F476633

General Info

Members Datasets Scaffolds Average Seq Length
709 586 256 344

Family's Representative Sequence

Representative Sequence 3300005262|Ga0065165_1001892|Ga0065165_100189210
Length 356
Sequence MKTRIVRLHGQQDIRIETGEVAVPGHGEVALRMAVGGICGSDLHYYQDGGFGPVRVREPIICGHEASGFVAAHGEGVSFPPLGALVAVNPSQPCGTCAQCAKGQPIHCLNMRFMGSAMRLPHEQGMFRNLLVVPAKQCFAVSEGISAAEAACAEPLAVCLHAVAQAGPLSGAKVLVTGAGPIGLLVMAAARAAGATEIVATDLADAALERAPAMGATSVINVAQDAQALARYEANKGYFDIAFDCSAAAPALRSAFATVKPRGIVVQVGVTGDVTIPLNALVGKEITWRGSQRFDREFGQAVDLISSRTIDVRPIISHTFPLEQAVQAFEQAGDRTQACKVQIDLGTEASPFGVVA

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
8 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
9 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
10 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
11 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
12 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
13 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
14 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
15 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
16 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
17 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
18 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
19 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
20 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
21 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
22 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
23 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
24 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
25 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
26 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
27 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
28 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
29 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
30 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
31 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
32 2516143018 Ensifer sp. BR816 Isolate Nodule
33 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
34 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
35 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
36 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
37 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
38 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
39 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
40 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
41 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
42 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
43 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
44 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
45 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
46 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
47 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
48 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
49 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
50 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
51 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
52 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
53 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
54 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
55 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
56 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
57 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
58 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
59 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
60 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
61 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
62 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
63 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
64 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
65 2643221558 Rhizobium sp. Root149 Isolate Unclassified
66 2643221568 Rhizobium sp. Root564 Isolate Unclassified
67 2643221582 Rhizobium sp. Root651 Isolate Unclassified
68 2643221693 Rhizobium sp. Root491 Isolate Unclassified
69 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
70 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
71 2718217882 Rhizobium sp. N741 Isolate Nodule
72 2718217927 Rhizobium sp. N324 Isolate Nodule
73 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
74 2718218009 Rhizobium sp. N561 Isolate Nodule
75 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
76 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
77 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
78 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
79 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
80 2718218363 Rhizobium sp. N113 Isolate Nodule
81 2718218365 Rhizobium sp. N731 Isolate Nodule
82 2718218366 Rhizobium sp. N621 Isolate Nodule
83 2718218423 Rhizobium sp. N941 Isolate Nodule
84 2721755514 Rhizobium sp. N6212 Isolate Nodule
85 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
86 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
87 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
88 2721755809 Rhizobium sp. N541 Isolate Nodule
89 2721755810 Rhizobium sp. N871 Isolate Nodule
90 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
91 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
92 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
93 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
94 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
95 2728369365 Rhizobium sp. N1341 Isolate Nodule
96 2728369397 Rhizobium sp. N1314 Isolate Nodule
97 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
98 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
99 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
100 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
101 2791355256 Rhizobium sp. M10 Isolate Nodule
102 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
103 2791355260 Rhizobium sp. L9 Isolate Nodule
104 2791355261 Rhizobium sp. J15 Isolate Nodule
105 2791355262 Rhizobium sp. M1 Isolate Nodule
106 2791355263 Rhizobium chutanense C5 Isolate Nodule
107 2791355264 Rhizobium sp. S9 Isolate Nodule
108 2791355265 Rhizobium sp. H4 Isolate Nodule
109 2791355266 Rhizobium sp. L43 Isolate Nodule
110 2791355267 Rhizobium sp. L18 Isolate Nodule
111 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
112 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
113 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
114 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
115 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
116 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
117 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
118 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
119 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
120 2802429633 Rhizobium anhuiense J3 Isolate Nodule
121 2802429634 Rhizobium anhuiense S10 Isolate Nodule
122 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
123 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
124 2802429637 Rhizobium anhuiense C15 Isolate Nodule
125 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
126 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
127 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
128 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
129 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
130 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
131 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
132 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
133 2838048938 Rhizobium pisi 27/80 Isolate Nodule
134 2838061910 Rhizobium phaseoli L15 Isolate Nodule
135 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
136 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
137 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
138 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
139 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
140 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
141 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
142 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
143 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
144 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
145 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
146 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
147 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
148 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
149 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
150 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
151 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
152 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
153 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
154 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
155 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
156 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
157 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
158 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
159 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
160 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
161 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
162 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
163 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
164 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
165 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
166 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
167 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
168 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
169 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
170 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
171 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
172 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
173 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
174 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
175 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
176 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
177 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
178 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
179 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
180 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
181 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
182 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
183 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
184 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
185 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
186 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
187 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
188 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
189 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
190 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
191 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
192 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
193 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
194 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
195 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
196 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
197 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
198 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
199 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
200 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
201 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
202 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
203 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
204 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
205 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
206 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
207 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
208 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
209 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
210 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
211 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
212 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
213 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
214 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
215 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
216 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
217 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
218 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
219 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
220 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
221 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
222 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
223 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
224 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
225 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
226 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
227 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
228 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
229 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
230 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
231 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
232 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
233 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
234 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
235 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
236 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
237 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
238 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
239 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
240 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
241 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
242 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
243 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
244 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
245 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
246 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
247 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
248 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
249 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
250 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
251 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
252 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
253 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
254 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
255 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
256 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
257 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
258 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
259 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
260 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
261 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
262 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
263 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
264 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
265 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
266 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
267 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
268 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
269 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
270 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
271 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
272 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
273 2933599457 Rhizobium phaseoli M3 Isolate Nodule
274 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
275 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
276 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
277 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
278 2936381700 Rhizobium chutanense C16 Isolate Unclassified
279 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
280 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
281 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
282 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
283 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
284 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
285 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
286 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
287 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
288 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
289 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
290 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
291 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
292 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
293 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
294 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
295 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
296 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
297 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
298 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
299 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
300 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
301 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
302 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
303 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
304 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
305 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
306 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
307 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
308 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
309 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
310 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
311 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
312 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
313 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
314 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
315 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
316 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
317 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
318 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
319 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
320 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
321 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
322 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
323 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
324 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
325 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
326 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
327 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
328 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
329 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
330 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
331 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
332 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
333 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
334 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
335 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
336 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
337 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
338 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
339 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
340 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
341 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
342 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
343 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
344 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
345 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
346 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
347 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
348 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
349 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
350 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
351 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
352 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
353 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
354 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
355 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
356 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
357 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
358 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
359 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
360 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
361 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
362 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
363 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
364 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
365 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
366 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
367 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
368 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
369 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
370 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
371 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
372 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
373 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
374 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
375 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
376 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
377 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
378 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
379 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
380 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
381 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
382 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
383 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
384 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
385 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
386 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
387 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
388 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
389 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
390 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
391 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
392 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
393 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
394 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
395 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
396 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
397 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
398 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
399 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
400 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
401 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
402 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
403 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
404 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
405 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
406 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
407 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
408 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
409 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
410 2996893221 Rhizobium sp. R635 Isolate Nodule
411 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
412 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
413 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
414 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
415 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
416 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
417 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
418 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
419 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
420 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
421 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
422 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
423 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
424 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
425 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
426 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
427 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
428 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
429 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
430 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
431 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
432 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
433 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
434 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
435 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
436 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
437 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
438 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
439 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
440 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
441 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
442 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
443 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
444 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
445 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
446 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
447 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
448 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
449 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
450 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
451 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
452 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
453 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
454 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
455 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
456 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
457 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
458 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
459 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
460 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
461 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
462 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
463 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
464 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
465 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
466 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
467 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
468 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
469 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
470 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
471 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
472 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
473 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
474 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
475 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
476 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
477 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
478 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
479 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
480 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
481 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
482 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
483 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
484 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
485 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
486 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
487 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
488 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
489 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
490 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
491 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
492 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
493 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
494 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
495 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
496 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
497 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
498 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
499 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
500 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
501 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
502 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
503 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
504 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
505 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
506 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
507 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
508 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
509 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
510 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
511 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
512 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
513 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
514 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
515 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
516 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
517 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
518 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
519 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
520 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
521 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
522 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
523 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
524 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
525 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
526 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
527 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
528 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
529 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
530 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
531 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
532 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
533 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
534 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
535 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
536 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
537 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
538 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
539 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
540 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
541 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
542 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
543 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
544 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
545 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
546 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
547 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
548 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
549 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
550 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
551 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
552 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
553 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
554 8005275841 Rhizobium sp. N4311 Isolate Nodule
555 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
556 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
557 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
558 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
559 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
560 8005382845 Rhizobium sp. R634 Isolate Nodule
561 8005395548 Rhizobium sp. R339 Isolate Nodule
562 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
563 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
564 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
565 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
566 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
567 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
568 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
569 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
570 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
571 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
572 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
573 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
574 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
575 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
576 8018176218 Rhizobium sp. N122 Isolate Nodule
577 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
578 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
579 8024501048 Rhizobium sp. H4 Isolate Nodule
580 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
581 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
582 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
583 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
584 8056382006 Rhizobium croatiense 13T Isolate Nodule
585 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
586 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 36.25
Metatranscriptomes 0
Isolates 63.75

Biome Distribution

Category Percentage (%)
Aerial Root 0.56
Bulb 0
Endosphere 16.22
Nodule 55.15
Rhizoplane 1.41
Rhizosphere 12.55
Stem 0
Stem Tuber 0.14
Unclassified 13.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1005787 3300002773 Bacteria 3514
2 JGI25150J39212_1005684 3300002774 Bacteria 2640
3 JGI25159J45721_1001409 3300002987 Bacteria 9986
4 JGI25151J46595_10000463 3300003187 Bacteria 38967
5 JGI25151J46595_10006059 3300003187 Bacteria 6153
6 rootH2_10270668 3300003320 Bacteria 1805
7 JGI25160J50197_1001923 3300003354 Bacteria 9929
8 JGI25161J50226_1000233 3300003374 Bacteria 33741
9 Ga0055526_1000645 3300003771 Bacteria 27078
10 Ga0055526_1004150 3300003771 Bacteria 8819
11 Ga0055526_1010598 3300003771 Bacteria 4267
12 Ga0055524_1000751 3300003775 Bacteria 22061
13 Ga0055524_1007851 3300003775 Bacteria 4490
14 Ga0055524_1037128 3300003775 Bacteria 1297
15 Ga0055528_1000054 3300003790 Bacteria 90334
16 Ga0055528_1000343 3300003790 Bacteria 38462
17 Ga0055528_1000764 3300003790 Bacteria 22452
18 Ga0055528_1003240 3300003790 Bacteria 8302
19 Ga0055528_1016049 3300003790 Bacteria 2670
20 Ga0055540_1000077 3300003792 Bacteria 114283
21 Ga0055540_1002166 3300003792 Bacteria 10702
22 Ga0055531_10001197 3300003794 Bacteria 19909
23 Ga0055543_1000717 3300004625 Bacteria 16806
24 Ga0055543_1001585 3300004625 Bacteria 8771
25 Ga0065165_1001892 3300005262 Bacteria 20185
26 Ga0065165_1004487 3300005262 Bacteria 8597
27 Ga0065165_1013020 3300005262 Bacteria 3337
28 Ga0070680_100054567 3300005336 Unclassified 3264
29 Ga0070682_100011228 3300005337 Bacteria 5111
30 Ga0070669_100090852 3300005353 Bacteria 2289
31 Ga0070679_100002484 3300005530 Bacteria 16709
32 Ga0070665_100071218 3300005548 Bacteria 3483
33 Ga0070665_100094351 3300005548 Bacteria 2997
34 Ga0068852_100004512 3300005616 Bacteria 9846
35 Ga0081539_10001089 3300005985 Bacteria 49350
36 Ga0075365_10000718 3300006038 Bacteria 13398
37 Ga0075365_10090718 3300006038 Bacteria 2081
38 Ga0075363_100041718 3300006048 Bacteria 2421
39 Ga0075362_10007441 3300006177 Bacteria 4148
40 Ga0075362_10053491 3300006177 Bacteria 1812
41 Ga0075367_10002993 3300006178 Bacteria 7906
42 Ga0075369_10001157 3300006186 Bacteria 8907
43 Ga0075369_10047214 3300006186 Bacteria 1856
44 Ga0075370_10004883 3300006353 Bacteria 6580
45 Ga0075370_10099409 3300006353 Bacteria 1683
46 Ga0079104_1000044 3300006946 Bacteria 185367
47 Ga0105243_10062848 3300009148 Bacteria 2974
48 Ga0123341_1000044 3300009765 Bacteria 52707
49 Ga0157370_10000211 3300013104 Bacteria 74012
50 Ga0157370_10198425 3300013104 Bacteria 1862
51 Ga0157369_10537776 3300013105 Bacteria 1208
52 Ga0157380_10277227 3300014326 Bacteria 1532
53 Ga0228710_1002752 3300022740 Bacteria 27893
54 Ga0209436_100007 3300025208 Bacteria 149841
55 Ga0207425_1007114 3300025245 Bacteria 2989
56 Ga0209129_1000082 3300025258 Bacteria 183436
57 Ga0209129_1001482 3300025258 Bacteria 13045
58 Ga0209129_1002994 3300025258 Bacteria 7699
59 Ga0209129_1008444 3300025258 Bacteria 2863
60 Ga0209673_1000005 3300025273 Bacteria 692788
61 Ga0209673_1000067 3300025273 Bacteria 249077
62 Ga0209673_1000294 3300025273 Bacteria 93050
63 Ga0209673_1000968 3300025273 Bacteria 35620
64 Ga0209673_1006587 3300025273 Bacteria 5563
65 Ga0209673_1008320 3300025273 Bacteria 4628
66 Ga0209130_1000001 3300025284 Bacteria 831557
67 Ga0209676_1015393 3300025292 Bacteria 2816
68 Ga0209676_1024411 3300025292 Bacteria 1959
69 Ga0209676_1041295 3300025292 Bacteria 1290
70 Ga0209025_1000260 3300025294 Bacteria 124240
71 Ga0209025_1000974 3300025294 Bacteria 42899
72 Ga0209025_1001148 3300025294 Bacteria 37707
73 Ga0209025_1002894 3300025294 Bacteria 17153
74 Ga0209025_1011728 3300025294 Bacteria 5723
75 Ga0209025_1045579 3300025294 Bacteria 1816
76 Ga0209564_1000092 3300025295 Bacteria 249018
77 Ga0209564_1000336 3300025295 Bacteria 90930
78 Ga0209564_1010119 3300025295 Bacteria 4388
79 Ga0209758_1000113 3300025297 Bacteria 202528
80 Ga0209758_1000203 3300025297 Bacteria 132184
81 Ga0209758_1005269 3300025297 Bacteria 10114
82 Ga0209758_1015387 3300025297 Bacteria 3965
83 Ga0209758_1021975 3300025297 Bacteria 2948
84 Ga0209758_1027418 3300025297 Bacteria 2434
85 Ga0209050_1006608 3300025298 Bacteria 6808
86 Ga0209050_1019591 3300025298 Bacteria 2562
87 Ga0209256_1000170 3300025299 Bacteria 130504
88 Ga0209256_1000475 3300025299 Bacteria 60194
89 Ga0209256_1001533 3300025299 Bacteria 23225
90 Ga0209256_1002121 3300025299 Bacteria 17205
91 Ga0207426_1000045 3300025302 Bacteria 422847
92 Ga0207426_1000282 3300025302 Bacteria 104108
93 Ga0209051_1000027 3300025303 Bacteria 412172
94 Ga0209051_1002417 3300025303 Bacteria 13419
95 Ga0209051_1004473 3300025303 Bacteria 8601
96 Ga0209051_1037274 3300025303 Bacteria 1785
97 Ga0209257_1000691 3300025304 Bacteria 52348
98 Ga0207705_10033863 3300025909 Bacteria 3650
99 Ga0207652_10002120 3300025921 Bacteria 17031
100 Ga0207681_10054605 3300025923 Bacteria 2717
101 Ga0207709_10092104 3300025935 Bacteria 1984
102 Ga0207698_10006661 3300026142 Bacteria 7221
103 Ga0209281_1000129 3300027111 Bacteria 194490
104 Ga0209281_1000805 3300027111 Bacteria 28809
105 Ga0209371_1000012 3300027312 Bacteria 748304
106 Ga0209371_1000472 3300027312 Bacteria 39594
107 Ga0209282_1000038 3300027666 Bacteria 128955
108 Ga0209282_1000323 3300027666 Bacteria 23657
109 Ga0268266_10052280 3300028379 Bacteria 3508
110 Ga0268266_10141180 3300028379 Bacteria 2162
111 Ga0307515_10003037 3300028794 Bacteria 35563
112 Ga0268256_1000013 3300030500 Bacteria 752103
113 Ga0307513_10001322 3300031456 Bacteria 35853
114 Ga0307405_10151806 3300031731 Bacteria 1630
115 Ga0315914_1002543 3300031967 Bacteria 27893
116 Ga0307409_100156252 3300031995 Bacteria 1988
117 Ga0315913_1001156 3300033430 Bacteria 27893
118 Ga0315915_1000018 3300033464 Bacteria 129799
119 Ga0439436_0019154 3300041404 Bacteria 2044
120 Ga0439438_033080 3300041405 Bacteria 1367
121 Ga0451839_1524206 3300041496 Bacteria 1452
122 Ga0451845_0192919 3300041501 Bacteria 3126
123 Ga0451853_0632566 3300041512 Bacteria 1410
124 Ga0439432_054299 3300042006 Bacteria 1245
125 Ga0439449_0010942 3300042007 Bacteria 3424
126 Ga0439449_0026773 3300042007 Bacteria 2152
127 Ga0439462_0025340 3300042015 Bacteria 1561
128 Ga0439434_0046352 3300042435 Bacteria 1342
129 Ga0450918_007935 3300042531 Bacteria 1869
130 Ga0495638_0000475 3300046460 Bacteria 48300
131 Ga0495605_0031644 3300046474 Bacteria 2701
132 Ga0495585_0040812 3300046492 Bacteria 2604
133 Ga0495583_0024196 3300046506 Bacteria 3057
134 Ga0495583_0029588 3300046506 Bacteria 2678
135 Ga0495583_0046858 3300046506 Bacteria 1992
136 Ga0495606_0081199 3300046507 Bacteria 2016
137 Ga0495606_0089417 3300046507 Bacteria 1897
138 Ga0495610_0045893 3300046512 Bacteria 2159
139 Ga0495610_0074257 3300046512 Bacteria 1578
140 Ga0495620_0041462 3300046515 Bacteria 2019
141 Ga0495631_0036479 3300046518 Bacteria 2195
142 Ga0495631_0049466 3300046518 Bacteria 1840
143 Ga0495632_0025705 3300046519 Bacteria 3111
144 Ga0495643_0027999 3300046522 Bacteria 3162
145 Ga0495643_0080282 3300046522 Bacteria 1698
146 Ga0495643_0100912 3300046522 Bacteria 1479
147 Ga0495648_0012073 3300046524 Bacteria 6468
148 Ga0495654_0000122 3300046530 Bacteria 86717
149 Ga0495597_0031452 3300046542 Bacteria 2415
150 Ga0495633_0031574 3300046558 Bacteria 2566
151 Ga0495668_0006686 3300046616 Bacteria 7508
152 Ga0495625_0011467 3300046660 Bacteria 7226
153 Ga0495625_0061451 3300046660 Bacteria 2658
154 Ga0495625_0189234 3300046660 Bacteria 1364
155 Ga0495625_0222987 3300046660 Bacteria 1234
156 Ga0495660_0054123 3300046810 Bacteria 2175
157 Ga0495672_0034652 3300047320 Bacteria 3116
158 Ga0495686_0051117 3300047472 Bacteria 2594
159 Ga0496106_0000355 3300048909 Bacteria 32404
160 Ga0496106_0072756 3300048909 Bacteria 2629
161 Ga0496106_0117347 3300048909 Bacteria 2077
162 Ga0496111_0000161 3300048914 Bacteria 30179
163 Ga0496113_0161241 3300048916 Bacteria 1773
164 Ga0496113_0164650 3300048916 Bacteria 1754
165 Ga0496116_0000243 3300048919 Bacteria 99201
166 Ga0496116_0060407 3300048919 Bacteria 2459
167 Ga0496116_0103442 3300048919 Bacteria 1695
168 Ga0496117_0000016 3300048920 Bacteria 523642
169 Ga0496117_0010901 3300048920 Bacteria 8196
170 Ga0496117_0071346 3300048920 Bacteria 2328
171 Ga0496118_0000758 3300048921 Bacteria 52123
172 Ga0496118_0038673 3300048921 Bacteria 3820
173 Ga0496118_0079532 3300048921 Bacteria 2313
174 Ga0496118_0208951 3300048921 Bacteria 1147
175 Ga0496119_0054285 3300048922 Bacteria 2440
176 Ga0496119_0064759 3300048922 Bacteria 2169
177 Ga0496120_0000056 3300048923 Bacteria 180367
178 Ga0496120_0024193 3300048923 Bacteria 3790
179 Ga0496120_0136931 3300048923 Bacteria 1247
180 Ga0496121_0000005 3300048924 Bacteria 1034486
181 Ga0496121_0010821 3300048924 Bacteria 10209
182 Ga0496121_0012780 3300048924 Bacteria 9094
183 Ga0496121_0043504 3300048924 Bacteria 3888
184 Ga0496121_0160059 3300048924 Bacteria 1647
185 Ga0496121_0179687 3300048924 Bacteria 1528
186 Ga0496122_0000002 3300048925 Bacteria 905834
187 Ga0496122_0000106 3300048925 Bacteria 193672
188 Ga0496122_0013925 3300048925 Bacteria 7821
189 Ga0496122_0014427 3300048925 Bacteria 7643
190 Ga0496122_0017699 3300048925 Bacteria 6637
191 Ga0496122_0034340 3300048925 Bacteria 4152
192 Ga0496123_0000002 3300048926 Bacteria 1811682
193 Ga0496123_0000022 3300048926 Bacteria 361832
194 Ga0496123_0033644 3300048926 Bacteria 3685
195 Ga0496123_0063411 3300048926 Bacteria 2361
196 Ga0496123_0164124 3300048926 Bacteria 1180
197 Ga0496124_0000428 3300048927 Bacteria 75094
198 Ga0496124_0010860 3300048927 Bacteria 9165
199 Ga0496124_0013787 3300048927 Bacteria 7865
200 Ga0496124_0107526 3300048927 Bacteria 2250
201 Ga0496124_0157051 3300048927 Bacteria 1777
202 Ga0496124_0159395 3300048927 Bacteria 1760
203 Ga0496124_0281749 3300048927 Bacteria 1211
204 Ga0496125_0000449 3300048928 Bacteria 74908
205 Ga0496125_0012755 3300048928 Bacteria 8310
206 Ga0496125_0172388 3300048928 Bacteria 1452
207 Ga0496125_0178738 3300048928 Bacteria 1417
208 Ga0496126_0000554 3300048929 Bacteria 71982
209 Ga0496126_0029711 3300048929 Bacteria 5188
210 Ga0496126_0037995 3300048929 Bacteria 4482
211 Ga0496126_0043552 3300048929 Bacteria 4140
212 Ga0496126_0101091 3300048929 Bacteria 2522
213 Ga0496126_0298679 3300048929 Bacteria 1329
214 Ga0495678_027712 3300049459 Bacteria 2400
215 Ga0495678_089889 3300049459 Bacteria 1084
216 Ga0501034_0016696 3300049571 Bacteria 7527
217 Ga0501034_0538431 3300049571 Bacteria 1078
218 Ga0501036_0372924 3300049572 Unclassified 1191
219 Ga0501037_0015498 3300049573 Bacteria 5609
220 Ga0501047_0160375 3300049581 Bacteria 2121
221 Ga0501068_0025318 3300049584 Bacteria 3490
222 nmdc:mga03683_1248_c1 3300050489 Bacteria 7531
223 nmdc:mga03683_23601_c1 3300050489 Bacteria 2398
224 nmdc:mga03n38_20411_c1 3300050490 Bacteria 2651
225 nmdc:mga00v17_3_c1 3300050491 Bacteria 242367
226 nmdc:mga00v17_52367_c1 3300050491 Bacteria 2483
227 nmdc:mga00v17_675_c1 3300050491 Bacteria 18761
228 nmdc:mga0yw44_128_c2 3300050492 Bacteria 13634
229 nmdc:mga0yw44_14433_c1 3300050492 Bacteria 4196
230 nmdc:mga06z11_47172_c1 3300050494 Bacteria 2187
231 nmdc:mga07m45_54669_c1 3300050496 Bacteria 2256
232 nmdc:mga07m45_67369_c1 3300050496 Bacteria 2034
233 nmdc:mga07m45_98519_c1 3300050496 Bacteria 1678
234 nmdc:mga0sz30_149459_c1 3300050516 Bacteria 1033
235 nmdc:mga0sz30_149_c1 3300050516 Bacteria 26106
236 nmdc:mga0sz30_9496_c1 3300050516 Bacteria 3705
237 Ga0500578_0077778 3300053086 Bacteria 2112
238 Ga0500578_0107874 3300053086 Bacteria 1757
239 Ga0500560_000033 3300053107 Bacteria 15664
240 Ga0500569_003815 3300053109 Bacteria 3120
241 Ga0500594_0028460 3300053118 Bacteria 1454
242 Ga0500618_000285 3300053125 Bacteria 38522
243 Ga0500618_004046 3300053125 Bacteria 4817
244 Ga0500618_009223 3300053125 Bacteria 2704
245 Ga0500658_0001040 3300053134 Bacteria 11339
246 Ga0500561_0000034 3300053137 Bacteria 28171
247 Ga0500568_0000109 3300053139 Bacteria 76714
248 Ga0500568_0003149 3300053139 Bacteria 9399
249 Ga0500616_0000472 3300053153 Bacteria 52191
250 Ga0500616_0055614 3300053153 Bacteria 2068
251 Ga0500616_0115566 3300053153 Bacteria 1289
252 Ga0500622_0000134 3300053156 Bacteria 78418
253 Ga0500624_000323 3300053157 Bacteria 16314
254 Ga0500633_0011394 3300053160 Bacteria 2416
255 Ga0500634_0102160 3300053161 Bacteria 1432
256 Ga0500599_004290 3300053736 Bacteria 1762

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049459 Ga0495678_089889 Ga0495678_089889_173_1030 285
2 3300048926 Ga0496123_0063411 Ga0496123_0063411_1481_2347 288
3 3300013105 Ga0157369_10537776 Ga0157369_105377762 300
4 3300048924 Ga0496121_0179687 Ga0496121_0179687_32_970 312
5 3300048926 Ga0496123_0164124 Ga0496123_0164124_53_994 312
6 3300049571 Ga0501034_0538431 Ga0501034_0538431_110_1054 313
7 3300048928 Ga0496125_0178738 Ga0496125_0178738_435_1382 315
8 3300050516 nmdc:mga0sz30_149459_c1 nmdc:mga0sz30_149459_c1_64_1014 315
9 3300049572 Ga0501036_0372924 Ga0501036_0372924_209_1174 318
10 3300048923 Ga0496120_0136931 Ga0496120_0136931_251_1213 319
11 3300053125 Ga0500618_009223 Ga0500618_009223_1701_2666 319
12 iso_pu_bacteria 2551306090 2551716764 325
13 iso_pu_bacteria 2960631154 2960637886 333
14 3300003792 Ga0055540_1000077 Ga0055540_100007769 335
15 3300025292 Ga0209676_1041295 Ga0209676_10412952 335
16 3300025298 Ga0209050_1019591 Ga0209050_10195912 335
17 3300025303 Ga0209051_1000027 Ga0209051_1000027268 335
18 3300053125 Ga0500618_004046 Ga0500618_004046_524_1573 339
19 iso_pu_bacteria 2513237144 2513910532 339
20 iso_pu_bacteria 2513237146 2513927963 339
21 iso_pu_bacteria 2599185170 2599420973 339
22 iso_pu_bacteria 2838035591 2838041333 339
23 iso_pu_bacteria 2838661181 2838665726 339
24 iso_pu_bacteria 2933016740 2933020661 339
25 iso_pu_bacteria 2509276021 2509391257 340
26 iso_pu_bacteria 2509276033 2509445436 340
27 iso_pu_bacteria 2510065019 2510135993 340
28 iso_pu_bacteria 2510461076 2510892533 340
29 iso_pu_bacteria 2513237084 2513568291 340
30 iso_pu_bacteria 2513237085 2513578168 340
31 iso_pu_bacteria 2513237093 2513634803 340
32 iso_pu_bacteria 2513237103 2513713833 340
33 iso_pu_bacteria 2513237162 2514021930 340
34 iso_pu_bacteria 2515154113 2515632427 340
35 iso_pu_bacteria 2515154114 2515640686 340
36 iso_pu_bacteria 2515154116 2515661647 340
37 iso_pu_bacteria 2515154134 2515737886 340
38 iso_pu_bacteria 2516653077 2517041416 340
39 iso_pu_bacteria 2516653085 2517079949 340
40 iso_pu_bacteria 2517093000 2517097968 340
41 iso_pu_bacteria 2517287029 2517410253 340
42 iso_pu_bacteria 2529292951 2530649221 340
43 iso_pu_bacteria 2585427526 2585525811 340
44 iso_pu_bacteria 2585427528 2585541663 340
45 iso_pu_bacteria 2585427593 2585840118 340
46 iso_pu_bacteria 2599185236 2599720744 340
47 iso_pu_bacteria 2615840624 2616294762 340
48 iso_pu_bacteria 2718217882 2719184469 340
49 iso_pu_bacteria 2718217997 2719668325 340
50 iso_pu_bacteria 2718218009 2719728489 340
51 iso_pu_bacteria 2718218199 2720489018 340
52 iso_pu_bacteria 2718218232 2720609710 340
53 iso_pu_bacteria 2718218233 2720617141 340
54 iso_pu_bacteria 2718218235 2720628273 340
55 iso_pu_bacteria 2718218269 2720772237 340
56 iso_pu_bacteria 2718218363 2721144177 340
57 iso_pu_bacteria 2718218365 2721156275 340
58 iso_pu_bacteria 2718218366 2721161552 340
59 iso_pu_bacteria 2721755514 2722842697 340
60 iso_pu_bacteria 2721755556 2723029657 340
61 iso_pu_bacteria 2721755684 2723564026 340
62 iso_pu_bacteria 2721755685 2723569561 340
63 iso_pu_bacteria 2721755810 2724041514 340
64 iso_pu_bacteria 2721755819 2724092266 340
65 iso_pu_bacteria 2721755822 2724101108 340
66 iso_pu_bacteria 2721755823 2724112634 340
67 iso_pu_bacteria 2724679232 2725947038 340
68 iso_pu_bacteria 2728369352 2730110190 340
69 iso_pu_bacteria 2728369365 2730160585 340
70 iso_pu_bacteria 2728369397 2730295808 340
71 iso_pu_bacteria 2738541333 2739036277 340
72 iso_pu_bacteria 2765235942 2766069234 340
73 iso_pu_bacteria 2791355256 2793297464 340
74 iso_pu_bacteria 2791355259 2793317386 340
75 iso_pu_bacteria 2791355260 2793325317 340
76 iso_pu_bacteria 2791355261 2793330456 340
77 iso_pu_bacteria 2791355262 2793336621 340
78 iso_pu_bacteria 2791355263 2793342539 340
79 iso_pu_bacteria 2791355264 2793345353 340
80 iso_pu_bacteria 2791355266 2793362317 340
81 iso_pu_bacteria 2791355267 2793365141 340
82 iso_pu_bacteria 2802429605 2805927118 340
83 iso_pu_bacteria 2802429606 2805934458 340
84 iso_pu_bacteria 2802429633 2806046380 340
85 iso_pu_bacteria 2802429634 2806053084 340
86 iso_pu_bacteria 2802429635 2806059708 340
87 iso_pu_bacteria 2802429636 2806068554 340
88 iso_pu_bacteria 2802429637 2806074976 340
89 iso_pu_bacteria 2821123053 2821127244 340
90 iso_pu_bacteria 2838016132 2838016458 340
91 iso_pu_bacteria 2838022645 2838028357 340
92 iso_pu_bacteria 2838042994 2838048100 340
93 iso_pu_bacteria 2838048938 2838050096 340
94 iso_pu_bacteria 2838061910 2838068249 340
95 iso_pu_bacteria 2838068647 2838068995 340
96 iso_pu_bacteria 2838668709 2838669580 340
97 iso_pu_bacteria 2838680041 2838685331 340
98 iso_pu_bacteria 2838686498 2838687696 340
99 iso_pu_bacteria 2838694306 2838700064 340
100 iso_pu_bacteria 2838701080 2838701952 340
101 iso_pu_bacteria 2838707686 2838713168 340
102 iso_pu_bacteria 2838729681 2838735583 340
103 iso_pu_bacteria 2838736955 2838740612 340
104 iso_pu_bacteria 2838742623 2838748485 340
105 iso_pu_bacteria 2841840854 2841844453 340
106 iso_pu_bacteria 2841851746 2841854243 340
107 iso_pu_bacteria 2842110456 2842111379 340
108 iso_pu_bacteria 2842118031 2842123532 340
109 iso_pu_bacteria 2842140634 2842144479 340
110 iso_pu_bacteria 2842156927 2842159389 340
111 iso_pu_bacteria 2842163707 2842163828 340
112 iso_pu_bacteria 2842180545 2842183042 340
113 iso_pu_bacteria 2842198810 2842204333 340
114 iso_pu_bacteria 2842205361 2842209350 340
115 iso_pu_bacteria 2842217011 2842223820 340
116 iso_pu_bacteria 2842229732 2842232753 340
117 iso_pu_bacteria 2842237096 2842242581 340
118 iso_pu_bacteria 2842243621 2842247004 340
119 iso_pu_bacteria 2842257432 2842259310 340
120 iso_pu_bacteria 2842264693 2842265332 340
121 iso_pu_bacteria 2842271015 2842272272 340
122 iso_pu_bacteria 2842278818 2842282606 340
123 iso_pu_bacteria 2842291075 2842296648 340
124 iso_pu_bacteria 2842304105 2842309244 340
125 iso_pu_bacteria 2842311132 2842313490 340
126 iso_pu_bacteria 2842317721 2842323388 340
127 iso_pu_bacteria 2842363717 2842365659 340
128 iso_pu_bacteria 2842370503 2842374674 340
129 iso_pu_bacteria 2842377471 2842383049 340
130 iso_pu_bacteria 2842384541 2842390181 340
131 iso_pu_bacteria 2842402390 2842405708 340
132 iso_pu_bacteria 2842409023 2842412292 340
133 iso_pu_bacteria 2842415677 2842418938 340
134 iso_pu_bacteria 2842422224 2842423141 340
135 iso_pu_bacteria 2842428310 2842428615 340
136 iso_pu_bacteria 2842434925 2842435229 340
137 iso_pu_bacteria 2842441272 2842441908 340
138 iso_pu_bacteria 2842447887 2842448043 340
139 iso_pu_bacteria 2842462802 2842463041 340
140 iso_pu_bacteria 2842469257 2842469561 340
141 iso_pu_bacteria 2842489311 2842489603 340
142 iso_pu_bacteria 2842495871 2842500435 340
143 iso_pu_bacteria 2844454524 2844460691 340
144 iso_pu_bacteria 2857516855 2857518251 340
145 iso_pu_bacteria 2857531043 2857534775 340
146 iso_pu_bacteria 2933570622 2933575655 340
147 iso_pu_bacteria 2933586486 2933587933 340
148 iso_pu_bacteria 2933599457 2933599662 340
149 iso_pu_bacteria 2935894831 2935899541 340
150 iso_pu_bacteria 2935901341 2935902928 340
151 iso_pu_bacteria 2936367885 2936374148 340
152 iso_pu_bacteria 2936375103 2936375333 340
153 iso_pu_bacteria 2936381700 2936383145 340
154 iso_pu_bacteria 2996893221 2996894464 340
155 iso_pu_bacteria 3005445848 3005451063 340
156 iso_pu_bacteria 639633055 639645164 340
157 iso_pu_bacteria 8005282627 8005286225 340
158 iso_pu_bacteria 8005289223 8005295502 340
159 iso_pu_bacteria 8005301065 8005306329 340
160 iso_pu_bacteria 8005307578 8005307700 340
161 iso_pu_bacteria 8005376324 8005380038 340
162 iso_pu_bacteria 8005382845 8005383437 340
163 iso_pu_bacteria 8005395548 8005399031 340
164 iso_pu_bacteria 8005430974 8005434718 340
165 iso_pu_bacteria 8005497431 8005502531 340
166 iso_pu_bacteria 8005556819 8005563540 340
167 iso_pu_bacteria 8005563573 8005565313 340
168 iso_pu_bacteria 8005570704 8005572385 340
169 iso_pu_bacteria 8005619151 8005623739 340
170 iso_pu_bacteria 8005626139 8005626298 340
171 iso_pu_bacteria 8005668836 8005673959 340
172 iso_pu_bacteria 8005688590 8005693975 340
173 iso_pu_bacteria 8005695170 8005701189 340
174 iso_pu_bacteria 8018127388 8018131885 340
175 iso_pu_bacteria 8018163183 8018165726 340
176 iso_pu_bacteria 8023680758 8023687885 340
177 iso_pu_bacteria 8024479707 8024484824 340
178 iso_pu_bacteria 8024501048 8024507143 340
179 iso_pu_bacteria 8057874678 8057877800 340
180 iso_pu_bacteria 2718217927 2719389661 341
181 iso_pu_bacteria 2718218423 2721402429 341
182 iso_pu_bacteria 2721755809 2724036263 341
183 iso_pu_bacteria 2791355265 2793354907 341
184 iso_pu_bacteria 2841864319 2841868617 341
185 iso_pu_bacteria 2842192696 2842198514 341
186 iso_pu_bacteria 2842250916 2842251625 341
187 iso_pu_bacteria 2842341865 2842342566 341
188 iso_pu_bacteria 2842395702 2842400370 341
189 iso_pu_bacteria 2929138655 2929143452 341
190 iso_pu_bacteria 8005275841 8005278006 341
191 iso_pu_bacteria 8018176218 8018176555 341
192 iso_pu_bacteria 8054460903 8054464555 341
193 iso_pu_bacteria 8056375014 8056377690 341
194 iso_pu_bacteria 8056382006 8056382473 341
195 3300005985 Ga0081539_10001089 Ga0081539_1000108952 342
196 iso_pu_bacteria 2510065057 2510302945 342
197 iso_pu_bacteria 2510461069 2510840864 342
198 iso_pu_bacteria 2511231052 2511496937 342
199 iso_pu_bacteria 2512047086 2512528847 342
200 iso_pu_bacteria 2512875026 2512969045 342
201 iso_pu_bacteria 2513237086 2513583378 342
202 iso_pu_bacteria 2513237089 2513605567 342
203 iso_pu_bacteria 2513237156 2513986237 342
204 iso_pu_bacteria 2513237159 2514002286 342
205 iso_pu_bacteria 2513237160 2514007709 342
206 iso_pu_bacteria 2517487022 2517566202 342
207 iso_pu_bacteria 2524023207 2524449165 342
208 iso_pu_bacteria 2551306084 2551678697 342
209 iso_pu_bacteria 2551306084 2551681935 342
210 iso_pu_bacteria 2551306085 2551683256 342
211 iso_pu_bacteria 2551306086 2551696698 342
212 iso_pu_bacteria 2551306092 2551739063 342
213 iso_pu_bacteria 2551306093 2551744238 342
214 iso_pu_bacteria 2582581866 2585395793 342
215 iso_pu_bacteria 2802428858 2802720679 342
216 iso_pu_bacteria 2802428859 2802727868 342
217 iso_pu_bacteria 2802428860 2802733021 342
218 iso_pu_bacteria 2802428861 2802740248 342
219 iso_pu_bacteria 2802428862 2802746190 342
220 iso_pu_bacteria 2802428863 2802753522 342
221 iso_pu_bacteria 2838074704 2838078612 342
222 iso_pu_bacteria 2842521101 2842525841 342
223 iso_pu_bacteria 2854896431 2854899809 342
224 iso_pu_bacteria 2854916844 2854920971 342
225 iso_pu_bacteria 2855020534 2855021800 342
226 iso_pu_bacteria 2855825444 2855829350 342
227 iso_pu_bacteria 2855839649 2855844449 342
228 iso_pu_bacteria 2858800743 2858806090 342
229 iso_pu_bacteria 2896384573 2896389290 342
230 iso_pu_bacteria 2915980308 2915982755 342
231 iso_pu_bacteria 2915993759 2915993825 342
232 iso_pu_bacteria 2916007675 2916008818 342
233 iso_pu_bacteria 2916014648 2916021496 342
234 iso_pu_bacteria 2916035215 2916037527 342
235 iso_pu_bacteria 2916061851 2916067093 342
236 iso_pu_bacteria 2920760137 2920764924 342
237 iso_pu_bacteria 2921201388 2921205319 342
238 iso_pu_bacteria 2921250672 2921253117 342
239 iso_pu_bacteria 2921289301 2921295092 342
240 iso_pu_bacteria 2921296804 2921298799 342
241 iso_pu_bacteria 2924144063 2924150421 342
242 iso_pu_bacteria 2924150972 2924157190 342
243 iso_pu_bacteria 2924158325 2924161699 342
244 iso_pu_bacteria 2924165586 2924171204 342
245 iso_pu_bacteria 2924186466 2924189115 342
246 iso_pu_bacteria 2924200457 2924200535 342
247 iso_pu_bacteria 2924214083 2924217767 342
248 iso_pu_bacteria 2924228884 2924233406 342
249 iso_pu_bacteria 2936996657 2936998399 342
250 iso_pu_bacteria 2937002841 2937002991 342
251 iso_pu_bacteria 2937009748 2937009840 342
252 iso_pu_bacteria 2937036028 2937041946 342
253 iso_pu_bacteria 2937049772 2937054582 342
254 iso_pu_bacteria 2937056579 2937058644 342
255 iso_pu_bacteria 2937063883 2937063920 342
256 iso_pu_bacteria 2937078374 2937081127 342
257 iso_pu_bacteria 2937084907 2937090078 342
258 iso_pu_bacteria 2937091812 2937094424 342
259 iso_pu_bacteria 2937098957 2937101436 342
260 iso_pu_bacteria 2937126314 2937128218 342
261 iso_pu_bacteria 2957375807 2957377367 342
262 iso_pu_bacteria 2957388812 2957395524 342
263 iso_pu_bacteria 2957422303 2957424621 342
264 iso_pu_bacteria 2957430029 2957431350 342
265 iso_pu_bacteria 2957437181 2957441403 342
266 iso_pu_bacteria 2957443900 2957446015 342
267 iso_pu_bacteria 2957471148 2957474519 342
268 iso_pu_bacteria 2957491536 2957496579 342
269 iso_pu_bacteria 2957498199 2957502017 342
270 iso_pu_bacteria 2957505466 2957505531 342
271 iso_pu_bacteria 2960591022 2960593907 342
272 iso_pu_bacteria 2960603979 2960604160 342
273 iso_pu_bacteria 2960617483 2960622305 342
274 iso_pu_bacteria 2960624210 2960624365 342
275 iso_pu_bacteria 2960637947 2960637985 342
276 iso_pu_bacteria 2960645483 2960649242 342
277 iso_pu_bacteria 2960652885 2960653276 342
278 iso_pu_bacteria 2960660292 2960663685 342
279 iso_pu_bacteria 2960667422 2960667506 342
280 iso_pu_bacteria 2960680706 2960683246 342
281 iso_pu_bacteria 2960693952 2960700384 342
282 iso_pu_bacteria 2964607997 2964611032 342
283 iso_pu_bacteria 2964628898 2964628962 342
284 iso_pu_bacteria 2964649959 2964653975 342
285 iso_pu_bacteria 2964656573 2964656664 342
286 iso_pu_bacteria 2964670856 2964676919 342
287 iso_pu_bacteria 2964678106 2964682319 342
288 iso_pu_bacteria 2964705432 2964707588 342
289 iso_pu_bacteria 2964712639 2964717766 342
290 iso_pu_bacteria 2964719344 2964721811 342
291 iso_pu_bacteria 2967664464 2967664504 342
292 iso_pu_bacteria 2967678726 2967683261 342
293 iso_pu_bacteria 2967686174 2967690158 342
294 iso_pu_bacteria 2967693043 2967698575 342
295 iso_pu_bacteria 2967714385 2967718648 342
296 iso_pu_bacteria 2967721400 2967723161 342
297 iso_pu_bacteria 2967728569 2967730014 342
298 iso_pu_bacteria 2967735183 2967737468 342
299 iso_pu_bacteria 2967762386 2967762537 342
300 iso_pu_bacteria 2967769361 2967769399 342
301 iso_pu_bacteria 2970026789 2970027032 342
302 iso_pu_bacteria 2970040964 2970044092 342
303 iso_pu_bacteria 2970047711 2970051032 342
304 iso_pu_bacteria 2970054988 2970058361 342
305 iso_pu_bacteria 2970061556 2970065199 342
306 iso_pu_bacteria 2970076120 2970077955 342
307 iso_pu_bacteria 2970082768 2970084519 342
308 iso_pu_bacteria 2970109326 2970111392 342
309 iso_pu_bacteria 2970116247 2970119000 342
310 iso_pu_bacteria 2970122695 2970124089 342
311 iso_pu_bacteria 2970129317 2970135386 342
312 iso_pu_bacteria 2970143518 2970146298 342
313 iso_pu_bacteria 2970149975 2970152185 342
314 iso_pu_bacteria 2970184632 2970191451 342
315 iso_pu_bacteria 2970191845 2970195054 342
316 iso_pu_bacteria 2977523885 2977525813 342
317 iso_pu_bacteria 2977530762 2977535511 342
318 iso_pu_bacteria 2977537788 2977539893 342
319 iso_pu_bacteria 2977544691 2977545654 342
320 iso_pu_bacteria 2977551784 2977556211 342
321 iso_pu_bacteria 2977558990 2977559118 342
322 iso_pu_bacteria 2977572785 2977574535 342
323 iso_pu_bacteria 2977579622 2977584973 342
324 iso_pu_bacteria 8003999396 8004004671 342
325 iso_pu_bacteria 8056875544 8056878887 342
326 iso_pu_bacteria 2510917030 2511200348 343
327 iso_pu_bacteria 2515075009 2515109069 343
328 iso_pu_bacteria 2537561587 2537873173 343
329 iso_pu_bacteria 2554235003 2554245649 343
330 iso_pu_bacteria 2558860242 2559296522 343
331 iso_pu_bacteria 2582581298 2585222488 343
332 iso_pu_bacteria 2585427529 2585544560 343
333 iso_pu_bacteria 2585427633 2585992846 343
334 iso_pu_bacteria 2585427634 2586003576 343
335 iso_pu_bacteria 2599185210 2599602983 343
336 iso_pu_bacteria 2600255279 2601610604 343
337 iso_pu_bacteria 2600255308 2601747066 343
338 iso_pu_bacteria 2643221558 2643814037 343
339 iso_pu_bacteria 2643221568 2643853750 343
340 iso_pu_bacteria 2643221582 2643922284 343
341 iso_pu_bacteria 2643221693 2644520649 343
342 iso_pu_bacteria 2808606387 2808986973 343
343 iso_pu_bacteria 2818991439 2819560724 343
344 iso_pu_bacteria 2818991461 2819688531 343
345 iso_pu_bacteria 2838675328 2838677785 343
346 iso_pu_bacteria 2838714209 2838717310 343
347 iso_pu_bacteria 2838719591 2838722081 343
348 iso_pu_bacteria 2838724970 2838728059 343
349 iso_pu_bacteria 2841846520 2841849720 343
350 iso_pu_bacteria 2841859092 2841861245 343
351 iso_pu_bacteria 2842124991 2842127532 343
352 iso_pu_bacteria 2842130223 2842132678 343
353 iso_pu_bacteria 2842152218 2842154672 343
354 iso_pu_bacteria 2842170452 2842173170 343
355 iso_pu_bacteria 2842175837 2842178292 343
356 iso_pu_bacteria 2842187318 2842190417 343
357 iso_pu_bacteria 2842211629 2842214731 343
358 iso_pu_bacteria 2842224351 2842227451 343
359 iso_pu_bacteria 2842515876 2842518488 343
360 iso_pu_bacteria 2899792073 2899793526 343
361 iso_pu_bacteria 2899803654 2899807108 343
362 iso_pu_bacteria 2919100787 2919103073 343
363 iso_pu_bacteria 2919114240 2919117575 343
364 iso_pu_bacteria 2919166419 2919168222 343
365 iso_pu_bacteria 2919171160 2919176412 343
366 iso_pu_bacteria 2926754445 2926759013 343
367 iso_pu_bacteria 2933006813 2933009945 343
368 iso_pu_bacteria 2933011516 2933014114 343
369 iso_pu_bacteria 2933594066 2933595914 343
370 iso_pu_bacteria 2979089926 2979091495 343
371 iso_pu_bacteria 2979095461 2979097015 343
372 iso_pu_bacteria 2979100975 2979101311 343
373 iso_pu_bacteria 2984509177 2984510732 343
374 iso_pu_bacteria 2984518228 2984518567 343
375 iso_pu_bacteria 2984537506 2984539082 343
376 iso_pu_bacteria 650716007 650842940 343
377 iso_pu_bacteria 8003570095 8003574348 343
378 iso_pu_bacteria 8005460587 8005467442 343
379 3300002774 JGI25150J39212_1005684 JGI25150J39212_10056842 344
380 3300003187 JGI25151J46595_10000463 JGI25151J46595_1000046316 344
381 3300003187 JGI25151J46595_10006059 JGI25151J46595_100060593 344
382 3300003354 JGI25160J50197_1001923 JGI25160J50197_10019239 344
383 3300003771 Ga0055526_1000645 Ga0055526_100064525 344
384 3300003771 Ga0055526_1004150 Ga0055526_10041509 344
385 3300003771 Ga0055526_1010598 Ga0055526_10105983 344
386 3300003775 Ga0055524_1000751 Ga0055524_100075120 344
387 3300003790 Ga0055528_1000054 Ga0055528_100005486 344
388 3300003790 Ga0055528_1000343 Ga0055528_100034334 344
389 3300003790 Ga0055528_1000764 Ga0055528_100076416 344
390 3300003790 Ga0055528_1003240 Ga0055528_10032402 344
391 3300004625 Ga0055543_1001585 Ga0055543_10015854 344
392 3300005262 Ga0065165_1004487 Ga0065165_10044872 344
393 3300005262 Ga0065165_1013020 Ga0065165_10130203 344
394 3300005336 Ga0070680_100054567 Ga0070680_1000545673 344
395 3300005337 Ga0070682_100011228 Ga0070682_1000112283 344
396 3300005530 Ga0070679_100002484 Ga0070679_10000248414 344
397 3300005548 Ga0070665_100094351 Ga0070665_1000943513 344
398 3300005616 Ga0068852_100004512 Ga0068852_1000045129 344
399 3300006038 Ga0075365_10090718 Ga0075365_100907182 344
400 3300006177 Ga0075362_10007441 Ga0075362_100074412 344
401 3300006178 Ga0075367_10002993 Ga0075367_100029934 344
402 3300006186 Ga0075369_10001157 Ga0075369_100011576 344
403 3300006353 Ga0075370_10004883 Ga0075370_100048832 344
404 3300006353 Ga0075370_10099409 Ga0075370_100994092 344
405 3300006946 Ga0079104_1000044 Ga0079104_100004479 344
406 3300009765 Ga0123341_1000044 Ga0123341_100004424 344
407 3300013104 Ga0157370_10198425 Ga0157370_101984252 344
408 3300014326 Ga0157380_10277227 Ga0157380_102772271 344
409 3300025245 Ga0207425_1007114 Ga0207425_10071142 344
410 3300025258 Ga0209129_1000082 Ga0209129_1000082148 344
411 3300025258 Ga0209129_1001482 Ga0209129_10014824 344
412 3300025258 Ga0209129_1002994 Ga0209129_10029947 344
413 3300025273 Ga0209673_1000005 Ga0209673_1000005176 344
414 3300025273 Ga0209673_1000067 Ga0209673_1000067146 344
415 3300025273 Ga0209673_1000294 Ga0209673_100029470 344
416 3300025273 Ga0209673_1000968 Ga0209673_100096823 344
417 3300025273 Ga0209673_1008320 Ga0209673_10083202 344
418 3300025292 Ga0209676_1024411 Ga0209676_10244112 344
419 3300025294 Ga0209025_1000260 Ga0209025_100026053 344
420 3300025294 Ga0209025_1000974 Ga0209025_10009747 344
421 3300025294 Ga0209025_1002894 Ga0209025_10028943 344
422 3300025294 Ga0209025_1011728 Ga0209025_10117284 344
423 3300025294 Ga0209025_1045579 Ga0209025_10455792 344
424 3300025295 Ga0209564_1000092 Ga0209564_1000092146 344
425 3300025295 Ga0209564_1000336 Ga0209564_100033635 344
426 3300025295 Ga0209564_1010119 Ga0209564_10101194 344
427 3300025297 Ga0209758_1000113 Ga0209758_100011349 344
428 3300025297 Ga0209758_1005269 Ga0209758_10052694 344
429 3300025297 Ga0209758_1015387 Ga0209758_10153872 344
430 3300025297 Ga0209758_1021975 Ga0209758_10219752 344
431 3300025299 Ga0209256_1000170 Ga0209256_100017086 344
432 3300025299 Ga0209256_1000475 Ga0209256_100047510 344
433 3300025299 Ga0209256_1001533 Ga0209256_100153318 344
434 3300025302 Ga0207426_1000282 Ga0207426_100028244 344
435 3300025303 Ga0209051_1002417 Ga0209051_10024178 344
436 3300025303 Ga0209051_1037274 Ga0209051_10372742 344
437 3300025909 Ga0207705_10033863 Ga0207705_100338632 344
438 3300025921 Ga0207652_10002120 Ga0207652_100021203 344
439 3300026142 Ga0207698_10006661 Ga0207698_100066613 344
440 3300027111 Ga0209281_1000129 Ga0209281_100012993 344
441 3300028379 Ga0268266_10141180 Ga0268266_101411802 344
442 3300031731 Ga0307405_10151806 Ga0307405_101518061 344
443 3300041496 Ga0451839_1524206 Ga0451839_1524206_370_1404 344
444 3300041501 Ga0451845_0192919 Ga0451845_0192919_360_1403 344
445 3300041512 Ga0451853_0632566 Ga0451853_0632566_206_1249 344
446 3300042006 Ga0439432_054299 Ga0439432_054299_68_1102 344
447 3300046460 Ga0495638_0000475 Ga0495638_0000475_16774_17808 344
448 3300046474 Ga0495605_0031644 Ga0495605_0031644_1085_2119 344
449 3300046492 Ga0495585_0040812 Ga0495585_0040812_696_1739 344
450 3300046506 Ga0495583_0024196 Ga0495583_0024196_122_1156 344
451 3300046506 Ga0495583_0046858 Ga0495583_0046858_483_1526 344
452 3300046507 Ga0495606_0081199 Ga0495606_0081199_679_1722 344
453 3300046507 Ga0495606_0089417 Ga0495606_0089417_295_1338 344
454 3300046512 Ga0495610_0074257 Ga0495610_0074257_280_1323 344
455 3300046515 Ga0495620_0041462 Ga0495620_0041462_648_1682 344
456 3300046518 Ga0495631_0036479 Ga0495631_0036479_621_1664 344
457 3300046518 Ga0495631_0049466 Ga0495631_0049466_68_1102 344
458 3300046519 Ga0495632_0025705 Ga0495632_0025705_1085_2119 344
459 3300046522 Ga0495643_0027999 Ga0495643_0027999_627_1670 344
460 3300046524 Ga0495648_0012073 Ga0495648_0012073_5121_6164 344
461 3300046530 Ga0495654_0000122 Ga0495654_0000122_83542_84579 344
462 3300046542 Ga0495597_0031452 Ga0495597_0031452_261_1304 344
463 3300046558 Ga0495633_0031574 Ga0495633_0031574_763_1806 344
464 3300046616 Ga0495668_0006686 Ga0495668_0006686_4545_5579 344
465 3300046660 Ga0495625_0011467 Ga0495625_0011467_235_1269 344
466 3300046660 Ga0495625_0061451 Ga0495625_0061451_1082_2125 344
467 3300046660 Ga0495625_0189234 Ga0495625_0189234_148_1191 344
468 3300046660 Ga0495625_0222987 Ga0495625_0222987_18_1061 344
469 3300046810 Ga0495660_0054123 Ga0495660_0054123_620_1654 344
470 3300047320 Ga0495672_0034652 Ga0495672_0034652_406_1440 344
471 3300047472 Ga0495686_0051117 Ga0495686_0051117_621_1664 344
472 3300048909 Ga0496106_0072756 Ga0496106_0072756_450_1484 344
473 3300048914 Ga0496111_0000161 Ga0496111_0000161_5852_6889 344
474 3300048920 Ga0496117_0071346 Ga0496117_0071346_925_1959 344
475 3300048924 Ga0496121_0012780 Ga0496121_0012780_5289_6326 344
476 3300048924 Ga0496121_0043504 Ga0496121_0043504_594_1628 344
477 3300048924 Ga0496121_0160059 Ga0496121_0160059_318_1352 344
478 3300048925 Ga0496122_0013925 Ga0496122_0013925_629_1666 344
479 3300048925 Ga0496122_0034340 Ga0496122_0034340_1368_2402 344
480 3300048926 Ga0496123_0033644 Ga0496123_0033644_1714_2748 344
481 3300048927 Ga0496124_0010860 Ga0496124_0010860_645_1682 344
482 3300048927 Ga0496124_0107526 Ga0496124_0107526_68_1102 344
483 3300048929 Ga0496126_0029711 Ga0496126_0029711_2823_3857 344
484 3300048929 Ga0496126_0101091 Ga0496126_0101091_1414_2448 344
485 3300049459 Ga0495678_027712 Ga0495678_027712_1316_2350 344
486 3300050489 nmdc:mga03683_1248_c1 nmdc:mga03683_1248_c1_750_1784 344
487 3300050496 nmdc:mga07m45_54669_c1 nmdc:mga07m45_54669_c1_473_1507 344
488 3300050496 nmdc:mga07m45_67369_c1 nmdc:mga07m45_67369_c1_843_1877 344
489 3300050496 nmdc:mga07m45_98519_c1 nmdc:mga07m45_98519_c1_212_1249 344
490 3300050516 nmdc:mga0sz30_9496_c1 nmdc:mga0sz30_9496_c1_804_1838 344
491 3300053086 Ga0500578_0077778 Ga0500578_0077778_884_1918 344
492 3300053086 Ga0500578_0107874 Ga0500578_0107874_420_1463 344
493 3300053109 Ga0500569_003815 Ga0500569_003815_719_1753 344
494 3300053118 Ga0500594_0028460 Ga0500594_0028460_134_1168 344
495 3300053125 Ga0500618_000285 Ga0500618_000285_31643_32680 344
496 3300053134 Ga0500658_0001040 Ga0500658_0001040_691_1734 344
497 3300053139 Ga0500568_0000109 Ga0500568_0000109_63795_64829 344
498 3300053153 Ga0500616_0000472 Ga0500616_0000472_20615_21649 344
499 3300053153 Ga0500616_0055614 Ga0500616_0055614_836_1879 344
500 3300053153 Ga0500616_0115566 Ga0500616_0115566_100_1143 344
501 3300053736 Ga0500599_004290 Ga0500599_004290_446_1480 344
502 iso_pu_bacteria 2899845264 2899847721 344
503 iso_pu_bacteria 2926760298 2926763470 344
504 iso_pu_bacteria 8054558443 8054560443 344
505 3300048920 Ga0496117_0010901 Ga0496117_0010901_3760_4800 345
506 3300048921 Ga0496118_0208951 Ga0496118_0208951_78_1118 345
507 3300048922 Ga0496119_0064759 Ga0496119_0064759_796_1836 345
508 3300048923 Ga0496120_0024193 Ga0496120_0024193_2358_3398 345
509 3300048924 Ga0496121_0000005 Ga0496121_0000005_562446_563486 345
510 3300048927 Ga0496124_0157051 Ga0496124_0157051_588_1628 345
511 3300048927 Ga0496124_0159395 Ga0496124_0159395_133_1173 345
512 3300048928 Ga0496125_0000449 Ga0496125_0000449_48186_49226 345
513 3300048929 Ga0496126_0037995 Ga0496126_0037995_1366_2406 345
514 3300048929 Ga0496126_0298679 Ga0496126_0298679_149_1189 345
515 3300049571 Ga0501034_0016696 Ga0501034_0016696_5192_6244 345
516 3300049573 Ga0501037_0015498 Ga0501037_0015498_1384_2424 345
517 3300049581 Ga0501047_0160375 Ga0501047_0160375_1042_2094 345
518 3300049584 Ga0501068_0025318 Ga0501068_0025318_1703_2740 345
519 3300050491 nmdc:mga00v17_675_c1 nmdc:mga00v17_675_c1_11948_12988 345
520 iso_pu_bacteria 2713897090 2715500405 345
521 iso_pu_bacteria 2984601300 2984605780 345
522 3300006038 Ga0075365_10000718 Ga0075365_100007183 346
523 3300022740 Ga0228710_1002752 Ga0228710_100275221 346
524 3300027111 Ga0209281_1000805 Ga0209281_100080523 346
525 3300027666 Ga0209282_1000038 Ga0209282_1000038113 346
526 3300028794 Ga0307515_10003037 Ga0307515_100030372 346
527 3300031456 Ga0307513_10001322 Ga0307513_1000132219 346
528 3300031967 Ga0315914_1002543 Ga0315914_10025437 346
529 3300031995 Ga0307409_100156252 Ga0307409_1001562521 346
530 3300033430 Ga0315913_1001156 Ga0315913_10011567 346
531 3300033464 Ga0315915_1000018 Ga0315915_1000018113 346
532 3300041404 Ga0439436_0019154 Ga0439436_0019154_550_1593 346
533 3300041405 Ga0439438_033080 Ga0439438_033080_287_1330 346
534 3300042007 Ga0439449_0010942 Ga0439449_0010942_1857_2900 346
535 3300042007 Ga0439449_0026773 Ga0439449_0026773_476_1519 346
536 3300042015 Ga0439462_0025340 Ga0439462_0025340_198_1241 346
537 3300042435 Ga0439434_0046352 Ga0439434_0046352_239_1282 346
538 3300042531 Ga0450918_007935 Ga0450918_007935_366_1409 346
539 3300048929 Ga0496126_0043552 Ga0496126_0043552_1389_2432 346
540 3300050492 nmdc:mga0yw44_128_c2 nmdc:mga0yw44_128_c2_2162_3205 346
541 iso_pu_bacteria 2508501122 2509110639 346
542 iso_pu_bacteria 2509276019 2509377459 346
543 iso_pu_bacteria 2513237140 2513883932 346
544 iso_pu_bacteria 2513237143 2513901598 346
545 iso_pu_bacteria 2516653046 2516895833 346
546 iso_pu_bacteria 2558860100 2558864994 346
547 iso_pu_bacteria 2690316117 2692319199 346
548 iso_pu_bacteria 2791355092 2792627785 346
549 iso_pu_bacteria 2802429268 2804754978 346
550 iso_pu_bacteria 2847417321 2847422295 346
551 iso_pu_bacteria 2848992105 2848998254 346
552 iso_pu_bacteria 2850079185 2850084711 346
553 iso_pu_bacteria 2855872281 2855875678 346
554 iso_pu_bacteria 2915986958 2915988131 346
555 iso_pu_bacteria 2916000859 2916005472 346
556 iso_pu_bacteria 2916021584 2916021657 346
557 iso_pu_bacteria 2916028427 2916028532 346
558 iso_pu_bacteria 2916041962 2916042009 346
559 iso_pu_bacteria 2916048683 2916048781 346
560 iso_pu_bacteria 2916055098 2916059869 346
561 iso_pu_bacteria 2916076590 2916077498 346
562 iso_pu_bacteria 2921208531 2921212109 346
563 iso_pu_bacteria 2921237296 2921237332 346
564 iso_pu_bacteria 2921244191 2921249221 346
565 iso_pu_bacteria 2921263974 2921268088 346
566 iso_pu_bacteria 2921282425 2921288640 346
567 iso_pu_bacteria 2924172951 2924175045 346
568 iso_pu_bacteria 2924179722 2924182716 346
569 iso_pu_bacteria 2924193448 2924196811 346
570 iso_pu_bacteria 2924207177 2924212084 346
571 iso_pu_bacteria 2924221636 2924223653 346
572 iso_pu_bacteria 2937016420 2937020006 346
573 iso_pu_bacteria 2937023124 2937025158 346
574 iso_pu_bacteria 2937042894 2937049092 346
575 iso_pu_bacteria 2937071275 2937077739 346
576 iso_pu_bacteria 2937113482 2937115420 346
577 iso_pu_bacteria 2937119839 2937120091 346
578 iso_pu_bacteria 2957382221 2957382267 346
579 iso_pu_bacteria 2957395598 2957397978 346
580 iso_pu_bacteria 2957402308 2957404287 346
581 iso_pu_bacteria 2957408893 2957414780 346
582 iso_pu_bacteria 2957415311 2957421114 346
583 iso_pu_bacteria 2957450854 2957451116 346
584 iso_pu_bacteria 2957457609 2957461749 346
585 iso_pu_bacteria 2957464669 2957465970 346
586 iso_pu_bacteria 2957478035 2957483290 346
587 iso_pu_bacteria 2957484790 2957491262 346
588 iso_pu_bacteria 2960584000 2960584083 346
589 iso_pu_bacteria 2960597568 2960603100 346
590 iso_pu_bacteria 2960610863 2960610940 346
591 iso_pu_bacteria 2960674078 2960676583 346
592 iso_pu_bacteria 2964615318 2964615461 346
593 iso_pu_bacteria 2964621998 2964628166 346
594 iso_pu_bacteria 2964636051 2964640185 346
595 iso_pu_bacteria 2964643177 2964643436 346
596 iso_pu_bacteria 2964663802 2964664056 346
597 iso_pu_bacteria 2964685014 2964690734 346
598 iso_pu_bacteria 2964691889 2964695936 346
599 iso_pu_bacteria 2964698721 2964698850 346
600 iso_pu_bacteria 2967671571 2967672463 346
601 iso_pu_bacteria 2967699805 2967706177 346
602 iso_pu_bacteria 2967706974 2967711837 346
603 iso_pu_bacteria 2967742019 2967748073 346
604 iso_pu_bacteria 2967748971 2967749232 346
605 iso_pu_bacteria 2967755722 2967755984 346
606 iso_pu_bacteria 2967775926 2967777263 346
607 iso_pu_bacteria 2970019648 2970019694 346
608 iso_pu_bacteria 2970033650 2970033911 346
609 iso_pu_bacteria 2970068827 2970075850 346
610 iso_pu_bacteria 2970088815 2970091852 346
611 iso_pu_bacteria 2970095765 2970097700 346
612 iso_pu_bacteria 2970102677 2970102939 346
613 iso_pu_bacteria 2970136068 2970141701 346
614 iso_pu_bacteria 2970156795 2970160092 346
615 iso_pu_bacteria 2970164137 2970164824 346
616 iso_pu_bacteria 2970170962 2970171240 346
617 iso_pu_bacteria 2970177841 2970179963 346
618 iso_pu_bacteria 2977516862 2977521725 346
619 iso_pu_bacteria 2977565890 2977566024 346
620 iso_pu_bacteria 643692032 643823779 346
621 iso_pu_bacteria 648276728 648735461 346
622 iso_pu_bacteria 8003992118 8003996973 346
623 iso_pu_bacteria 8018150411 8018153731 346
624 iso_pu_bacteria 8049293176 8049298092 346
625 3300002773 JGI25152J39213_1005787 JGI25152J39213_10057874 347
626 3300002987 JGI25159J45721_1001409 JGI25159J45721_10014093 347
627 3300003320 rootH2_10270668 rootH2_102706682 347
628 3300003374 JGI25161J50226_1000233 JGI25161J50226_100023317 347
629 3300003775 Ga0055524_1007851 Ga0055524_10078515 347
630 3300003775 Ga0055524_1037128 Ga0055524_10371281 347
631 3300003790 Ga0055528_1016049 Ga0055528_10160492 347
632 3300003792 Ga0055540_1002166 Ga0055540_10021663 347
633 3300003794 Ga0055531_10001197 Ga0055531_100011973 347
634 3300004625 Ga0055543_1000717 Ga0055543_10007172 347
635 3300005262 Ga0065165_1001892 Ga0065165_100189210 347
636 3300005353 Ga0070669_100090852 Ga0070669_1000908522 347
637 3300005548 Ga0070665_100071218 Ga0070665_1000712182 347
638 3300006048 Ga0075363_100041718 Ga0075363_1000417182 347
639 3300006177 Ga0075362_10053491 Ga0075362_100534912 347
640 3300006186 Ga0075369_10047214 Ga0075369_100472142 347
641 3300009148 Ga0105243_10062848 Ga0105243_100628482 347
642 3300013104 Ga0157370_10000211 Ga0157370_1000021152 347
643 3300025208 Ga0209436_100007 Ga0209436_100007109 347
644 3300025258 Ga0209129_1008444 Ga0209129_10084443 347
645 3300025273 Ga0209673_1006587 Ga0209673_10065872 347
646 3300025284 Ga0209130_1000001 Ga0209130_1000001661 347
647 3300025292 Ga0209676_1015393 Ga0209676_10153932 347
648 3300025294 Ga0209025_1001148 Ga0209025_100114815 347
649 3300025297 Ga0209758_1000203 Ga0209758_10002035 347
650 3300025297 Ga0209758_1027418 Ga0209758_10274182 347
651 3300025298 Ga0209050_1006608 Ga0209050_10066082 347
652 3300025299 Ga0209256_1002121 Ga0209256_10021212 347
653 3300025302 Ga0207426_1000045 Ga0207426_1000045270 347
654 3300025303 Ga0209051_1004473 Ga0209051_10044738 347
655 3300025304 Ga0209257_1000691 Ga0209257_100069132 347
656 3300025923 Ga0207681_10054605 Ga0207681_100546052 347
657 3300025935 Ga0207709_10092104 Ga0207709_100921042 347
658 3300027312 Ga0209371_1000012 Ga0209371_1000012280 347
659 3300027312 Ga0209371_1000472 Ga0209371_100047222 347
660 3300027666 Ga0209282_1000323 Ga0209282_100032320 347
661 3300028379 Ga0268266_10052280 Ga0268266_100522802 347
662 3300030500 Ga0268256_1000013 Ga0268256_1000013280 347
663 3300046506 Ga0495583_0029588 Ga0495583_0029588_1111_2154 347
664 3300046512 Ga0495610_0045893 Ga0495610_0045893_1037_2080 347
665 3300046522 Ga0495643_0080282 Ga0495643_0080282_66_1109 347
666 3300046522 Ga0495643_0100912 Ga0495643_0100912_356_1417 347
667 3300048909 Ga0496106_0000355 Ga0496106_0000355_27771_28814 347
668 3300048909 Ga0496106_0117347 Ga0496106_0117347_883_1938 347
669 3300048916 Ga0496113_0161241 Ga0496113_0161241_697_1740 347
670 3300048916 Ga0496113_0164650 Ga0496113_0164650_239_1300 347
671 3300048919 Ga0496116_0000243 Ga0496116_0000243_64397_65446 347
672 3300048919 Ga0496116_0060407 Ga0496116_0060407_1013_2056 347
673 3300048919 Ga0496116_0103442 Ga0496116_0103442_338_1384 347
674 3300048920 Ga0496117_0000016 Ga0496117_0000016_426959_428020 347
675 3300048921 Ga0496118_0000758 Ga0496118_0000758_14090_15151 347
676 3300048921 Ga0496118_0038673 Ga0496118_0038673_1367_2410 347
677 3300048921 Ga0496118_0079532 Ga0496118_0079532_31_1080 347
678 3300048922 Ga0496119_0054285 Ga0496119_0054285_649_1710 347
679 3300048923 Ga0496120_0000056 Ga0496120_0000056_115936_116997 347
680 3300048924 Ga0496121_0010821 Ga0496121_0010821_5499_6542 347
681 3300048925 Ga0496122_0000002 Ga0496122_0000002_427620_428681 347
682 3300048925 Ga0496122_0000106 Ga0496122_0000106_67667_68737 347
683 3300048925 Ga0496122_0014427 Ga0496122_0014427_411_1454 347
684 3300048925 Ga0496122_0017699 Ga0496122_0017699_3352_4401 347
685 3300048926 Ga0496123_0000002 Ga0496123_0000002_1383002_1384063 347
686 3300048926 Ga0496123_0000002 Ga0496123_0000002_427620_428681 347
687 3300048926 Ga0496123_0000022 Ga0496123_0000022_293420_294490 347
688 3300048927 Ga0496124_0000428 Ga0496124_0000428_72684_73733 347
689 3300048927 Ga0496124_0013787 Ga0496124_0013787_6755_7816 347
690 3300048927 Ga0496124_0281749 Ga0496124_0281749_76_1119 347
691 3300048928 Ga0496125_0012755 Ga0496125_0012755_4276_5319 347
692 3300048928 Ga0496125_0172388 Ga0496125_0172388_18_1064 347
693 3300048929 Ga0496126_0000554 Ga0496126_0000554_64859_65908 347
694 3300050489 nmdc:mga03683_23601_c1 nmdc:mga03683_23601_c1_114_1175 347
695 3300050490 nmdc:mga03n38_20411_c1 nmdc:mga03n38_20411_c1_717_1778 347
696 3300050491 nmdc:mga00v17_3_c1 nmdc:mga00v17_3_c1_207859_208920 347
697 3300050491 nmdc:mga00v17_52367_c1 nmdc:mga00v17_52367_c1_521_1567 347
698 3300050492 nmdc:mga0yw44_14433_c1 nmdc:mga0yw44_14433_c1_613_1674 347
699 3300050494 nmdc:mga06z11_47172_c1 nmdc:mga06z11_47172_c1_119_1180 347
700 3300050516 nmdc:mga0sz30_149_c1 nmdc:mga0sz30_149_c1_47_1108 347
701 3300053107 Ga0500560_000033 Ga0500560_000033_8528_9589 347
702 3300053137 Ga0500561_0000034 Ga0500561_0000034_6180_7241 347
703 3300053139 Ga0500568_0003149 Ga0500568_0003149_7479_8522 347
704 3300053156 Ga0500622_0000134 Ga0500622_0000134_3155_4198 347
705 3300053157 Ga0500624_000323 Ga0500624_000323_12699_13760 347
706 3300053160 Ga0500633_0011394 Ga0500633_0011394_877_1920 347
707 3300053161 Ga0500634_0102160 Ga0500634_0102160_201_1262 347
708 iso_pu_bacteria 2516143018 2516206699 347
709 iso_pu_bacteria 2791355094 2792640256 347

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

181

307

0.95

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

25

143

0.94

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

214

341

0.73

PF16912

Glu_dehyd_C

Glucose dehydrogenase C-terminus

142

345

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
5iq4-assembly1.cif.gz_B crystal structure of rntmm mutant y207s soaking 0.965 168 201
5iq1-assembly1.cif.gz_B crystal structure of rntmm mutant y207s 0.9636 168 201
6dkh-assembly1.cif.gz_A the crystal structure of l-idonate 5-dehydrogenase from escherichia coli str. k-12 substr. mg1655 0.9591 1 342
5ipy-assembly1.cif.gz_B crystal structure of wt rntmm 0.9529 168 200
2xls-assembly1.cif.gz_A joint-functions of protein residues and nadp(h) in oxygen-activation by flavin-containing monooxygenase: asn78lys mutant 0.9523 168 200
ID Description Score Start End Superfamily
af_P39346_157_290_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9552 158 288 3.40.50.720
af_P39346_4_156_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.954 3 155 3.90.180.10
af_A0A0R4IGI3_166_529_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9403 169 204 3.50.50.60
af_A0A1D8PUB4_3_180_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9396 4 163 3.90.180.10
af_P39346_4_156_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.936 3 155 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A246S4I6-F1-model_v4 Phosphoesterase 0.9853 4 341 GO:0008270
GO:0016616
AF-A0A177RH45-F1-model_v4 deleted 0.9825 4 341
AF-A0A2N3BNK1-F1-model_v4 L-idonate 5-dehydrogenase 0.9756 195 341 GO:0016491
GO:0046872
AF-A0A2G6EEP7-F1-model_v4 L-idonate 5-dehydrogenase 0.9703 4 345 GO:0008270
GO:0016616
AF-A0A3M1QK08-F1-model_v4 L-idonate 5-dehydrogenase 0.9676 4 344 GO:0008270
GO:0016491

Feature Viewer

pLDDT pTM Quality
95.32 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map