F476252

General Info

Members Datasets Scaffolds Average Seq Length
702 290 1404 375

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8034962539|8034964998
Length 416
Sequence ISIVPTENAAMDLHAMLKILSSQDGSDLYLSTGAPPCAKFNGVLKALSQEPMKAGDVAAIADSIMDSAQREEFERELEMNLAISLAGVGRFRINIFKQRNEVSIVARNIKLDIPRFEDLKLPEVLLSTVMEKRGLVLFVGGTGSGKSTSLAALIDYRNRNSGGHIITIEDPVEYVHRHKKSIINQREVGVDTRSFHAALKNTLRQAPDVILIGEIRDRETMEHALAFADTGHLAISTLHANNANQALDRIINFFPEDRRPQLLNDLGNNLKAFVSQRLVKTVDGKRRAAVEVMLGTPTVRDLIKRNEFSELKEIMEKSKNLGMQTFDQALIDLVHEGAIDEEEAVKNADSANNVRLKLKLHRDNPANARPAPAAAASVAAPVAPAKVTPPGDWGLELTLEDIEEEQPPEDPGRQGI

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
14 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
15 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
16 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
17 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
18 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
19 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
20 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
21 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
22 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
23 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
24 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
25 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
26 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
30 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
31 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
32 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
33 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
34 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
35 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
36 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
37 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
38 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
48 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
50 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
51 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
52 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
53 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
54 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
55 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
56 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
57 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
58 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
59 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
60 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
61 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
62 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
63 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
64 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
65 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
66 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
67 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
68 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
69 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
70 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
71 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
72 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
73 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
74 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
75 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
76 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
77 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
78 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
79 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
80 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
81 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
82 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
83 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
84 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
85 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
86 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
87 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
88 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
89 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
90 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
91 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
92 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
93 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
94 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
95 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
96 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
97 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
98 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
99 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
100 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
101 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
102 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
103 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
104 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
105 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
106 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
107 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
108 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
109 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
110 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
111 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
112 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
113 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
114 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
115 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
116 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
117 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
118 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
119 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
120 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
121 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
122 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
123 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
124 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
125 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
126 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
127 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
128 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
129 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
132 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
133 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
134 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
135 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
136 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
137 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
140 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
142 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
143 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
144 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
145 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
146 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
147 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
148 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
149 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
150 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
151 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
152 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
160 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
161 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
162 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
163 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
164 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
165 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
166 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
167 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
169 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
170 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
171 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
173 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
174 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
175 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
176 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
177 2511231004 Pseudomonas sp. GM102 Isolate Nodule
178 2511231007 Pseudomonas sp. GM18 Isolate Nodule
179 2511231010 Pseudomonas sp. GM25 Isolate Nodule
180 2511231011 Pseudomonas sp. GM30 Isolate Nodule
181 2511231016 Pseudomonas sp. GM50 Isolate Nodule
182 2511231018 Pseudomonas sp. GM60 Isolate Nodule
183 2511231019 Pseudomonas sp. GM67 Isolate Nodule
184 2511231021 Pseudomonas sp. GM78 Isolate Nodule
185 2511231022 Pseudomonas sp. GM79 Isolate Nodule
186 2511231031 Pseudomonas sp. GM16 Isolate Nodule
187 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
188 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
189 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
190 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
191 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
192 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
193 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
194 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
195 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
196 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
197 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
198 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
199 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
200 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
201 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
202 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
203 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
204 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
205 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
206 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
207 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
208 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
209 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
210 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
211 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
212 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
213 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
214 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
215 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
216 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
217 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
218 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
219 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
220 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
221 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
222 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
223 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
224 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
225 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
226 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
227 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
228 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
229 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
230 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
231 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
232 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
233 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
234 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
235 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
236 2773857670 Pseudomonas sp. 478 Isolate Unclassified
237 2773857673 Pseudomonas sp. 443 Isolate Unclassified
238 2784132063 Pseudomonas sp. 424 Isolate Unclassified
239 2784132072 Pseudomonas sp. 460 Isolate Unclassified
240 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
241 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
242 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
243 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
244 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
245 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
246 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
247 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
248 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
249 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
250 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
251 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
252 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
253 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
254 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
255 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
256 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
257 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
258 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
259 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
260 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
261 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
262 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
263 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
264 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
265 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
266 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
267 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
268 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
269 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
270 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
271 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
272 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
273 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
274 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
275 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
276 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
277 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
278 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
279 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
280 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
281 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
282 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
283 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
284 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
285 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
286 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
287 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
288 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
289 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
290 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.62
Metatranscriptomes 0
Isolates 16.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.7
Nodule 1.99
Rhizoplane 6.13
Rhizosphere 77.49
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_34 2124908027 Bacteria 17902
2 JGI25162J39368_1000013 3300002737 Bacteria 343384
3 JGI25163J39215_1000865 3300002771 Bacteria 7128
4 JGI25164J39214_1000005 3300002772 Bacteria 343384
5 JGI25165J46597_1000340 3300003214 Bacteria 54174
6 Ga0055536_1000452 3300003781 Bacteria 28896
7 Ga0055530_10000868 3300003791 Bacteria 24882
8 Ga0055540_1000009 3300003792 Bacteria 300466
9 Ga0055540_1000236 3300003792 Bacteria 50444
10 Ga0055531_10000668 3300003794 Bacteria 29325
11 Ga0065714_10000541 3300005288 Bacteria 3941
12 Ga0065714_10003562 3300005288 Bacteria 7428
13 Ga0065714_10006732 3300005288 Bacteria 4013
14 Ga0065704_10070326 3300005289 Bacteria 32542
15 Ga0065704_10107687 3300005289 Bacteria 2044
16 Ga0065704_10147333 3300005289 Bacteria 1456
17 Ga0065712_10003820 3300005290 Bacteria 6028
18 Ga0065712_10067779 3300005290 Bacteria 39385
19 Ga0075364_10098055 3300006051 Bacteria 1950
20 Ga0075432_10001993 3300006058 Bacteria 6780
21 Ga0079104_1000006 3300006946 Bacteria 396255
22 Ga0079104_1004425 3300006946 Bacteria 6033
23 Ga0105251_10000001 3300009011 Bacteria 466643
24 Ga0105251_10000244 3300009011 Bacteria 54761
25 Ga0105251_10005744 3300009011 Bacteria 8046
26 Ga0105251_10025767 3300009011 Bacteria 3003
27 Ga0105251_10042182 3300009011 Bacteria 2216
28 Ga0105244_10000286 3300009036 Bacteria 50004
29 Ga0105244_10000370 3300009036 Bacteria 41670
30 Ga0105244_10005435 3300009036 Bacteria 8472
31 Ga0105244_10005539 3300009036 Bacteria 8375
32 Ga0105250_10000082 3300009092 Bacteria 82954
33 Ga0105250_10000597 3300009092 Bacteria 23582
34 Ga0105250_10001774 3300009092 Bacteria 11324
35 Ga0105250_10018972 3300009092 Bacteria 2781
36 Ga0105243_10000170 3300009148 Bacteria 74646
37 Ga0105246_10081535 3300011119 Bacteria 2306
38 Ga0157345_1000014 3300012498 Bacteria 50849
39 Ga0157373_10001340 3300013100 Bacteria 18858
40 Ga0157373_10046802 3300013100 Bacteria 3086
41 Ga0157371_10000495 3300013102 Bacteria 47755
42 Ga0157371_10000754 3300013102 Bacteria 37446
43 Ga0157371_10003879 3300013102 Bacteria 13328
44 Ga0157370_10009885 3300013104 Bacteria 10111
45 Ga0157370_10012076 3300013104 Bacteria 8989
46 Ga0157370_10072175 3300013104 Bacteria 3258
47 Ga0157370_10103418 3300013104 Bacteria 2666
48 Ga0157369_10000417 3300013105 Bacteria 56214
49 Ga0157369_10005026 3300013105 Bacteria 15486
50 Ga0163162_10000210 3300013306 Bacteria 54200
51 Ga0163162_10028307 3300013306 Bacteria 5544
52 Ga0157372_10022235 3300013307 Bacteria 6861
53 Ga0157375_10033647 3300013308 Bacteria 4873
54 Ga0157375_10215135 3300013308 Bacteria 2079
55 Ga0182008_10003581 3300014497 Bacteria 9310
56 Ga0182008_10028591 3300014497 Bacteria 2819
57 Ga0182006_1000700 3300015261 Bacteria 23197
58 Ga0182006_1006385 3300015261 Bacteria 5488
59 Ga0182006_1020353 3300015261 Bacteria 2781
60 Ga0182007_10000493 3300015262 Bacteria 23546
61 Ga0182005_1001106 3300015265 Bacteria 11275
62 Ga0182005_1003464 3300015265 Bacteria 5339
63 Ga0182005_1008184 3300015265 Bacteria 3094
64 Ga0163161_10000221 3300017792 Bacteria 51978
65 Ga0163161_10004238 3300017792 Bacteria 10004
66 Ga0209760_100007 3300025207 Bacteria 211381
67 Ga0207427_100018 3300025231 Bacteria 530735
68 Ga0209437_100031 3300025233 Bacteria 530871
69 Ga0209233_1000012 3300025261 Bacteria 1019519
70 Ga0209676_1000002 3300025292 Bacteria 1732948
71 Ga0209676_1000020 3300025292 Bacteria 617256
72 Ga0209676_1002971 3300025292 Bacteria 11033
73 Ga0209050_1000006 3300025298 Bacteria 1359702
74 Ga0209050_1000009 3300025298 Bacteria 1047265
75 Ga0209051_1000001 3300025303 Bacteria 1732974
76 Ga0209051_1000008 3300025303 Bacteria 706935
77 Ga0209257_1000269 3300025304 Bacteria 119726
78 Ga0209257_1014155 3300025304 Bacteria 3457
79 Ga0207696_1000002 3300025711 Bacteria 1098043
80 Ga0207696_1000219 3300025711 Bacteria 83088
81 Ga0207696_1014406 3300025711 Bacteria 2715
82 Ga0207655_1000022 3300025728 Bacteria 483933
83 Ga0207655_1000167 3300025728 Bacteria 119650
84 Ga0207655_1000270 3300025728 Bacteria 81429
85 Ga0207655_1001481 3300025728 Bacteria 21559
86 Ga0207655_1002893 3300025728 Bacteria 13249
87 Ga0207655_1004012 3300025728 Bacteria 10636
88 Ga0207655_1007687 3300025728 Bacteria 6956
89 Ga0207655_1015363 3300025728 Bacteria 4261
90 Ga0207713_1000071 3300025735 Bacteria 186255
91 Ga0207713_1000117 3300025735 Bacteria 129339
92 Ga0207713_1000455 3300025735 Bacteria 42889
93 Ga0207713_1000827 3300025735 Bacteria 28559
94 Ga0207713_1008831 3300025735 Bacteria 5744
95 Ga0207681_10019433 3300025923 Bacteria 4292
96 Ga0207709_10000004 3300025935 Bacteria 825156
97 Ga0209281_1000011 3300027111 Bacteria 695292
98 Ga0209281_1003709 3300027111 Bacteria 4887
99 Ga0209371_1000385 3300027312 Bacteria 46739
100 Ga0207428_10076959 3300027907 Bacteria 2612
101 Ga0268256_1000394 3300030500 Bacteria 39863
102 Ga0314311_1201895 3300030733 Bacteria 2281
103 Ga0316178_1024507 3300030735 Bacteria 2562
104 Ga0316181_1002473 3300030744 Bacteria 2803
105 Ga0307408_100000345 3300031548 Bacteria 43522
106 Ga0307408_100004772 3300031548 Bacteria 9136
107 Ga0307408_100049356 3300031548 Bacteria 3022
108 Ga0307405_10004167 3300031731 Bacteria 6802
109 Ga0307405_10024260 3300031731 Bacteria 3461
110 Ga0307413_10041548 3300031824 Bacteria 2693
111 Ga0307406_10014173 3300031901 Bacteria 4581
112 Ga0307412_10001704 3300031911 Bacteria 12153
113 Ga0307412_10011369 3300031911 Bacteria 5154
114 Ga0307412_10045419 3300031911 Bacteria 2871
115 Ga0307414_10005429 3300032004 Bacteria 7018
116 Ga0307414_10015070 3300032004 Bacteria 4657
117 Ga0307414_10032746 3300032004 Bacteria 3427
118 Ga0307414_10053248 3300032004 Bacteria 2821
119 Ga0307411_10080104 3300032005 Bacteria 2244
120 Ga0307510_10000904 3300033180 Bacteria 31347
121 Ga0307510_10059412 3300033180 Bacteria 3949
122 Ga0237819_00519 3300038705 Bacteria 12945
123 Ga0439436_0002855 3300041404 Bacteria 5240
124 Ga0439438_000404 3300041405 Bacteria 19378
125 Ga0439438_000619 3300041405 Bacteria 16008
126 Ga0439438_000892 3300041405 Bacteria 13264
127 Ga0439438_001686 3300041405 Bacteria 9715
128 Ga0439438_003827 3300041405 Bacteria 5936
129 Ga0439438_004455 3300041405 Bacteria 5364
130 Ga0439438_005923 3300041405 Bacteria 4411
131 Ga0439447_000412 3300041407 Bacteria 15833
132 Ga0439447_000801 3300041407 Bacteria 11561
133 Ga0439447_005235 3300041407 Bacteria 4332
134 Ga0439447_022666 3300041407 Bacteria 1642
135 Ga0439466_0000125 3300041411 Bacteria 30280
136 Ga0439466_0027410 3300041411 Bacteria 1973
137 Ga0439432_001438 3300042006 Bacteria 8952
138 Ga0439432_003102 3300042006 Bacteria 6189
139 Ga0439432_007965 3300042006 Bacteria 3735
140 Ga0439451_002739 3300042009 Bacteria 3581
141 Ga0439451_010343 3300042009 Bacteria 1881
142 Ga0439451_011930 3300042009 Bacteria 1752
143 Ga0439452_000043 3300042010 Bacteria 132609
144 Ga0439452_000274 3300042010 Bacteria 34135
145 Ga0439452_001558 3300042010 Bacteria 9179
146 Ga0439463_000824 3300042016 Bacteria 8518
147 Ga0439463_005984 3300042016 Bacteria 3021
148 Ga0450911_000009 3300042115 Bacteria 162968
149 Ga0450911_000013 3300042115 Bacteria 129019
150 Ga0450902_001415 3300042137 Bacteria 3267
151 Ga0450903_001791 3300042138 Bacteria 3929
152 Ga0450904_000085 3300042139 Bacteria 21415
153 Ga0450904_001850 3300042139 Bacteria 2737
154 Ga0450904_002918 3300042139 Bacteria 1928
155 Ga0450906_000069 3300042145 Bacteria 16421
156 Ga0450907_000043 3300042146 Bacteria 55843
157 Ga0450907_001384 3300042146 Bacteria 5329
158 Ga0439446_0000269 3300042156 Bacteria 9755
159 Ga0450908_006666 3300042184 Bacteria 2186
160 Ga0439434_0001511 3300042435 Bacteria 6696
161 Ga0439459_0000104 3300042438 Bacteria 7798
162 Ga0439460_0000770 3300042461 Bacteria 7222
163 Ga0450893_0010574 3300042532 Bacteria 1518
164 Ga0439440_0004980 3300042993 Bacteria 2623
165 Ga0495617_000121 3300046452 Bacteria 51958
166 Ga0495617_001378 3300046452 Bacteria 10716
167 Ga0495617_011357 3300046452 Bacteria 3038
168 Ga0495627_000436 3300046453 Bacteria 36284
169 Ga0495627_002853 3300046453 Bacteria 7981
170 Ga0495627_004314 3300046453 Bacteria 5977
171 Ga0495590_0001677 3300046457 Bacteria 9429
172 Ga0495591_000125 3300046458 Bacteria 83668
173 Ga0495591_000447 3300046458 Bacteria 33587
174 Ga0495591_000682 3300046458 Bacteria 24796
175 Ga0495591_001495 3300046458 Bacteria 14432
176 Ga0495591_002035 3300046458 Bacteria 11747
177 Ga0495591_002103 3300046458 Bacteria 11463
178 Ga0495591_006613 3300046458 Bacteria 5086
179 Ga0495591_026177 3300046458 Bacteria 1817
180 Ga0495591_032598 3300046458 Bacteria 1549
181 Ga0495629_0028435 3300046459 Bacteria 3969
182 Ga0495638_0000813 3300046460 Bacteria 32881
183 Ga0495638_0012227 3300046460 Bacteria 5892
184 Ga0495638_0013785 3300046460 Bacteria 5488
185 Ga0495638_0021776 3300046460 Bacteria 4215
186 Ga0495638_0027335 3300046460 Bacteria 3694
187 Ga0495638_0126282 3300046460 Bacteria 1507
188 Ga0495653_0004419 3300046463 Bacteria 11367
189 Ga0495653_0025993 3300046463 Bacteria 4698
190 Ga0495653_0058115 3300046463 Bacteria 2940
191 Ga0495650_0000362 3300046471 Bacteria 80025
192 Ga0495650_0003554 3300046471 Bacteria 11281
193 Ga0495650_0004674 3300046471 Bacteria 9245
194 Ga0495650_0006999 3300046471 Bacteria 6885
195 Ga0495650_0021519 3300046471 Bacteria 3113
196 Ga0495605_0000001 3300046474 Bacteria 614538
197 Ga0495605_0000013 3300046474 Bacteria 308178
198 Ga0495605_0000346 3300046474 Bacteria 45641
199 Ga0495605_0001282 3300046474 Bacteria 16650
200 Ga0495605_0001797 3300046474 Bacteria 13762
201 Ga0495605_0006332 3300046474 Bacteria 6822
202 Ga0495605_0010541 3300046474 Bacteria 5169
203 Ga0495605_0017393 3300046474 Bacteria 3873
204 Ga0495605_0017396 3300046474 Bacteria 3873
205 Ga0495605_0020756 3300046474 Bacteria 3488
206 Ga0495605_0027427 3300046474 Bacteria 2951
207 Ga0495639_0000225 3300046475 Bacteria 28610
208 Ga0495639_0001349 3300046475 Bacteria 11021
209 Ga0495584_0001260 3300046491 Bacteria 15422
210 Ga0495584_0001861 3300046491 Bacteria 12207
211 Ga0495584_0002090 3300046491 Bacteria 11453
212 Ga0495584_0004332 3300046491 Bacteria 7639
213 Ga0495584_0004413 3300046491 Bacteria 7576
214 Ga0495584_0008896 3300046491 Bacteria 5191
215 Ga0495584_0011950 3300046491 Bacteria 4439
216 Ga0495584_0019495 3300046491 Bacteria 3445
217 Ga0495584_0080178 3300046491 Bacteria 1642
218 Ga0495585_0000149 3300046492 Bacteria 75947
219 Ga0495585_0001050 3300046492 Bacteria 22855
220 Ga0495585_0001228 3300046492 Bacteria 20763
221 Ga0495585_0001741 3300046492 Bacteria 16580
222 Ga0495585_0002596 3300046492 Bacteria 12776
223 Ga0495585_0003713 3300046492 Bacteria 10209
224 Ga0495585_0004677 3300046492 Bacteria 8823
225 Ga0495585_0008850 3300046492 Bacteria 6075
226 Ga0495585_0010245 3300046492 Bacteria 5593
227 Ga0495594_0000962 3300046499 Bacteria 14967
228 Ga0495594_0015881 3300046499 Bacteria 3960
229 Ga0495594_0018860 3300046499 Bacteria 3660
230 Ga0495596_0005045 3300046500 Bacteria 6303
231 Ga0495596_0015540 3300046500 Bacteria 3184
232 Ga0495607_0000031 3300046501 Bacteria 153964
233 Ga0495607_0000036 3300046501 Bacteria 140259
234 Ga0495607_0000167 3300046501 Bacteria 69947
235 Ga0495607_0000243 3300046501 Bacteria 58444
236 Ga0495607_0001042 3300046501 Bacteria 25419
237 Ga0495607_0001425 3300046501 Bacteria 21318
238 Ga0495607_0001540 3300046501 Bacteria 20221
239 Ga0495607_0002406 3300046501 Bacteria 15272
240 Ga0495607_0006649 3300046501 Bacteria 8103
241 Ga0495607_0006712 3300046501 Bacteria 8056
242 Ga0495607_0006926 3300046501 Bacteria 7904
243 Ga0495607_0008833 3300046501 Bacteria 6860
244 Ga0495607_0052279 3300046501 Bacteria 2367
245 Ga0495607_0058733 3300046501 Bacteria 2197
246 Ga0495607_0073316 3300046501 Bacteria 1903
247 Ga0495583_0000042 3300046506 Bacteria 234630
248 Ga0495583_0001762 3300046506 Bacteria 20649
249 Ga0495583_0002032 3300046506 Bacteria 18425
250 Ga0495583_0002803 3300046506 Bacteria 14296
251 Ga0495583_0002843 3300046506 Bacteria 14111
252 Ga0495583_0002891 3300046506 Bacteria 13899
253 Ga0495583_0006127 3300046506 Bacteria 7930
254 Ga0495583_0006791 3300046506 Bacteria 7395
255 Ga0495583_0014873 3300046506 Bacteria 4261
256 Ga0495583_0031304 3300046506 Bacteria 2580
257 Ga0495606_0000079 3300046507 Bacteria 164788
258 Ga0495606_0001306 3300046507 Bacteria 34340
259 Ga0495606_0001318 3300046507 Bacteria 33912
260 Ga0495606_0002405 3300046507 Bacteria 21856
261 Ga0495606_0002580 3300046507 Bacteria 20743
262 Ga0495606_0008307 3300046507 Bacteria 9050
263 Ga0495606_0010739 3300046507 Bacteria 7552
264 Ga0495606_0031175 3300046507 Bacteria 3710
265 Ga0495606_0051139 3300046507 Bacteria 2697
266 Ga0495606_0063314 3300046507 Bacteria 2358
267 Ga0495606_0104004 3300046507 Bacteria 1724
268 Ga0495610_0003360 3300046512 Bacteria 12545
269 Ga0495610_0004757 3300046512 Bacteria 9900
270 Ga0495610_0005187 3300046512 Bacteria 9332
271 Ga0495610_0007725 3300046512 Bacteria 7096
272 Ga0495610_0016446 3300046512 Bacteria 4256
273 Ga0495610_0021012 3300046512 Bacteria 3601
274 Ga0495610_0023057 3300046512 Bacteria 3391
275 Ga0495616_0000425 3300046513 Bacteria 32300
276 Ga0495616_0000985 3300046513 Bacteria 20408
277 Ga0495616_0001188 3300046513 Bacteria 18358
278 Ga0495616_0015339 3300046513 Bacteria 4260
279 Ga0495616_0018142 3300046513 Bacteria 3870
280 Ga0495616_0025174 3300046513 Bacteria 3183
281 Ga0495620_0000072 3300046515 Bacteria 83803
282 Ga0495620_0001042 3300046515 Bacteria 17030
283 Ga0495620_0001258 3300046515 Bacteria 15487
284 Ga0495620_0002700 3300046515 Bacteria 10239
285 Ga0495620_0008353 3300046515 Bacteria 5563
286 Ga0495620_0013181 3300046515 Bacteria 4241
287 Ga0495620_0024618 3300046515 Bacteria 2859
288 Ga0495620_0033365 3300046515 Bacteria 2337
289 Ga0495620_0045149 3300046515 Bacteria 1910
290 Ga0495628_0048613 3300046516 Bacteria 3362
291 Ga0495630_0213637 3300046517 Bacteria 1472
292 Ga0495630_0235050 3300046517 Bacteria 1400
293 Ga0495631_0000126 3300046518 Bacteria 51226
294 Ga0495631_0000317 3300046518 Bacteria 33439
295 Ga0495631_0008045 3300046518 Bacteria 5329
296 Ga0495631_0013175 3300046518 Bacteria 4019
297 Ga0495631_0015985 3300046518 Bacteria 3586
298 Ga0495631_0034850 3300046518 Bacteria 2254
299 Ga0495631_0039491 3300046518 Bacteria 2094
300 Ga0495631_0042505 3300046518 Bacteria 2008
301 Ga0495631_0059953 3300046518 Bacteria 1652
302 Ga0495632_0000619 3300046519 Bacteria 32813
303 Ga0495632_0000802 3300046519 Bacteria 27836
304 Ga0495632_0000900 3300046519 Bacteria 26055
305 Ga0495632_0003819 3300046519 Bacteria 10482
306 Ga0495632_0007767 3300046519 Bacteria 6687
307 Ga0495632_0016565 3300046519 Bacteria 4095
308 Ga0495632_0017416 3300046519 Bacteria 3966
309 Ga0495632_0018909 3300046519 Bacteria 3764
310 Ga0495632_0021584 3300046519 Bacteria 3467
311 Ga0495632_0073485 3300046519 Bacteria 1639
312 Ga0495637_0000075 3300046520 Bacteria 79690
313 Ga0495637_0000601 3300046520 Bacteria 25729
314 Ga0495637_0001741 3300046520 Bacteria 12488
315 Ga0495637_0002202 3300046520 Bacteria 10895
316 Ga0495637_0003359 3300046520 Bacteria 8512
317 Ga0495637_0003542 3300046520 Bacteria 8275
318 Ga0495637_0010431 3300046520 Bacteria 4493
319 Ga0495637_0012645 3300046520 Bacteria 4029
320 Ga0495637_0023280 3300046520 Bacteria 2817
321 Ga0495637_0037140 3300046520 Bacteria 2117
322 Ga0495637_0043959 3300046520 Bacteria 1904
323 Ga0495637_0052843 3300046520 Bacteria 1694
324 Ga0495643_0000609 3300046522 Bacteria 43060
325 Ga0495643_0001942 3300046522 Bacteria 17401
326 Ga0495643_0008277 3300046522 Bacteria 6601
327 Ga0495643_0009382 3300046522 Bacteria 6084
328 Ga0495643_0020125 3300046522 Bacteria 3854
329 Ga0495643_0032614 3300046522 Bacteria 2889
330 Ga0495643_0040289 3300046522 Bacteria 2551
331 Ga0495643_0045814 3300046522 Bacteria 2373
332 Ga0495644_0004101 3300046523 Bacteria 5734
333 Ga0495644_0006093 3300046523 Bacteria 4688
334 Ga0495644_0022870 3300046523 Bacteria 2381
335 Ga0495648_0001446 3300046524 Bacteria 23232
336 Ga0495648_0002725 3300046524 Bacteria 15959
337 Ga0495648_0002822 3300046524 Bacteria 15621
338 Ga0495648_0003147 3300046524 Bacteria 14684
339 Ga0495648_0004321 3300046524 Bacteria 12169
340 Ga0495648_0005714 3300046524 Bacteria 10271
341 Ga0495648_0007374 3300046524 Bacteria 8810
342 Ga0495648_0013372 3300046524 Bacteria 6074
343 Ga0495648_0024133 3300046524 Bacteria 4150
344 Ga0495648_0033893 3300046524 Bacteria 3330
345 Ga0495666_0009933 3300046526 Bacteria 4753
346 Ga0495666_0047989 3300046526 Bacteria 2057
347 Ga0495642_0000036 3300046528 Bacteria 79741
348 Ga0495642_0000808 3300046528 Bacteria 15185
349 Ga0495654_0000470 3300046530 Bacteria 33575
350 Ga0495654_0000626 3300046530 Bacteria 27978
351 Ga0495654_0001686 3300046530 Bacteria 14871
352 Ga0495654_0003837 3300046530 Bacteria 9085
353 Ga0495654_0006173 3300046530 Bacteria 6850
354 Ga0495654_0007040 3300046530 Bacteria 6331
355 Ga0495654_0013736 3300046530 Bacteria 4327
356 Ga0495654_0017306 3300046530 Bacteria 3791
357 Ga0495654_0037783 3300046530 Bacteria 2418
358 Ga0495654_0140749 3300046530 Bacteria 1075
359 Ga0495586_0001923 3300046535 Bacteria 11318
360 Ga0495587_0013149 3300046536 Bacteria 5203
361 Ga0495609_0000014 3300046538 Bacteria 326023
362 Ga0495609_0000016 3300046538 Bacteria 312882
363 Ga0495609_0000139 3300046538 Bacteria 76273
364 Ga0495609_0000549 3300046538 Bacteria 29734
365 Ga0495609_0001655 3300046538 Bacteria 14523
366 Ga0495609_0001874 3300046538 Bacteria 13441
367 Ga0495609_0005393 3300046538 Bacteria 6738
368 Ga0495609_0005598 3300046538 Bacteria 6552
369 Ga0495609_0005633 3300046538 Bacteria 6531
370 Ga0495597_0000012 3300046542 Bacteria 212005
371 Ga0495597_0000747 3300046542 Bacteria 25713
372 Ga0495597_0002817 3300046542 Bacteria 10669
373 Ga0495597_0007316 3300046542 Bacteria 5622
374 Ga0495597_0033720 3300046542 Bacteria 2317
375 Ga0495597_0041868 3300046542 Bacteria 2044
376 Ga0495597_0056062 3300046542 Bacteria 1726
377 Ga0495622_0000708 3300046557 Bacteria 18867
378 Ga0495622_0004326 3300046557 Bacteria 6611
379 Ga0495622_0008149 3300046557 Bacteria 4855
380 Ga0495622_0014841 3300046557 Bacteria 3621
381 Ga0495622_0024007 3300046557 Bacteria 2845
382 Ga0495633_0000194 3300046558 Bacteria 77718
383 Ga0495633_0000525 3300046558 Bacteria 38410
384 Ga0495633_0001015 3300046558 Bacteria 22970
385 Ga0495633_0031144 3300046558 Bacteria 2588
386 Ga0495668_0026771 3300046616 Bacteria 3270
387 Ga0495668_0056879 3300046616 Bacteria 2158
388 Ga0495668_0075574 3300046616 Bacteria 1850
389 Ga0495634_0004556 3300046642 Bacteria 10832
390 Ga0495611_0000048 3300046648 Bacteria 85172
391 Ga0495611_0000155 3300046648 Bacteria 49111
392 Ga0495611_0002213 3300046648 Bacteria 9041
393 Ga0495611_0003786 3300046648 Bacteria 6603
394 Ga0495611_0012342 3300046648 Bacteria 3633
395 Ga0495611_0016808 3300046648 Bacteria 3126
396 Ga0495611_0034631 3300046648 Bacteria 2233
397 Ga0495611_0058065 3300046648 Bacteria 1754
398 Ga0495625_0000084 3300046660 Bacteria 151895
399 Ga0495625_0000747 3300046660 Bacteria 45403
400 Ga0495625_0007629 3300046660 Bacteria 9386
401 Ga0495625_0025456 3300046660 Bacteria 4489
402 Ga0495625_0026921 3300046660 Bacteria 4336
403 Ga0495625_0068832 3300046660 Bacteria 2487
404 Ga0495625_0135184 3300046660 Bacteria 1667
405 Ga0495625_0138434 3300046660 Bacteria 1644
406 Ga0495625_0154095 3300046660 Bacteria 1543
407 Ga0495635_0005480 3300046663 Bacteria 8828
408 Ga0495635_0005526 3300046663 Bacteria 8792
409 Ga0495659_0000881 3300046664 Bacteria 10664
410 Ga0495659_0001585 3300046664 Bacteria 7647
411 Ga0495661_0000066 3300046665 Bacteria 127316
412 Ga0495661_0000191 3300046665 Bacteria 71123
413 Ga0495661_0000550 3300046665 Bacteria 38814
414 Ga0495661_0001498 3300046665 Bacteria 19446
415 Ga0495661_0007590 3300046665 Bacteria 7559
416 Ga0495661_0032457 3300046665 Bacteria 3300
417 Ga0495661_0045684 3300046665 Bacteria 2677
418 Ga0495661_0054032 3300046665 Bacteria 2413
419 Ga0495661_0088755 3300046665 Bacteria 1764
420 Ga0495646_0009598 3300046680 Bacteria 6142
421 Ga0495669_0003654 3300046684 Bacteria 6332
422 Ga0495613_0007224 3300046689 Bacteria 8271
423 Ga0495613_0155200 3300046689 Bacteria 1631
424 Ga0495670_0000304 3300046691 Bacteria 23231
425 Ga0495670_0000343 3300046691 Bacteria 22187
426 Ga0495670_0032743 3300046691 Bacteria 2586
427 Ga0495671_0000885 3300046692 Bacteria 21379
428 Ga0495671_0001882 3300046692 Bacteria 13487
429 Ga0495671_0002189 3300046692 Bacteria 12441
430 Ga0495671_0002694 3300046692 Bacteria 11129
431 Ga0495671_0004908 3300046692 Bacteria 7908
432 Ga0495671_0008536 3300046692 Bacteria 5757
433 Ga0495671_0009893 3300046692 Bacteria 5305
434 Ga0495671_0011136 3300046692 Bacteria 4963
435 Ga0495671_0019433 3300046692 Bacteria 3591
436 Ga0495671_0062587 3300046692 Bacteria 1833
437 Ga0495649_0000257 3300046694 Bacteria 47325
438 Ga0495649_0000423 3300046694 Bacteria 36623
439 Ga0495649_0000647 3300046694 Bacteria 28304
440 Ga0495649_0004281 3300046694 Bacteria 9363
441 Ga0495649_0061450 3300046694 Bacteria 2019
442 Ga0495649_0074762 3300046694 Bacteria 1815
443 Ga0495649_0098616 3300046694 Bacteria 1554
444 Ga0495589_0000395 3300046794 Bacteria 33322
445 Ga0495589_0000415 3300046794 Bacteria 32054
446 Ga0495589_0003199 3300046794 Bacteria 8940
447 Ga0495589_0003219 3300046794 Bacteria 8908
448 Ga0495589_0004795 3300046794 Bacteria 7185
449 Ga0495589_0019351 3300046794 Bacteria 3491
450 Ga0495660_0000710 3300046810 Bacteria 25564
451 Ga0495660_0001192 3300046810 Bacteria 18254
452 Ga0495660_0002031 3300046810 Bacteria 13160
453 Ga0495660_0004249 3300046810 Bacteria 8693
454 Ga0495660_0004345 3300046810 Bacteria 8583
455 Ga0495660_0004881 3300046810 Bacteria 8077
456 Ga0495660_0011102 3300046810 Bacteria 5229
457 Ga0495660_0016185 3300046810 Bacteria 4301
458 Ga0495660_0017417 3300046810 Bacteria 4137
459 Ga0495660_0057938 3300046810 Bacteria 2088
460 Ga0495660_0092769 3300046810 Bacteria 1566
461 Ga0495581_0096289 3300047315 Bacteria 1718
462 Ga0495636_0005235 3300047318 Bacteria 5091
463 Ga0495674_0035862 3300047319 Bacteria 4471
464 Ga0495672_0000407 3300047320 Bacteria 52187
465 Ga0495672_0002860 3300047320 Bacteria 15334
466 Ga0495672_0003925 3300047320 Bacteria 12480
467 Ga0495672_0010841 3300047320 Bacteria 6466
468 Ga0495676_0000039 3300047321 Bacteria 111011
469 Ga0495676_0000178 3300047321 Bacteria 50077
470 Ga0495680_0008212 3300047322 Bacteria 9513
471 Ga0495680_0070476 3300047322 Bacteria 2665
472 Ga0495683_0000002 3300047323 Bacteria 638279
473 Ga0495683_0000210 3300047323 Bacteria 55329
474 Ga0495683_0000231 3300047323 Bacteria 51177
475 Ga0495683_0008841 3300047323 Bacteria 5372
476 Ga0495683_0009078 3300047323 Bacteria 5295
477 Ga0495683_0009202 3300047323 Bacteria 5262
478 Ga0495687_002451 3300047443 Bacteria 14881
479 Ga0495687_014352 3300047443 Bacteria 4082
480 Ga0495687_053198 3300047443 Bacteria 1706
481 Ga0495675_0122044 3300047444 Bacteria 1622
482 Ga0495677_0001105 3300047445 Bacteria 10783
483 Ga0495679_000086 3300047446 Bacteria 85895
484 Ga0495679_000120 3300047446 Bacteria 69112
485 Ga0495679_001193 3300047446 Bacteria 15436
486 Ga0495679_005290 3300047446 Bacteria 5752
487 Ga0495679_020925 3300047446 Bacteria 2270
488 Ga0495679_027262 3300047446 Bacteria 1888
489 Ga0495685_002145 3300047447 Bacteria 6130
490 Ga0495685_023339 3300047447 Bacteria 2130
491 Ga0495673_0000077 3300047469 Bacteria 204403
492 Ga0495673_0000656 3300047469 Bacteria 34029
493 Ga0495673_0000966 3300047469 Bacteria 25951
494 Ga0495673_0001880 3300047469 Bacteria 15759
495 Ga0495673_0003303 3300047469 Bacteria 10699
496 Ga0495673_0003553 3300047469 Bacteria 10262
497 Ga0495673_0004171 3300047469 Bacteria 9131
498 Ga0495673_0004264 3300047469 Bacteria 9024
499 Ga0495673_0005765 3300047469 Bacteria 7422
500 Ga0495673_0006566 3300047469 Bacteria 6820
501 Ga0495673_0008322 3300047469 Bacteria 5846
502 Ga0495673_0020187 3300047469 Bacteria 3322
503 Ga0495673_0033952 3300047469 Bacteria 2362
504 Ga0495673_0044056 3300047469 Bacteria 1992
505 Ga0495673_0052826 3300047469 Bacteria 1774
506 Ga0495673_0060310 3300047469 Bacteria 1627
507 Ga0495673_0072251 3300047469 Bacteria 1448
508 Ga0495673_0095441 3300047469 Bacteria 1209
509 Ga0495681_0000031 3300047470 Bacteria 128177
510 Ga0495681_0000452 3300047470 Bacteria 31438
511 Ga0495681_0000574 3300047470 Bacteria 28103
512 Ga0495681_0004748 3300047470 Bacteria 9207
513 Ga0495681_0022478 3300047470 Bacteria 3373
514 Ga0495681_0033470 3300047470 Bacteria 2573
515 Ga0495686_0002047 3300047472 Bacteria 19858
516 Ga0495686_0002170 3300047472 Bacteria 19116
517 Ga0495686_0007907 3300047472 Bacteria 7897
518 Ga0495686_0088335 3300047472 Bacteria 1884
519 Ga0495686_0108115 3300047472 Bacteria 1671
520 Ga0495686_0159441 3300047472 Bacteria 1319
521 Ga0495593_0020133 3300047673 Bacteria 3736
522 Ga0495593_0032218 3300047673 Bacteria 2859
523 Ga0495626_0000002 3300048091 Bacteria 436012
524 Ga0495626_0000247 3300048091 Bacteria 62776
525 Ga0495626_0000451 3300048091 Bacteria 41891
526 Ga0495626_0002504 3300048091 Bacteria 12668
527 Ga0495626_0002881 3300048091 Bacteria 11471
528 Ga0495626_0003700 3300048091 Bacteria 9678
529 Ga0495626_0076849 3300048091 Bacteria 1489
530 Ga0496102_0000475 3300048905 Bacteria 44485
531 Ga0496103_0005061 3300048906 Bacteria 7945
532 Ga0496103_0137263 3300048906 Bacteria 1563
533 Ga0496106_0056781 3300048909 Bacteria 2960
534 Ga0496110_0307232 3300048913 Bacteria 1445
535 Ga0496111_0081872 3300048914 Bacteria 2357
536 Ga0496114_0272555 3300048917 Bacteria 1491
537 Ga0496116_0000435 3300048919 Bacteria 58557
538 Ga0496116_0002071 3300048919 Bacteria 21456
539 Ga0496116_0005464 3300048919 Bacteria 11770
540 Ga0496116_0006566 3300048919 Bacteria 10532
541 Ga0496117_0002804 3300048920 Bacteria 21271
542 Ga0496117_0009335 3300048920 Bacteria 9143
543 Ga0496117_0017384 3300048920 Bacteria 6005
544 Ga0496117_0032505 3300048920 Bacteria 3963
545 Ga0496118_0004796 3300048921 Bacteria 15793
546 Ga0496118_0048816 3300048921 Bacteria 3264
547 Ga0496118_0110444 3300048921 Bacteria 1826
548 Ga0496118_0180438 3300048921 Bacteria 1276
549 Ga0496120_0026653 3300048923 Bacteria 3565
550 Ga0496121_0003531 3300048924 Bacteria 22194
551 Ga0496121_0003988 3300048924 Bacteria 20364
552 Ga0496121_0005144 3300048924 Bacteria 17011
553 Ga0496121_0009440 3300048924 Bacteria 11214
554 Ga0496121_0025645 3300048924 Bacteria 5587
555 Ga0496122_0001036 3300048925 Bacteria 48813
556 Ga0496122_0009793 3300048925 Bacteria 10008
557 Ga0496122_0011459 3300048925 Bacteria 8974
558 Ga0496123_0000055 3300048926 Bacteria 233626
559 Ga0496123_0004385 3300048926 Bacteria 14876
560 Ga0496123_0012144 3300048926 Bacteria 7375
561 Ga0496123_0068090 3300048926 Bacteria 2244
562 Ga0496123_0085055 3300048926 Bacteria 1904
563 Ga0496123_0133089 3300048926 Bacteria 1373
564 Ga0496124_0000035 3300048927 Bacteria 318099
565 Ga0496124_0009778 3300048927 Bacteria 9814
566 Ga0496124_0041218 3300048927 Bacteria 3986
567 Ga0496124_0058655 3300048927 Bacteria 3236
568 Ga0496124_0120442 3300048927 Bacteria 2098
569 Ga0496125_0007026 3300048928 Bacteria 12043
570 Ga0496126_0037335 3300048929 Bacteria 4535
571 Ga0495678_000005 3300049459 Bacteria 522958
572 Ga0495678_000564 3300049459 Bacteria 35624
573 Ga0495678_001061 3300049459 Bacteria 23289
574 Ga0495678_005402 3300049459 Bacteria 7063
575 Ga0495678_012861 3300049459 Bacteria 3949
576 Ga0495678_019675 3300049459 Bacteria 3005
577 Ga0495678_033300 3300049459 Bacteria 2128
578 Ga0495678_036920 3300049459 Bacteria 1990
579 Ga0495678_042755 3300049459 Bacteria 1804
580 Ga0495682_0000395 3300049460 Bacteria 31474
581 Ga0495682_0001543 3300049460 Bacteria 12094
582 Ga0495682_0010757 3300049460 Bacteria 3532
583 Ga0501032_0047729 3300049569 Bacteria 2891
584 Ga0501226_000003 3300049853 Bacteria 358977
585 Ga0500572_000267 3300053111 Bacteria 18829
586 Ga0500618_002846 3300053125 Bacteria 6219
587 Ga0500586_007414 3300053145 Bacteria 2924
588 8034964998 8034962539 Bacteria 4884839
589 2511254280 2511231004 Bacteria 6669789
590 2511269517 2511231007 Bacteria 6306603
591 2511288630 2511231010 Bacteria 6373152
592 2511296136 2511231011 Bacteria 6149768
593 2511324595 2511231016 Bacteria 6704427
594 2511340806 2511231018 Bacteria 6436256
595 2511342466 2511231019 Bacteria 6520662
596 2511358668 2511231021 Bacteria 7302637
597 2511360274 2511231022 Bacteria 6719296
598 2511412682 2511231031 Bacteria 6558529
599 2511825251 2511231156 Bacteria 6845832
600 2599328893 2599185155 Bacteria 5827168
601 2599504736 2599185188 Bacteria 6164180
602 2599771717 2599185248 Bacteria 6696816
603 2599884254 2599185289 Bacteria 6778765
604 2599899259 2599185291 Bacteria 6775623
605 2599931177 2599185300 Bacteria 6062622
606 2599941411 2599185302 Bacteria 5954930
607 2599953069 2599185304 Bacteria 5951361
608 2599958606 2599185305 Bacteria 6748700
609 2599968281 2599185306 Bacteria 6637356
610 2599970170 2599185307 Bacteria 6194719
611 2599979467 2599185308 Bacteria 6621546
612 2599982677 2599185309 Bacteria 5969593
613 2599989722 2599185310 Bacteria 6014457
614 2599993055 2599185311 Bacteria 6354990
615 2599998619 2599185312 Bacteria 5912071
616 2600003531 2599185313 Bacteria 6658188
617 2600010006 2599185314 Bacteria 6621749
618 2600018108 2599185315 Bacteria 6771107
619 2600022956 2599185316 Bacteria 6320029
620 2600028904 2599185317 Bacteria 6435722
621 2600035927 2599185318 Bacteria 6961590
622 2600042990 2599185319 Bacteria 6637840
623 2600047297 2599185320 Bacteria 5963263
624 2600052627 2599185321 Bacteria 6764560
625 2600058049 2599185322 Bacteria 6763055
626 2600066276 2599185323 Bacteria 6688755
627 2600069446 2599185324 Bacteria 6590677
628 2600076324 2599185325 Bacteria 6324919
629 2600358071 2600254930 Bacteria 6431253
630 2600444400 2600254954 Bacteria 5100516
631 2601624497 2600255283 Bacteria 6061572
632 2602011485 2600255389 Bacteria 5275336
633 2624481032 2623620443 Bacteria 6427864
634 2624491630 2623620446 Bacteria 6500345
635 2643841549 2643221565 Bacteria 6216018
636 2644186512 2643221633 Bacteria 6733554
637 2652548223 2651869719 Bacteria 6047974
638 2671091310 2667528170 Bacteria 6786960
639 2671129363 2667528176 Bacteria 6724917
640 2678263200 2675903515 Bacteria 6580491
641 2718633947 2718217725 Bacteria 5758958
642 2738687989 2738541271 Bacteria 5657310
643 2739263576 2738543016 Bacteria 5657564
644 2739285165 2738543020 Bacteria 5718238
645 2739290479 2738543021 Bacteria 5718241
646 2739314629 2738543025 Bacteria 6600348
647 2745009532 2744054620 Bacteria 6551379
648 2774120145 2773857670 Bacteria 6407454
649 2774133999 2773857673 Bacteria 6513460
650 2784264232 2784132063 Bacteria 6262788
651 2784311924 2784132072 Bacteria 6596533
652 2794597653 2791355520 Bacteria 5948615
653 2808907926 2808606373 Bacteria 4423627
654 2808941364 2808606379 Bacteria 5022697
655 2808956369 2808606382 Bacteria 6841132
656 2812367708 2811994881 Bacteria 6298475
657 2823423516 2823421272 Bacteria 5372474
658 2825652570 2825651385 Bacteria 6715909
659 2826584843 2826581358 Bacteria 5963467
660 2842806727 2842805378 Bacteria 5385175
661 2842816345 2842815866 Bacteria 5947510
662 2842835008 2842832357 Bacteria 5959113
663 2842846745 2842843487 Bacteria 6004777
664 2842849915 2842849001 Bacteria 5924277
665 2842855130 2842854478 Bacteria 6143501
666 2852657682 2852657418 Bacteria 6472974
667 2860342940 2860339153 Bacteria 6846989
668 2904519899 2904518522 Bacteria 6068986
669 2913038975 2913036834 Bacteria 6704877
670 2919064731 2919063839 Bacteria 6302690
671 2919390246 2919385768 Bacteria 5897293
672 2919460539 2919456309 Bacteria 6586567
673 2919483969 2919481497 Bacteria 6907839
674 2919494419 2919493220 Bacteria 4598500
675 2919503152 2919501602 Bacteria 5286340
676 2919544040 2919543075 Bacteria 4728703
677 2919703375 2919697872 Bacteria 6553725
678 2923521758 2923519811 Bacteria 6298479
679 2923528990 2923525760 Bacteria 4472324
680 2923586816 2923586266 Bacteria 6565975
681 2926066277 2926063275 Bacteria 5285848
682 2929147903 2929144301 Bacteria 6622272
683 2931370171 2931369376 Bacteria 6847892
684 2931401572 2931396565 Bacteria 7251677
685 2974291249 2974289157 Bacteria 6080362
686 2988733961 2988728565 Bacteria 6124362
687 2990199381 2990196909 Bacteria 4054280
688 2998142529 2998139840 Bacteria 6073514
689 3007318477 3007315729 Bacteria 5076637
690 3007422981 3007419365 Bacteria 7026924
691 3007514029 3007511990 Bacteria 6481491
692 3007623416 3007619802 Bacteria 6411688
693 3007722569 3007718800 Bacteria 5971527
694 3007861814 3007861166 Bacteria 6045338
695 3007868614 3007866637 Bacteria 5899198
696 8011352312 8011350971 Bacteria 6158957
697 8019778474 8019775933 Bacteria 6858656
698 8029998165 8029995093 Bacteria 5990776
699 8056146855 8056143049 Bacteria 6307666
700 8056159118 8056155041 Bacteria 6486948
701 8056168555 8056166840 Bacteria 5820959
702 8056177989 8056177738 Bacteria 6748268
703 MRS2a_Contig_34
704 JGI25162J39368_1000013
705 JGI25163J39215_1000865
706 JGI25164J39214_1000005
707 JGI25165J46597_1000340
708 Ga0055536_1000452
709 Ga0055530_10000868
710 Ga0055540_1000009
711 Ga0055540_1000236
712 Ga0055531_10000668
713 Ga0065714_10000541
714 Ga0065714_10003562
715 Ga0065714_10006732
716 Ga0065704_10070326
717 Ga0065704_10107687
718 Ga0065704_10147333
719 Ga0065712_10003820
720 Ga0065712_10067779
721 Ga0075364_10098055
722 Ga0075432_10001993
723 Ga0079104_1000006
724 Ga0079104_1004425
725 Ga0105251_10000001
726 Ga0105251_10000244
727 Ga0105251_10005744
728 Ga0105251_10025767
729 Ga0105251_10042182
730 Ga0105244_10000286
731 Ga0105244_10000370
732 Ga0105244_10005435
733 Ga0105244_10005539
734 Ga0105250_10000082
735 Ga0105250_10000597
736 Ga0105250_10001774
737 Ga0105250_10018972
738 Ga0105243_10000170
739 Ga0105246_10081535
740 Ga0157345_1000014
741 Ga0157373_10001340
742 Ga0157373_10046802
743 Ga0157371_10000495
744 Ga0157371_10000754
745 Ga0157371_10003879
746 Ga0157370_10009885
747 Ga0157370_10012076
748 Ga0157370_10072175
749 Ga0157370_10103418
750 Ga0157369_10000417
751 Ga0157369_10005026
752 Ga0163162_10000210
753 Ga0163162_10028307
754 Ga0157372_10022235
755 Ga0157375_10033647
756 Ga0157375_10215135
757 Ga0182008_10003581
758 Ga0182008_10028591
759 Ga0182006_1000700
760 Ga0182006_1006385
761 Ga0182006_1020353
762 Ga0182007_10000493
763 Ga0182005_1001106
764 Ga0182005_1003464
765 Ga0182005_1008184
766 Ga0163161_10000221
767 Ga0163161_10004238
768 Ga0209760_100007
769 Ga0207427_100018
770 Ga0209437_100031
771 Ga0209233_1000012
772 Ga0209676_1000002
773 Ga0209676_1000020
774 Ga0209676_1002971
775 Ga0209050_1000006
776 Ga0209050_1000009
777 Ga0209051_1000001
778 Ga0209051_1000008
779 Ga0209257_1000269
780 Ga0209257_1014155
781 Ga0207696_1000002
782 Ga0207696_1000219
783 Ga0207696_1014406
784 Ga0207655_1000022
785 Ga0207655_1000167
786 Ga0207655_1000270
787 Ga0207655_1001481
788 Ga0207655_1002893
789 Ga0207655_1004012
790 Ga0207655_1007687
791 Ga0207655_1015363
792 Ga0207713_1000071
793 Ga0207713_1000117
794 Ga0207713_1000455
795 Ga0207713_1000827
796 Ga0207713_1008831
797 Ga0207681_10019433
798 Ga0207709_10000004
799 Ga0209281_1000011
800 Ga0209281_1003709
801 Ga0209371_1000385
802 Ga0207428_10076959
803 Ga0268256_1000394
804 Ga0314311_1201895
805 Ga0316178_1024507
806 Ga0316181_1002473
807 Ga0307408_100000345
808 Ga0307408_100004772
809 Ga0307408_100049356
810 Ga0307405_10004167
811 Ga0307405_10024260
812 Ga0307413_10041548
813 Ga0307406_10014173
814 Ga0307412_10001704
815 Ga0307412_10011369
816 Ga0307412_10045419
817 Ga0307414_10005429
818 Ga0307414_10015070
819 Ga0307414_10032746
820 Ga0307414_10053248
821 Ga0307411_10080104
822 Ga0307510_10000904
823 Ga0307510_10059412
824 Ga0237819_00519
825 Ga0439436_0002855
826 Ga0439438_000404
827 Ga0439438_000619
828 Ga0439438_000892
829 Ga0439438_001686
830 Ga0439438_003827
831 Ga0439438_004455
832 Ga0439438_005923
833 Ga0439447_000412
834 Ga0439447_000801
835 Ga0439447_005235
836 Ga0439447_022666
837 Ga0439466_0000125
838 Ga0439466_0027410
839 Ga0439432_001438
840 Ga0439432_003102
841 Ga0439432_007965
842 Ga0439451_002739
843 Ga0439451_010343
844 Ga0439451_011930
845 Ga0439452_000043
846 Ga0439452_000274
847 Ga0439452_001558
848 Ga0439463_000824
849 Ga0439463_005984
850 Ga0450911_000009
851 Ga0450911_000013
852 Ga0450902_001415
853 Ga0450903_001791
854 Ga0450904_000085
855 Ga0450904_001850
856 Ga0450904_002918
857 Ga0450906_000069
858 Ga0450907_000043
859 Ga0450907_001384
860 Ga0439446_0000269
861 Ga0450908_006666
862 Ga0439434_0001511
863 Ga0439459_0000104
864 Ga0439460_0000770
865 Ga0450893_0010574
866 Ga0439440_0004980
867 Ga0495617_000121
868 Ga0495617_001378
869 Ga0495617_011357
870 Ga0495627_000436
871 Ga0495627_002853
872 Ga0495627_004314
873 Ga0495590_0001677
874 Ga0495591_000125
875 Ga0495591_000447
876 Ga0495591_000682
877 Ga0495591_001495
878 Ga0495591_002035
879 Ga0495591_002103
880 Ga0495591_006613
881 Ga0495591_026177
882 Ga0495591_032598
883 Ga0495629_0028435
884 Ga0495638_0000813
885 Ga0495638_0012227
886 Ga0495638_0013785
887 Ga0495638_0021776
888 Ga0495638_0027335
889 Ga0495638_0126282
890 Ga0495653_0004419
891 Ga0495653_0025993
892 Ga0495653_0058115
893 Ga0495650_0000362
894 Ga0495650_0003554
895 Ga0495650_0004674
896 Ga0495650_0006999
897 Ga0495650_0021519
898 Ga0495605_0000001
899 Ga0495605_0000013
900 Ga0495605_0000346
901 Ga0495605_0001282
902 Ga0495605_0001797
903 Ga0495605_0006332
904 Ga0495605_0010541
905 Ga0495605_0017393
906 Ga0495605_0017396
907 Ga0495605_0020756
908 Ga0495605_0027427
909 Ga0495639_0000225
910 Ga0495639_0001349
911 Ga0495584_0001260
912 Ga0495584_0001861
913 Ga0495584_0002090
914 Ga0495584_0004332
915 Ga0495584_0004413
916 Ga0495584_0008896
917 Ga0495584_0011950
918 Ga0495584_0019495
919 Ga0495584_0080178
920 Ga0495585_0000149
921 Ga0495585_0001050
922 Ga0495585_0001228
923 Ga0495585_0001741
924 Ga0495585_0002596
925 Ga0495585_0003713
926 Ga0495585_0004677
927 Ga0495585_0008850
928 Ga0495585_0010245
929 Ga0495594_0000962
930 Ga0495594_0015881
931 Ga0495594_0018860
932 Ga0495596_0005045
933 Ga0495596_0015540
934 Ga0495607_0000031
935 Ga0495607_0000036
936 Ga0495607_0000167
937 Ga0495607_0000243
938 Ga0495607_0001042
939 Ga0495607_0001425
940 Ga0495607_0001540
941 Ga0495607_0002406
942 Ga0495607_0006649
943 Ga0495607_0006712
944 Ga0495607_0006926
945 Ga0495607_0008833
946 Ga0495607_0052279
947 Ga0495607_0058733
948 Ga0495607_0073316
949 Ga0495583_0000042
950 Ga0495583_0001762
951 Ga0495583_0002032
952 Ga0495583_0002803
953 Ga0495583_0002843
954 Ga0495583_0002891
955 Ga0495583_0006127
956 Ga0495583_0006791
957 Ga0495583_0014873
958 Ga0495583_0031304
959 Ga0495606_0000079
960 Ga0495606_0001306
961 Ga0495606_0001318
962 Ga0495606_0002405
963 Ga0495606_0002580
964 Ga0495606_0008307
965 Ga0495606_0010739
966 Ga0495606_0031175
967 Ga0495606_0051139
968 Ga0495606_0063314
969 Ga0495606_0104004
970 Ga0495610_0003360
971 Ga0495610_0004757
972 Ga0495610_0005187
973 Ga0495610_0007725
974 Ga0495610_0016446
975 Ga0495610_0021012
976 Ga0495610_0023057
977 Ga0495616_0000425
978 Ga0495616_0000985
979 Ga0495616_0001188
980 Ga0495616_0015339
981 Ga0495616_0018142
982 Ga0495616_0025174
983 Ga0495620_0000072
984 Ga0495620_0001042
985 Ga0495620_0001258
986 Ga0495620_0002700
987 Ga0495620_0008353
988 Ga0495620_0013181
989 Ga0495620_0024618
990 Ga0495620_0033365
991 Ga0495620_0045149
992 Ga0495628_0048613
993 Ga0495630_0213637
994 Ga0495630_0235050
995 Ga0495631_0000126
996 Ga0495631_0000317
997 Ga0495631_0008045
998 Ga0495631_0013175
999 Ga0495631_0015985
1000 Ga0495631_0034850
1001 Ga0495631_0039491
1002 Ga0495631_0042505
1003 Ga0495631_0059953
1004 Ga0495632_0000619
1005 Ga0495632_0000802
1006 Ga0495632_0000900
1007 Ga0495632_0003819
1008 Ga0495632_0007767
1009 Ga0495632_0016565
1010 Ga0495632_0017416
1011 Ga0495632_0018909
1012 Ga0495632_0021584
1013 Ga0495632_0073485
1014 Ga0495637_0000075
1015 Ga0495637_0000601
1016 Ga0495637_0001741
1017 Ga0495637_0002202
1018 Ga0495637_0003359
1019 Ga0495637_0003542
1020 Ga0495637_0010431
1021 Ga0495637_0012645
1022 Ga0495637_0023280
1023 Ga0495637_0037140
1024 Ga0495637_0043959
1025 Ga0495637_0052843
1026 Ga0495643_0000609
1027 Ga0495643_0001942
1028 Ga0495643_0008277
1029 Ga0495643_0009382
1030 Ga0495643_0020125
1031 Ga0495643_0032614
1032 Ga0495643_0040289
1033 Ga0495643_0045814
1034 Ga0495644_0004101
1035 Ga0495644_0006093
1036 Ga0495644_0022870
1037 Ga0495648_0001446
1038 Ga0495648_0002725
1039 Ga0495648_0002822
1040 Ga0495648_0003147
1041 Ga0495648_0004321
1042 Ga0495648_0005714
1043 Ga0495648_0007374
1044 Ga0495648_0013372
1045 Ga0495648_0024133
1046 Ga0495648_0033893
1047 Ga0495666_0009933
1048 Ga0495666_0047989
1049 Ga0495642_0000036
1050 Ga0495642_0000808
1051 Ga0495654_0000470
1052 Ga0495654_0000626
1053 Ga0495654_0001686
1054 Ga0495654_0003837
1055 Ga0495654_0006173
1056 Ga0495654_0007040
1057 Ga0495654_0013736
1058 Ga0495654_0017306
1059 Ga0495654_0037783
1060 Ga0495654_0140749
1061 Ga0495586_0001923
1062 Ga0495587_0013149
1063 Ga0495609_0000014
1064 Ga0495609_0000016
1065 Ga0495609_0000139
1066 Ga0495609_0000549
1067 Ga0495609_0001655
1068 Ga0495609_0001874
1069 Ga0495609_0005393
1070 Ga0495609_0005598
1071 Ga0495609_0005633
1072 Ga0495597_0000012
1073 Ga0495597_0000747
1074 Ga0495597_0002817
1075 Ga0495597_0007316
1076 Ga0495597_0033720
1077 Ga0495597_0041868
1078 Ga0495597_0056062
1079 Ga0495622_0000708
1080 Ga0495622_0004326
1081 Ga0495622_0008149
1082 Ga0495622_0014841
1083 Ga0495622_0024007
1084 Ga0495633_0000194
1085 Ga0495633_0000525
1086 Ga0495633_0001015
1087 Ga0495633_0031144
1088 Ga0495668_0026771
1089 Ga0495668_0056879
1090 Ga0495668_0075574
1091 Ga0495634_0004556
1092 Ga0495611_0000048
1093 Ga0495611_0000155
1094 Ga0495611_0002213
1095 Ga0495611_0003786
1096 Ga0495611_0012342
1097 Ga0495611_0016808
1098 Ga0495611_0034631
1099 Ga0495611_0058065
1100 Ga0495625_0000084
1101 Ga0495625_0000747
1102 Ga0495625_0007629
1103 Ga0495625_0025456
1104 Ga0495625_0026921
1105 Ga0495625_0068832
1106 Ga0495625_0135184
1107 Ga0495625_0138434
1108 Ga0495625_0154095
1109 Ga0495635_0005480
1110 Ga0495635_0005526
1111 Ga0495659_0000881
1112 Ga0495659_0001585
1113 Ga0495661_0000066
1114 Ga0495661_0000191
1115 Ga0495661_0000550
1116 Ga0495661_0001498
1117 Ga0495661_0007590
1118 Ga0495661_0032457
1119 Ga0495661_0045684
1120 Ga0495661_0054032
1121 Ga0495661_0088755
1122 Ga0495646_0009598
1123 Ga0495669_0003654
1124 Ga0495613_0007224
1125 Ga0495613_0155200
1126 Ga0495670_0000304
1127 Ga0495670_0000343
1128 Ga0495670_0032743
1129 Ga0495671_0000885
1130 Ga0495671_0001882
1131 Ga0495671_0002189
1132 Ga0495671_0002694
1133 Ga0495671_0004908
1134 Ga0495671_0008536
1135 Ga0495671_0009893
1136 Ga0495671_0011136
1137 Ga0495671_0019433
1138 Ga0495671_0062587
1139 Ga0495649_0000257
1140 Ga0495649_0000423
1141 Ga0495649_0000647
1142 Ga0495649_0004281
1143 Ga0495649_0061450
1144 Ga0495649_0074762
1145 Ga0495649_0098616
1146 Ga0495589_0000395
1147 Ga0495589_0000415
1148 Ga0495589_0003199
1149 Ga0495589_0003219
1150 Ga0495589_0004795
1151 Ga0495589_0019351
1152 Ga0495660_0000710
1153 Ga0495660_0001192
1154 Ga0495660_0002031
1155 Ga0495660_0004249
1156 Ga0495660_0004345
1157 Ga0495660_0004881
1158 Ga0495660_0011102
1159 Ga0495660_0016185
1160 Ga0495660_0017417
1161 Ga0495660_0057938
1162 Ga0495660_0092769
1163 Ga0495581_0096289
1164 Ga0495636_0005235
1165 Ga0495674_0035862
1166 Ga0495672_0000407
1167 Ga0495672_0002860
1168 Ga0495672_0003925
1169 Ga0495672_0010841
1170 Ga0495676_0000039
1171 Ga0495676_0000178
1172 Ga0495680_0008212
1173 Ga0495680_0070476
1174 Ga0495683_0000002
1175 Ga0495683_0000210
1176 Ga0495683_0000231
1177 Ga0495683_0008841
1178 Ga0495683_0009078
1179 Ga0495683_0009202
1180 Ga0495687_002451
1181 Ga0495687_014352
1182 Ga0495687_053198
1183 Ga0495675_0122044
1184 Ga0495677_0001105
1185 Ga0495679_000086
1186 Ga0495679_000120
1187 Ga0495679_001193
1188 Ga0495679_005290
1189 Ga0495679_020925
1190 Ga0495679_027262
1191 Ga0495685_002145
1192 Ga0495685_023339
1193 Ga0495673_0000077
1194 Ga0495673_0000656
1195 Ga0495673_0000966
1196 Ga0495673_0001880
1197 Ga0495673_0003303
1198 Ga0495673_0003553
1199 Ga0495673_0004171
1200 Ga0495673_0004264
1201 Ga0495673_0005765
1202 Ga0495673_0006566
1203 Ga0495673_0008322
1204 Ga0495673_0020187
1205 Ga0495673_0033952
1206 Ga0495673_0044056
1207 Ga0495673_0052826
1208 Ga0495673_0060310
1209 Ga0495673_0072251
1210 Ga0495673_0095441
1211 Ga0495681_0000031
1212 Ga0495681_0000452
1213 Ga0495681_0000574
1214 Ga0495681_0004748
1215 Ga0495681_0022478
1216 Ga0495681_0033470
1217 Ga0495686_0002047
1218 Ga0495686_0002170
1219 Ga0495686_0007907
1220 Ga0495686_0088335
1221 Ga0495686_0108115
1222 Ga0495686_0159441
1223 Ga0495593_0020133
1224 Ga0495593_0032218
1225 Ga0495626_0000002
1226 Ga0495626_0000247
1227 Ga0495626_0000451
1228 Ga0495626_0002504
1229 Ga0495626_0002881
1230 Ga0495626_0003700
1231 Ga0495626_0076849
1232 Ga0496102_0000475
1233 Ga0496103_0005061
1234 Ga0496103_0137263
1235 Ga0496106_0056781
1236 Ga0496110_0307232
1237 Ga0496111_0081872
1238 Ga0496114_0272555
1239 Ga0496116_0000435
1240 Ga0496116_0002071
1241 Ga0496116_0005464
1242 Ga0496116_0006566
1243 Ga0496117_0002804
1244 Ga0496117_0009335
1245 Ga0496117_0017384
1246 Ga0496117_0032505
1247 Ga0496118_0004796
1248 Ga0496118_0048816
1249 Ga0496118_0110444
1250 Ga0496118_0180438
1251 Ga0496120_0026653
1252 Ga0496121_0003531
1253 Ga0496121_0003988
1254 Ga0496121_0005144
1255 Ga0496121_0009440
1256 Ga0496121_0025645
1257 Ga0496122_0001036
1258 Ga0496122_0009793
1259 Ga0496122_0011459
1260 Ga0496123_0000055
1261 Ga0496123_0004385
1262 Ga0496123_0012144
1263 Ga0496123_0068090
1264 Ga0496123_0085055
1265 Ga0496123_0133089
1266 Ga0496124_0000035
1267 Ga0496124_0009778
1268 Ga0496124_0041218
1269 Ga0496124_0058655
1270 Ga0496124_0120442
1271 Ga0496125_0007026
1272 Ga0496126_0037335
1273 Ga0495678_000005
1274 Ga0495678_000564
1275 Ga0495678_001061
1276 Ga0495678_005402
1277 Ga0495678_012861
1278 Ga0495678_019675
1279 Ga0495678_033300
1280 Ga0495678_036920
1281 Ga0495678_042755
1282 Ga0495682_0000395
1283 Ga0495682_0001543
1284 Ga0495682_0010757
1285 Ga0501032_0047729
1286 Ga0501226_000003
1287 Ga0500572_000267
1288 Ga0500618_002846
1289 Ga0500586_007414
1290 8034964998
1291 2511254280
1292 2511269517
1293 2511288630
1294 2511296136
1295 2511324595
1296 2511340806
1297 2511342466
1298 2511358668
1299 2511360274
1300 2511412682
1301 2511825251
1302 2599328893
1303 2599504736
1304 2599771717
1305 2599884254
1306 2599899259
1307 2599931177
1308 2599941411
1309 2599953069
1310 2599958606
1311 2599968281
1312 2599970170
1313 2599979467
1314 2599982677
1315 2599989722
1316 2599993055
1317 2599998619
1318 2600003531
1319 2600010006
1320 2600018108
1321 2600022956
1322 2600028904
1323 2600035927
1324 2600042990
1325 2600047297
1326 2600052627
1327 2600058049
1328 2600066276
1329 2600069446
1330 2600076324
1331 2600358071
1332 2600444400
1333 2601624497
1334 2602011485
1335 2624481032
1336 2624491630
1337 2643841549
1338 2644186512
1339 2652548223
1340 2671091310
1341 2671129363
1342 2678263200
1343 2718633947
1344 2738687989
1345 2739263576
1346 2739285165
1347 2739290479
1348 2739314629
1349 2745009532
1350 2774120145
1351 2774133999
1352 2784264232
1353 2784311924
1354 2794597653
1355 2808907926
1356 2808941364
1357 2808956369
1358 2812367708
1359 2823423516
1360 2825652570
1361 2826584843
1362 2842806727
1363 2842816345
1364 2842835008
1365 2842846745
1366 2842849915
1367 2842855130
1368 2852657682
1369 2860342940
1370 2904519899
1371 2913038975
1372 2919064731
1373 2919390246
1374 2919460539
1375 2919483969
1376 2919494419
1377 2919503152
1378 2919544040
1379 2919703375
1380 2923521758
1381 2923528990
1382 2923586816
1383 2926066277
1384 2929147903
1385 2931370171
1386 2931401572
1387 2974291249
1388 2988733961
1389 2990199381
1390 2998142529
1391 3007318477
1392 3007422981
1393 3007514029
1394 3007623416
1395 3007722569
1396 3007861814
1397 3007868614
1398 8011352312
1399 8019778474
1400 8029998165
1401 8056146855
1402 8056159118
1403 8056168555
1404 8056177989

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00437

T2SSE

Type II/IV secretion system protein

15

282

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
2eyu-assembly2.cif.gz_B the crystal structure of the c-terminal domain of aquifex aeolicus pilt 0.8649 119 362
2eyu-assembly2.cif.gz_B the crystal structure of the c-terminal domain of aquifex aeolicus pilt 0.8519 119 362
3jvu-assembly1.cif.gz_A-2 crystal structure of unliganded p. aeruginosa pilt 0.8419 18 354
3jvv-assembly1.cif.gz_A-2 crystal structure of p. aeruginosa pilt with bound amp-pcp 0.8363 18 354
3jvu-assembly1.cif.gz_A-2 crystal structure of unliganded p. aeruginosa pilt 0.8306 18 354
ID Description Score Start End Superfamily
5fl3A01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.9318 17 115 3.30.450.90
3jvvA01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.9291 18 114 3.30.450.90
5fl3A01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.9144 17 115 3.30.450.90
3jvvC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8967 117 354 3.40.50.300
3jvvA01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.8943 18 114 3.30.450.90
ID Description Score Start End GO Terms
AF-A0A699WNI5-F1-model_v4 Bacterial type II secretion system protein E domain-containing protein 0.9886 210 333 GO:0016887
AF-T1AK23-F1-model_v4 Twitching motility protein 0.9881 269 363
AF-D4XNG8-F1-model_v4 Bacterial type II secretion system protein E domain-containing protein 0.9839 215 369 GO:0016887
AF-A0A0P9IIX6-F1-model_v4 deleted 0.9798 258 357
AF-A0A0B8PIJ7-F1-model_v4 Twitching motility protein pilT 0.9791 266 347

Map