929 Ga0068871_100015528
930 Ga0068871_100042900
931 Ga0068871_100193376
932 Ga0068871_100309429
933 Ga0075433_10123222
934 Ga0075434_100000041
935 Ga0075434_100014319
936 Ga0075434_100044495
937 Ga0068865_100014673
938 Ga0068865_100082641
939 Ga0068865_100218907
940 Ga0068865_100405399
941 Ga0075436_100001699
942 Ga0075436_100003352
943 Ga0075436_100018543
944 Ga0075436_100046923
945 Ga0075436_100213360
946 Ga0097620_100137082
947 Ga0075435_100000105
948 Ga0075435_100108825
949 Ga0105250_10086019
950 Ga0105240_10244883
951 Ga0105240_10275300
952 Ga0105240_10304138
953 Ga0105240_10325513
954 Ga0105245_10000563
955 Ga0105245_10046124
956 Ga0105245_10202962
957 Ga0105245_10271936
958 Ga0105245_10337389
959 Ga0105247_10007660
960 Ga0105247_10101070
961 Ga0105247_10125500
962 Ga0105247_10398093
963 Ga0105243_10083504
964 Ga0105243_10639190
965 Ga0105241_10033613
966 Ga0105241_10038179
967 Ga0105241_10176601
968 Ga0105241_10205297
969 Ga0105241_10366308
970 Ga0105241_10437478
971 Ga0105242_10034583
972 Ga0105242_10045488
973 Ga0105242_10046658
974 Ga0105242_10052001
975 Ga0105242_10106964
976 Ga0105248_10045188
977 Ga0105248_10162781
978 Ga0105248_10169761
979 Ga0105248_10344695
980 Ga0105237_10056086
981 Ga0105237_10080390
982 Ga0105237_10114122
983 Ga0105237_10355253
984 Ga0105238_10054824
985 Ga0105238_10073885
986 Ga0105238_10523231
987 Ga0105249_10018692
988 Ga0105249_10149965
989 Ga0105249_10153168
990 Ga0105239_10031532
991 Ga0105239_10032808
992 Ga0105239_10214638
993 Ga0105239_10289214
994 Ga0105239_10395115
995 Ga0105246_10004331
996 Ga0105246_10027874
997 Ga0157373_10005392
998 Ga0157373_10089836
999 Ga0157373_10096181
1000 Ga0157373_10114197
1001 Ga0157371_10012541
1002 Ga0157370_10110052
1003 Ga0157370_10217465
1004 Ga0157369_10318819
1005 Ga0157369_10321064
1006 Ga0157369_10493087
1007 Ga0157369_10559167
1008 Ga0157374_10010549
1009 Ga0157374_10018351
1010 Ga0157374_10032515
1011 Ga0157374_10034781
1012 Ga0157374_10123225
1013 Ga0157374_10347554
1014 Ga0157378_10001969
1015 Ga0157378_10086662
1016 Ga0157378_10120859
1017 Ga0157378_10278950
1018 Ga0163162_10000822
1019 Ga0163162_10004655
1020 Ga0163162_10221322
1021 Ga0163162_10393816
1022 Ga0163162_10622924
1023 Ga0157372_10020581
1024 Ga0157372_10023668
1025 Ga0157372_10079620
1026 Ga0157372_10105979
1027 Ga0157372_10291720
1028 Ga0157375_10019511
1029 Ga0157375_10082020
1030 Ga0157375_10263164
1031 Ga0163163_10037567
1032 Ga0163163_10059760
1033 Ga0163163_10093306
1034 Ga0163163_11107872
1035 Ga0182008_10022201
1036 Ga0182008_10030021
1037 Ga0182008_10122049
1038 Ga0157377_10020496
1039 Ga0157377_10084800
1040 Ga0157379_10009361
1041 Ga0157379_10028741
1042 Ga0157379_10075657
1043 Ga0157379_10093724
1044 Ga0157379_10107793
1045 Ga0157379_10174670
1046 Ga0157376_10050976
1047 Ga0157376_10075158
1048 Ga0182006_1028175
1049 Ga0182007_10008105
1050 Ga0163161_10513778
1051 Ga0213874_10003840
1052 Ga0224569_100111
1053 Ga0224572_1001227
1054 Ga0228598_1000004
1055 Ga0228598_1001692
1056 Ga0228598_1013294
1057 Ga0209025_1021428
1058 Ga0207682_10010502
1059 Ga0207692_10120895
1060 Ga0207692_10135282
1061 Ga0207692_10159309
1062 Ga0207692_10175780
1063 Ga0207692_10285169
1064 Ga0207642_10013339
1065 Ga0207642_10244055
1066 Ga0207710_10019141
1067 Ga0207710_10059450
1068 Ga0207680_10150098
1069 Ga0207647_10002414
1070 Ga0207647_10021795
1071 Ga0207685_10000631
1072 Ga0207685_10019192
1073 Ga0207685_10043921
1074 Ga0207685_10183177
1075 Ga0207699_10000491
1076 Ga0207699_10131390
1077 Ga0207699_10171428
1078 Ga0207699_10254987
1079 Ga0207645_10005119
1080 Ga0207645_10007907
1081 Ga0207643_10000133
1082 Ga0207705_10168814
1083 Ga0207705_10275778
1084 Ga0207684_10004183
1085 Ga0207654_10001902
1086 Ga0207654_10002085
1087 Ga0207707_10006740
1088 Ga0207707_10217262
1089 Ga0207707_10461399
1090 Ga0207695_10006005
1091 Ga0207695_10157183
1092 Ga0207695_10281716
1093 Ga0207695_10371196
1094 Ga0207671_10035235
1095 Ga0207693_10000031
1096 Ga0207693_10001029
1097 Ga0207693_10004658
1098 Ga0207693_10005542
1099 Ga0207693_10010541
1100 Ga0207693_10087010
1101 Ga0207663_10001477
1102 Ga0207663_10001507
1103 Ga0207663_10003723
1104 Ga0207663_10139943
1105 Ga0207663_10165308
1106 Ga0207660_10270422
1107 Ga0207660_10292143
1108 Ga0207660_10416267
1109 Ga0207662_10073561
1110 Ga0207657_10001503
1111 Ga0207657_10001593
1112 Ga0207649_10000241
1113 Ga0207649_10031601
1114 Ga0207652_10013464
1115 Ga0207652_10130009
1116 Ga0207652_10409399
1117 Ga0207646_10119073
1118 Ga0207646_10351202
1119 Ga0207646_10507470
1120 Ga0207694_10061498
1121 Ga0207650_10000124
1122 Ga0207659_10094976
1123 Ga0207687_10008822
1124 Ga0207687_10056635
1125 Ga0207687_10072337
1126 Ga0207687_10096714
1127 Ga0207700_10000160
1128 Ga0207700_10006581
1129 Ga0207700_10032259
1130 Ga0207700_10047280
1131 Ga0207700_10096058
1132 Ga0207700_10103759
1133 Ga0207700_10177307
1134 Ga0207700_10282559
1135 Ga0207664_10000582
1136 Ga0207664_10128155
1137 Ga0207664_10191142
1138 Ga0207664_10271524
1139 Ga0207664_10310646
1140 Ga0207644_10115344
1141 Ga0207690_10030631
1142 Ga0207706_10000389
1143 Ga0207706_10006249
1144 Ga0207706_10056596
1145 Ga0207686_10028881
1146 Ga0207686_10133681
1147 Ga0207686_10276480
1148 Ga0207670_10074306
1149 Ga0207670_10455724
1150 Ga0207704_10086311
1151 Ga0207665_10000147
1152 Ga0207665_10005444
1153 Ga0207665_10008366
1154 Ga0207665_10017982
1155 Ga0207665_10021074
1156 Ga0207665_10023251
1157 Ga0207665_10027128
1158 Ga0207665_10091019
1159 Ga0207665_10243989
1160 Ga0207711_10004244
1161 Ga0207711_10035926
1162 Ga0207689_10009150
1163 Ga0207689_10011845
1164 Ga0207689_10062743
1165 Ga0207661_10001087
1166 Ga0207661_10017574
1167 Ga0207679_10000084
1168 Ga0207679_10140057
1169 Ga0207667_10087011
1170 Ga0207667_10161815
1171 Ga0207651_10118931
1172 Ga0207712_10009116
1173 Ga0207712_10208142
1174 Ga0207668_10013144
1175 Ga0207668_10040244
1176 Ga0207640_10411341
1177 Ga0207658_10014114
1178 Ga0207658_10077952
1179 Ga0207703_10003183
1180 Ga0207703_10178233
1181 Ga0207703_10248459
1182 Ga0207703_10474245
1183 Ga0207678_10001143
1184 Ga0207708_10028910
1185 Ga0207702_10008415
1186 Ga0207702_10027557
1187 Ga0207641_10000006
1188 Ga0207641_10177890
1189 Ga0207641_10179476
1190 Ga0207648_10001425
1191 Ga0207648_10031311
1192 Ga0207676_10000132
1193 Ga0207676_10286978
1194 Ga0207674_10000556
1195 Ga0207674_10017835
1196 Ga0207675_100033172
1197 Ga0207675_100095099
1198 Ga0207675_100097785
1199 Ga0207683_10007717
1200 Ga0207698_10017954
1201 Ga0207698_10019763
1202 Ga0265356_1000354
1203 Ga0268266_10179515
1204 Ga0268265_10031603
1205 Ga0268265_10108391
1206 Ga0268265_10167886
1207 Ga0268264_10021753
1208 Ga0268264_10022661
1209 Ga0268264_10165358
1210 Ga0268264_10231429
1211 Ga0265338_10060051
1212 Ga0265338_10084182
1213 Ga0265338_10157775
1214 Ga0265338_10332248
1215 Ga0265762_1000869
1216 Ga0265765_1008673
1217 Ga0265760_10000174
1218 Ga0265760_10001409
1219 Ga0265760_10003429
1220 Ga0265760_10003881
1221 Ga0265760_10108841
1222 Ga0265328_10132170
1223 Ga0265325_10003981
1224 Ga0265340_10003431
1225 Ga0265340_10064551
1226 Ga0265339_10003817
1227 Ga0265339_10058183
1228 Ga0265331_10172006
1229 Ga0265327_10022339
1230 Ga0265316_10038595
1231 Ga0265316_10048330
1232 Ga0265316_10202380
1233 Ga0316575_10021261
1234 Ga0316575_10043607
1235 Ga0316579_10001629
1236 Ga0316579_10012060
1237 Ga0265314_10049506
1238 Ga0265342_10083547
1239 Ga0316576_10022106
1240 Ga0316576_10087652
1241 Ga0316576_10193959
1242 Ga0316576_10238131
1243 Ga0316576_10269025
1244 Ga0316578_10027752
1245 Ga0316578_10087094
1246 Ga0316578_10200691
1247 Ga0316578_10202823
1248 Ga0316578_10208351
1249 Ga0316577_10000049
1250 Ga0316577_10000314
1251 Ga0316577_10002818
1252 Ga0316577_10005721
1253 Ga0316577_10009616
1254 Ga0316577_10016212
1255 Ga0316577_10136933
1256 Ga0316577_10241483
1257 Ga0307413_10000444
1258 Ga0307416_100681861
1259 Ga0316585_10002466
1260 Ga0373934_0012252
1261 Ga0373923_0034729
1262 Ga0373923_0073326
1263 Ga0373936_0067514
1264 Ga0373953_0019557
1265 Ga0373954_0008040
1266 Ga0373943_0031051
1267 Ga0373943_0147866
1268 Ga0373946_0025185
1269 Ga0373955_0130743
1270 Ga0373942_0023783
1271 Ga0316574_0079633
1272 Ga0316574_0151720
1273 Ga0316574_0256574
1274 Ga0373924_0140202
1275 Ga0373935_0006013
1276 Ga0373935_0151866
1277 Ga0373935_0311163
1278 Ga0373927_0000292
1279 Ga0373933_0025679
1280 Ga0373933_0035991
1281 Ga0373933_0216741
1282 Ga0373947_0025848
1283 Ga0373937_0055834
1284 Ga0373937_0103447
1285 Ga0373937_0196295
1286 Ga0316582_0001904
1287 Ga0316582_0023025
1288 Ga0316582_0035925
1289 Ga0316582_0070284
1290 Ga0316582_0133968
1291 Ga0316584_0002073
1292 Ga0316584_0005287
1293 Ga0316584_0005604
1294 Ga0316584_0020602
1295 Ga0316584_0025072
1296 Ga0316584_0077282
1297 Ga0316584_0180824
1298 Ga0373925_0001535
1299 Ga0373925_0026667
1300 Ga0373925_0297798
1301 Ga0395905_0503305
1302 Ga0316581_0000989
1303 Ga0436365_0726991
1304 Ga0436360_1345289
1305 Ga0436363_0557136
1306 Ga0436362_1272274
1307 Ga0466963_0026412
1308 Ga0466964_0080234
1309 Ga0466964_0082977
1310 Ga0466971_0210370
1311 Ga0466957_0087019
1312 Ga0451576_0072825
1313 Ga0451576_0074752
1314 Ga0451576_0770455
1315 Ga0466958_0047968
1316 Ga0466967_0062580
1317 Ga0466967_0897600
1318 Ga0495590_0041918
1319 Ga0495629_0074850
1320 Ga0495641_0060039
1321 Ga0495653_0102841
1322 Ga0495580_0000340
1323 Ga0495580_0000509
1324 Ga0495580_0004340
1325 Ga0495580_0008423
1326 Ga0495580_0011550
1327 Ga0495580_0055636
1328 Ga0495580_0110370
1329 Ga0495582_0038669
1330 Ga0495664_0065991
1331 Ga0495584_0180176
1332 Ga0495594_0237456
1333 Ga0495628_0096384
1334 Ga0495665_0040453
1335 Ga0495587_0027758
1336 Ga0495657_0079415
1337 Ga0495657_0198492
1338 Ga0495647_0047854
1339 Ga0495581_0192845
1340 Ga0495674_0484187
1341 Ga0495675_0062390
1342 Ga0495602_0108905
1343 Ga0495602_0176016
1344 Ga0496100_0073880
1345 Ga0496100_0271235
1346 Ga0496101_0017475
1347 Ga0496101_0177072
1348 Ga0496101_0179642
1349 Ga0496101_0280253
1350 Ga0496102_0016545
1351 Ga0496102_0056758
1352 Ga0496102_0092193
1353 Ga0496102_0128323
1354 Ga0496102_0144303
1355 Ga0496102_0195694
1356 Ga0496102_0439968
1357 Ga0496102_0707548
1358 Ga0496103_0054240
1359 Ga0496103_0236080
1360 Ga0496103_0255987
1361 Ga0496104_0031320
1362 Ga0496104_0075030
1363 Ga0496104_0199958
1364 Ga0496104_0360605
1365 Ga0496104_0421854
1366 Ga0496105_0117049
1367 Ga0496105_0287545
1368 Ga0496106_0020771
1369 Ga0496106_0099109
1370 Ga0496106_0328431
1371 Ga0496107_0071442
1372 Ga0496107_0253921
1373 Ga0496108_0000495
1374 Ga0496108_0030375
1375 Ga0496108_0223831
1376 Ga0496108_0236207
1377 Ga0496108_0603984
1378 Ga0496109_0000149
1379 Ga0496109_0470095
1380 Ga0496110_0018231
1381 Ga0496111_0068948
1382 Ga0496112_0000070
1383 Ga0496112_0027725
1384 Ga0496112_0059357
1385 Ga0496112_0094779
1386 Ga0496112_0140087
1387 Ga0496112_0153449
1388 Ga0496112_0221752
1389 Ga0496112_0521770
1390 Ga0496113_0000078
1391 Ga0496113_0016272
1392 Ga0496113_0152875
1393 Ga0496113_0215881
1394 Ga0496114_0316789
1395 Ga0496114_0399256
1396 Ga0496115_0007315
1397 Ga0496115_0180446
1398 Ga0496115_0573907
1399 Ga0501067_0000021
1400 Ga0501067_0060804
1401 Ga0501068_0000684
1402 Ga0501069_0000095
1403 Ga0501070_0069998
1404 Ga0501076_0537275
1405 nmdc:mga08y16_254489_c1
1406 nmdc:mga0n895_12227_c2
1407 nmdc:mga0n895_12481_c1
1408 nmdc:mga0n895_386_c1
1409 nmdc:mga0rr50_284_c1
1410 nmdc:mga0rr50_30680_c1
1411 nmdc:mga08x19_1022_c1
1412 nmdc:mga08x19_18945_c1
1413 nmdc:mga08x19_7561_c1
1414 nmdc:mga0a205_146440_c1
1415 Ga0495612_0159311
1416 Ga0495619_0150586
1417 Ga0530510_0057004
1418 2513722325
1419 2791214025
1420 2857467562
1421 2857593521
1422 2906634160

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

38

227

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

44

272

0.96

PF08659

KR

KR domain

39

200

0.9

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

40

250

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
5itv-assembly1.cif.gz_A crystal structure of bacillus subtilis bacc dihydroanticapsin 7-dehydrogenase in complex with nadh 0.9777 4 244
4npc-assembly1.cif.gz_A crystal structure of an oxidoreductase, short-chain dehydrogenase/reductase family protein from brucella suis 0.9666 6 244
4nbu-assembly1.cif.gz_D crystal structure of fabg from bacillus sp 0.9663 4 241
4i5d-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form 0.9658 4 243
3vzr-assembly1.cif.gz_B crystal structure of t173s mutant of phab from ralstonia eutropha 0.9646 6 242
ID Description Score Start End Superfamily
5itvA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9777 4 244 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9668 88 182 3.40.50.720
4npcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9666 6 244 3.40.50.720
4urfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9645 4 244 3.40.50.720
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9612 80 242 3.40.50.720
ID Description Score Start End GO Terms
AF-X1CRD0-F1-model_v4 Oxidoreductase 0.9936 32 245 GO:0016491
AF-A0A7C6YIY1-F1-model_v4 SDR family oxidoreductase 0.9925 4 182 GO:0016491
AF-A0A497JZN1-F1-model_v4 Oxidoreductase 0.9909 1 168 GO:0006633
GO:0016616
GO:0048038
AF-A0A7J2WRN1-F1-model_v4 SDR family oxidoreductase 0.9825 4 244 GO:0016491
AF-A0A497JZN1-F1-model_v4 Oxidoreductase 0.9793 1 168 GO:0006633
GO:0016616
GO:0048038

Map