F476141
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 701 | 266 | 1402 | 271 |
Family's Representative Sequence
| Representative Sequence | 3300005434|Ga0070709_10008870|Ga0070709_100088703 |
| Length | 297 |
| Sequence | MRSGTAGTIWRASAQLWAGDLMTRTPKLMAVLAHPDDESLGVGGALAKYASEGVDVFLLTATRGDSGRFRGYRLEDNQHPGPLALANIREAELRGAASVLGVREVSILDYRDQHLDRANPREAVAAIVGHLRRIQPDVVVTFGPDGAYGHPDHIAISQFTTAAIVAAADAAFPGDGIASPQQHAVSKLYYIAWPESAWKAYQSAFRKLVSMVDGMERQAIPWPDWAVTTVIDTRNFWSTVWRAICCHESQVTAYERLKDLSPDDHEALWGQQSFYRVFSTVNGGRGRETDLLEGIRT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 165 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 169 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 170 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 171 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 172 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 173 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 174 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 175 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 176 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 177 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 178 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 179 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 180 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 181 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 182 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 185 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 186 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 187 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 188 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 235 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 236 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 237 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 238 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 239 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 240 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 243 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 244 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 245 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 246 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 247 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 254 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 255 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.71 |
| Nodule | 0 |
| Rhizoplane | 3.42 |
| Rhizosphere | 95.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 23.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070709_10008870 | 3300005434 | Bacteria | 5536 |
| 2 | Ga0065712_10007200 | 3300005290 | Bacteria | 6182 |
| 3 | Ga0065712_10084010 | 3300005290 | Bacteria | 2795 |
| 4 | Ga0065715_10157136 | 3300005293 | Bacteria | 1665 |
| 5 | Ga0065707_10008911 | 3300005295 | Bacteria | 3801 |
| 6 | Ga0065707_10011530 | 3300005295 | Bacteria | 2361 |
| 7 | Ga0070676_10020595 | 3300005328 | Bacteria | 3685 |
| 8 | Ga0070676_10226580 | 3300005328 | Bacteria | 1237 |
| 9 | Ga0070676_10292487 | 3300005328 | Bacteria | 1101 |
| 10 | Ga0070683_100043393 | 3300005329 | Plasmid | 4145 |
| 11 | Ga0070683_100060680 | 3300005329 | Bacteria | 3515 |
| 12 | Ga0070683_100137178 | 3300005329 | Bacteria | 2317 |
| 13 | Ga0070690_100125576 | 3300005330 | Bacteria | 1727 |
| 14 | Ga0070690_100145888 | 3300005330 | Unclassified | 1610 |
| 15 | Ga0070670_100000980 | 3300005331 | Bacteria | 22371 |
| 16 | Ga0070670_100023524 | 3300005331 | Bacteria | 5304 |
| 17 | Ga0070670_100038827 | 3300005331 | Bacteria | 4094 |
| 18 | Ga0070670_100054934 | 3300005331 | Bacteria | 3419 |
| 19 | Ga0070670_100080664 | 3300005331 | Bacteria | 2796 |
| 20 | Ga0070670_100257881 | 3300005331 | Bacteria | 1520 |
| 21 | Ga0068869_100120331 | 3300005334 | Bacteria | 2007 |
| 22 | Ga0070666_10009508 | 3300005335 | Bacteria | 6063 |
| 23 | Ga0070680_100513362 | 3300005336 | Bacteria | 1026 |
| 24 | Ga0068868_100047963 | 3300005338 | Unclassified | 3350 |
| 25 | Ga0068868_100111457 | 3300005338 | Bacteria | 2224 |
| 26 | Ga0068868_100148196 | 3300005338 | Unclassified | 1931 |
| 27 | Ga0068868_100161651 | 3300005338 | Bacteria | 1850 |
| 28 | Ga0068868_100438489 | 3300005338 | Unclassified | 1134 |
| 29 | Ga0070660_100076509 | 3300005339 | Unclassified | 2621 |
| 30 | Ga0070689_100010826 | 3300005340 | Bacteria | 6519 |
| 31 | Ga0070689_100031094 | 3300005340 | Bacteria | 4056 |
| 32 | Ga0070687_100021411 | 3300005343 | Bacteria | 3039 |
| 33 | Ga0070661_100084721 | 3300005344 | Bacteria | 2341 |
| 34 | Ga0070661_100115426 | 3300005344 | Unclassified | 2008 |
| 35 | Ga0070661_100199012 | 3300005344 | Bacteria | 1530 |
| 36 | Ga0070669_100001432 | 3300005353 | Bacteria | 17255 |
| 37 | Ga0070675_100004642 | 3300005354 | Bacteria | 10490 |
| 38 | Ga0070675_100006220 | 3300005354 | Bacteria | 9159 |
| 39 | Ga0070675_100132931 | 3300005354 | Bacteria | 2122 |
| 40 | Ga0070675_100221027 | 3300005354 | Bacteria | 1649 |
| 41 | Ga0070671_100247207 | 3300005355 | Unclassified | 1515 |
| 42 | Ga0070671_100517010 | 3300005355 | Unclassified | 1028 |
| 43 | Ga0070674_100011803 | 3300005356 | Bacteria | 5333 |
| 44 | Ga0070674_100090522 | 3300005356 | Bacteria | 2207 |
| 45 | Ga0070673_100025882 | 3300005364 | Bacteria | 4325 |
| 46 | Ga0070673_100099469 | 3300005364 | Bacteria | 2393 |
| 47 | Ga0070688_100086600 | 3300005365 | Bacteria | 2039 |
| 48 | Ga0070688_100153545 | 3300005365 | Bacteria | 1576 |
| 49 | Ga0070659_100035103 | 3300005366 | Plasmid | 3903 |
| 50 | Ga0070667_100057092 | 3300005367 | Unclassified | 3298 |
| 51 | Ga0070667_100352934 | 3300005367 | Bacteria | 1332 |
| 52 | Ga0070709_10190611 | 3300005434 | Bacteria | 1446 |
| 53 | Ga0070714_100086561 | 3300005435 | Bacteria | 2738 |
| 54 | Ga0070714_100526011 | 3300005435 | Unclassified | 1130 |
| 55 | Ga0070713_100002726 | 3300005436 | Bacteria | 11539 |
| 56 | Ga0070713_100008525 | 3300005436 | Bacteria | 7272 |
| 57 | Ga0070713_100012642 | 3300005436 | Bacteria | 6202 |
| 58 | Ga0070713_100018872 | 3300005436 | Bacteria | 5251 |
| 59 | Ga0070713_100032939 | 3300005436 | Unclassified | 4146 |
| 60 | Ga0070713_100198421 | 3300005436 | Unclassified | 1811 |
| 61 | Ga0070713_100283256 | 3300005436 | Bacteria | 1521 |
| 62 | Ga0070713_100301916 | 3300005436 | Bacteria | 1474 |
| 63 | Ga0070710_10305782 | 3300005437 | Bacteria | 1039 |
| 64 | Ga0070711_100000111 | 3300005439 | Bacteria | 42762 |
| 65 | Ga0070711_100002761 | 3300005439 | Bacteria | 10069 |
| 66 | Ga0070711_100440460 | 3300005439 | Bacteria | 1065 |
| 67 | Ga0070700_100008707 | 3300005441 | Bacteria | 5537 |
| 68 | Ga0070700_100087448 | 3300005441 | Unclassified | 2026 |
| 69 | Ga0070694_100123407 | 3300005444 | Unclassified | 1861 |
| 70 | Ga0070708_100098056 | 3300005445 | Bacteria | 2680 |
| 71 | Ga0070708_100262845 | 3300005445 | Unclassified | 1622 |
| 72 | Ga0070678_100009655 | 3300005456 | Bacteria | 5860 |
| 73 | Ga0070678_100135065 | 3300005456 | Bacteria | 1966 |
| 74 | Ga0070662_100057393 | 3300005457 | Unclassified | 2829 |
| 75 | Ga0070681_10010740 | 3300005458 | Bacteria | 9050 |
| 76 | Ga0070681_10315316 | 3300005458 | Bacteria | 1473 |
| 77 | Ga0070681_10404745 | 3300005458 | Unclassified | 1276 |
| 78 | Ga0068867_100020517 | 3300005459 | Bacteria | 4709 |
| 79 | Ga0068867_100061938 | 3300005459 | Bacteria | 2779 |
| 80 | Ga0068867_100135965 | 3300005459 | Unclassified | 1916 |
| 81 | Ga0068867_100541235 | 3300005459 | Bacteria | 1007 |
| 82 | Ga0068867_100632796 | 3300005459 | Bacteria | 937 |
| 83 | Ga0070706_100100417 | 3300005467 | Unclassified | 2689 |
| 84 | Ga0070707_100014693 | 3300005468 | Bacteria | 7338 |
| 85 | Ga0070698_100340228 | 3300005471 | Bacteria | 1432 |
| 86 | Ga0070679_100013137 | 3300005530 | Bacteria | 7928 |
| 87 | Ga0070684_100050616 | 3300005535 | Bacteria | 3609 |
| 88 | Ga0070684_100078744 | 3300005535 | Unclassified | 2912 |
| 89 | Ga0070684_100090100 | 3300005535 | Bacteria | 2727 |
| 90 | Ga0070697_100014531 | 3300005536 | Bacteria | 6184 |
| 91 | Ga0070697_100162137 | 3300005536 | Unclassified | 1889 |
| 92 | Ga0068853_100048180 | 3300005539 | Bacteria | 3659 |
| 93 | Ga0070672_100025343 | 3300005543 | Bacteria | 4397 |
| 94 | Ga0070672_100045157 | 3300005543 | Bacteria | 3406 |
| 95 | Ga0070672_100388069 | 3300005543 | Bacteria | 1195 |
| 96 | Ga0070686_100083552 | 3300005544 | Bacteria | 2120 |
| 97 | Ga0070695_100307352 | 3300005545 | Bacteria | 1174 |
| 98 | Ga0070693_100028535 | 3300005547 | Bacteria | 3035 |
| 99 | Ga0070693_100081838 | 3300005547 | Unclassified | 1927 |
| 100 | Ga0070693_100163548 | 3300005547 | Bacteria | 1419 |
| 101 | Ga0070665_100044381 | 3300005548 | Bacteria | 4464 |
| 102 | Ga0070704_100002288 | 3300005549 | Bacteria | 10700 |
| 103 | Ga0070704_100595128 | 3300005549 | Unclassified | 971 |
| 104 | Ga0068855_100001075 | 3300005563 | Bacteria | 33944 |
| 105 | Ga0068855_100015384 | 3300005563 | Bacteria | 9212 |
| 106 | Ga0068855_100082070 | 3300005563 | Bacteria | 3737 |
| 107 | Ga0068855_100175308 | 3300005563 | Bacteria | 2427 |
| 108 | Ga0068855_100274114 | 3300005563 | Bacteria | 1875 |
| 109 | Ga0070664_100008078 | 3300005564 | Bacteria | 8505 |
| 110 | Ga0070664_100011113 | 3300005564 | Bacteria | 7299 |
| 111 | Ga0070664_100021979 | 3300005564 | Bacteria | 5261 |
| 112 | Ga0070664_100034700 | 3300005564 | Bacteria | 4232 |
| 113 | Ga0070664_100064966 | 3300005564 | Bacteria | 3113 |
| 114 | Ga0070664_100089372 | 3300005564 | Unclassified | 2665 |
| 115 | Ga0070664_100135597 | 3300005564 | Bacteria | 2164 |
| 116 | Ga0070664_100226926 | 3300005564 | Unclassified | 1673 |
| 117 | Ga0070664_100324107 | 3300005564 | Bacteria | 1396 |
| 118 | Ga0070664_100734204 | 3300005564 | Unclassified | 921 |
| 119 | Ga0068857_100000091 | 3300005577 | Bacteria | 52422 |
| 120 | Ga0068857_100005889 | 3300005577 | Bacteria | 10466 |
| 121 | Ga0068857_100029279 | 3300005577 | Bacteria | 4859 |
| 122 | Ga0068856_100002148 | 3300005614 | Bacteria | 20438 |
| 123 | Ga0068856_100010450 | 3300005614 | Bacteria | 9010 |
| 124 | Ga0068856_100118719 | 3300005614 | Bacteria | 2646 |
| 125 | Ga0068856_100291031 | 3300005614 | Bacteria | 1650 |
| 126 | Ga0070702_100165270 | 3300005615 | Bacteria | 1434 |
| 127 | Ga0068852_100575169 | 3300005616 | Bacteria | 1129 |
| 128 | Ga0068859_100002342 | 3300005617 | Bacteria | 19265 |
| 129 | Ga0068859_100090476 | 3300005617 | Unclassified | 3111 |
| 130 | Ga0068859_100177335 | 3300005617 | Bacteria | 2213 |
| 131 | Ga0068864_100005198 | 3300005618 | Bacteria | 10664 |
| 132 | Ga0068864_100012162 | 3300005618 | Bacteria | 7114 |
| 133 | Ga0068864_100024210 | 3300005618 | Bacteria | 5105 |
| 134 | Ga0068864_100024710 | 3300005618 | Bacteria | 5055 |
| 135 | Ga0068864_100056404 | 3300005618 | Bacteria | 3394 |
| 136 | Ga0068864_100240256 | 3300005618 | Bacteria | 1678 |
| 137 | Ga0068864_100372455 | 3300005618 | Bacteria | 1352 |
| 138 | Ga0068861_100006026 | 3300005719 | Bacteria | 8243 |
| 139 | Ga0068861_100280749 | 3300005719 | Unclassified | 1434 |
| 140 | Ga0068851_10199770 | 3300005834 | Unclassified | 1115 |
| 141 | Ga0068870_10119874 | 3300005840 | Unclassified | 1514 |
| 142 | Ga0068863_100005319 | 3300005841 | Bacteria | 12701 |
| 143 | Ga0068863_100048620 | 3300005841 | Unclassified | 4021 |
| 144 | Ga0068863_100060102 | 3300005841 | Bacteria | 3594 |
| 145 | Ga0068863_100071617 | 3300005841 | Bacteria | 3279 |
| 146 | Ga0068863_100134763 | 3300005841 | Bacteria | 2359 |
| 147 | Ga0068863_100290145 | 3300005841 | Unclassified | 1586 |
| 148 | Ga0068863_100470540 | 3300005841 | Bacteria | 1235 |
| 149 | Ga0068858_100004558 | 3300005842 | Bacteria | 13571 |
| 150 | Ga0068858_100005359 | 3300005842 | Bacteria | 12583 |
| 151 | Ga0068858_100010258 | 3300005842 | Bacteria | 8886 |
| 152 | Ga0068858_100066344 | 3300005842 | Bacteria | 3341 |
| 153 | Ga0068858_100103580 | 3300005842 | Bacteria | 2655 |
| 154 | Ga0068858_100438591 | 3300005842 | Bacteria | 1258 |
| 155 | Ga0068858_100532302 | 3300005842 | Bacteria | 1137 |
| 156 | Ga0068860_100004722 | 3300005843 | Bacteria | 13895 |
| 157 | Ga0068860_100021862 | 3300005843 | Bacteria | 6190 |
| 158 | Ga0068860_100619510 | 3300005843 | Unclassified | 1089 |
| 159 | Ga0068862_100001212 | 3300005844 | Bacteria | 24331 |
| 160 | Ga0081455_10143357 | 3300005937 | Unclassified | 1852 |
| 161 | Ga0081455_10158519 | 3300005937 | Bacteria | 1737 |
| 162 | Ga0070717_10007582 | 3300006028 | Bacteria | 8064 |
| 163 | Ga0070717_10271266 | 3300006028 | Unclassified | 1503 |
| 164 | Ga0075368_10045231 | 3300006042 | Bacteria | 1738 |
| 165 | Ga0070716_100082022 | 3300006173 | Bacteria | 1927 |
| 166 | Ga0070712_100007166 | 3300006175 | Bacteria | 6954 |
| 167 | Ga0070712_100010213 | 3300006175 | Bacteria | 5919 |
| 168 | Ga0070712_100114352 | 3300006175 | Unclassified | 2020 |
| 169 | Ga0075366_10080090 | 3300006195 | Bacteria | 1950 |
| 170 | Ga0097621_100000413 | 3300006237 | Bacteria | 29856 |
| 171 | Ga0097621_100000452 | 3300006237 | Bacteria | 28745 |
| 172 | Ga0097621_100006552 | 3300006237 | Bacteria | 8270 |
| 173 | Ga0097621_100007741 | 3300006237 | Bacteria | 7702 |
| 174 | Ga0097621_100010149 | 3300006237 | Bacteria | 6876 |
| 175 | Ga0097621_100014081 | 3300006237 | Bacteria | 5978 |
| 176 | Ga0097621_100067234 | 3300006237 | Unclassified | 2953 |
| 177 | Ga0097621_100085917 | 3300006237 | Bacteria | 2625 |
| 178 | Ga0097621_100087326 | 3300006237 | Unclassified | 2604 |
| 179 | Ga0097621_100116300 | 3300006237 | Bacteria | 2264 |
| 180 | Ga0097621_100551808 | 3300006237 | Bacteria | 1049 |
| 181 | Ga0075370_10201654 | 3300006353 | Bacteria | 1173 |
| 182 | Ga0068871_100000150 | 3300006358 | Bacteria | 45815 |
| 183 | Ga0068871_100001131 | 3300006358 | Bacteria | 17890 |
| 184 | Ga0068871_100011632 | 3300006358 | Bacteria | 6462 |
| 185 | Ga0068871_100030891 | 3300006358 | Unclassified | 4221 |
| 186 | Ga0068871_100054996 | 3300006358 | Bacteria | 3230 |
| 187 | Ga0068871_100133172 | 3300006358 | Bacteria | 2109 |
| 188 | Ga0068871_100146593 | 3300006358 | Bacteria | 2010 |
| 189 | Ga0068871_100197421 | 3300006358 | Unclassified | 1736 |
| 190 | Ga0068871_100363188 | 3300006358 | Unclassified | 1283 |
| 191 | Ga0075428_100001755 | 3300006844 | Bacteria | 23151 |
| 192 | Ga0075428_100004899 | 3300006844 | Bacteria | 14863 |
| 193 | Ga0075428_100009217 | 3300006844 | Bacteria | 10949 |
| 194 | Ga0075428_100052707 | 3300006844 | Unclassified | 4457 |
| 195 | Ga0075428_100160414 | 3300006844 | Bacteria | 2441 |
| 196 | Ga0075428_100481637 | 3300006844 | Bacteria | 1328 |
| 197 | Ga0075430_100118067 | 3300006846 | Bacteria | 2211 |
| 198 | Ga0075431_100005555 | 3300006847 | Bacteria | 12446 |
| 199 | Ga0075431_100040167 | 3300006847 | Bacteria | 4821 |
| 200 | Ga0075431_100059994 | 3300006847 | Unclassified | 3925 |
| 201 | Ga0075433_10098585 | 3300006852 | Bacteria | 2587 |
| 202 | Ga0075433_10136659 | 3300006852 | Unclassified | 2179 |
| 203 | Ga0075434_100002940 | 3300006871 | Bacteria | 15150 |
| 204 | Ga0075434_100085483 | 3300006871 | Bacteria | 3153 |
| 205 | Ga0075434_100252531 | 3300006871 | Bacteria | 1783 |
| 206 | Ga0075429_100000393 | 3300006880 | Bacteria | 32106 |
| 207 | Ga0068865_100026809 | 3300006881 | Bacteria | 3802 |
| 208 | Ga0068865_100062401 | 3300006881 | Bacteria | 2616 |
| 209 | Ga0075436_100177388 | 3300006914 | Bacteria | 1505 |
| 210 | Ga0097620_100002342 | 3300006931 | Bacteria | 19265 |
| 211 | Ga0097620_100090484 | 3300006931 | Unclassified | 3111 |
| 212 | Ga0097620_100177338 | 3300006931 | Bacteria | 2213 |
| 213 | Ga0075435_100045538 | 3300007076 | Bacteria | 3517 |
| 214 | Ga0075435_100065016 | 3300007076 | Bacteria | 2965 |
| 215 | Ga0075435_100125595 | 3300007076 | Bacteria | 2144 |
| 216 | Ga0075435_100139011 | 3300007076 | Bacteria | 2037 |
| 217 | Ga0075435_100140680 | 3300007076 | Bacteria | 2025 |
| 218 | Ga0105240_10031356 | 3300009093 | Bacteria | 6894 |
| 219 | Ga0105240_10046457 | 3300009093 | Bacteria | 5501 |
| 220 | Ga0105240_10080117 | 3300009093 | Bacteria | 4017 |
| 221 | Ga0105240_10256245 | 3300009093 | Unclassified | 2020 |
| 222 | Ga0111539_10052657 | 3300009094 | Bacteria | 4845 |
| 223 | Ga0111539_10109840 | 3300009094 | Bacteria | 3236 |
| 224 | Ga0111539_10122258 | 3300009094 | Bacteria | 3051 |
| 225 | Ga0111539_10136427 | 3300009094 | Bacteria | 2873 |
| 226 | Ga0111539_10798814 | 3300009094 | Bacteria | 1098 |
| 227 | Ga0105245_10002872 | 3300009098 | Bacteria | 15473 |
| 228 | Ga0105245_10003043 | 3300009098 | Bacteria | 15026 |
| 229 | Ga0105245_10008455 | 3300009098 | Bacteria | 8986 |
| 230 | Ga0105245_10035242 | 3300009098 | Bacteria | 4441 |
| 231 | Ga0105245_10297232 | 3300009098 | Bacteria | 1583 |
| 232 | Ga0105247_10001523 | 3300009101 | Bacteria | 16572 |
| 233 | Ga0105247_10034952 | 3300009101 | Bacteria | 3061 |
| 234 | Ga0114129_10015277 | 3300009147 | Bacteria | 10927 |
| 235 | Ga0114129_10066618 | 3300009147 | Bacteria | 5023 |
| 236 | Ga0114129_10126089 | 3300009147 | Bacteria | 3519 |
| 237 | Ga0114129_10128583 | 3300009147 | Bacteria | 3481 |
| 238 | Ga0114129_10389422 | 3300009147 | Bacteria | 1839 |
| 239 | Ga0105243_10790876 | 3300009148 | Bacteria | 934 |
| 240 | Ga0105241_10030797 | 3300009174 | Bacteria | 4013 |
| 241 | Ga0105241_10045108 | 3300009174 | Unclassified | 3343 |
| 242 | Ga0105241_10046298 | 3300009174 | Bacteria | 3303 |
| 243 | Ga0105241_10059559 | 3300009174 | Unclassified | 2936 |
| 244 | Ga0105241_10110904 | 3300009174 | Unclassified | 2195 |
| 245 | Ga0105241_10297342 | 3300009174 | Unclassified | 1384 |
| 246 | Ga0105242_10005778 | 3300009176 | Bacteria | 9530 |
| 247 | Ga0105242_10006636 | 3300009176 | Bacteria | 8925 |
| 248 | Ga0105242_10018454 | 3300009176 | Bacteria | 5454 |
| 249 | Ga0105242_10019208 | 3300009176 | Bacteria | 5354 |
| 250 | Ga0105242_10020961 | 3300009176 | Bacteria | 5126 |
| 251 | Ga0105242_10141645 | 3300009176 | Bacteria | 2087 |
| 252 | Ga0105242_10249044 | 3300009176 | Bacteria | 1600 |
| 253 | Ga0105242_10356783 | 3300009176 | Bacteria | 1352 |
| 254 | Ga0105248_10001154 | 3300009177 | Bacteria | 29468 |
| 255 | Ga0105248_10001212 | 3300009177 | Bacteria | 28824 |
| 256 | Ga0105248_10006132 | 3300009177 | Bacteria | 13188 |
| 257 | Ga0105248_10047986 | 3300009177 | Bacteria | 4789 |
| 258 | Ga0105248_10055587 | 3300009177 | Unclassified | 4440 |
| 259 | Ga0105248_10058639 | 3300009177 | Bacteria | 4323 |
| 260 | Ga0105248_10067736 | 3300009177 | Bacteria | 4008 |
| 261 | Ga0105248_10070741 | 3300009177 | Unclassified | 3918 |
| 262 | Ga0105248_10100459 | 3300009177 | Unclassified | 3260 |
| 263 | Ga0105248_10276537 | 3300009177 | Bacteria | 1890 |
| 264 | Ga0105248_10368399 | 3300009177 | Bacteria | 1617 |
| 265 | Ga0105248_10909401 | 3300009177 | Bacteria | 994 |
| 266 | Ga0105237_10188650 | 3300009545 | Unclassified | 2062 |
| 267 | Ga0105237_10770596 | 3300009545 | Bacteria | 969 |
| 268 | Ga0105238_10000995 | 3300009551 | Bacteria | 28960 |
| 269 | Ga0105238_10001793 | 3300009551 | Bacteria | 21494 |
| 270 | Ga0105238_10015296 | 3300009551 | Bacteria | 7771 |
| 271 | Ga0105238_10112711 | 3300009551 | Bacteria | 2699 |
| 272 | Ga0105238_10238741 | 3300009551 | Unclassified | 1795 |
| 273 | Ga0105249_10007702 | 3300009553 | Bacteria | 9382 |
| 274 | Ga0105249_10025151 | 3300009553 | Bacteria | 5358 |
| 275 | Ga0105249_10289738 | 3300009553 | Unclassified | 1638 |
| 276 | Ga0105239_10064693 | 3300010375 | Plasmid | 4015 |
| 277 | Ga0105239_10122848 | 3300010375 | Unclassified | 2885 |
| 278 | Ga0105239_10224732 | 3300010375 | Unclassified | 2106 |
| 279 | Ga0105239_10601548 | 3300010375 | Unclassified | 1254 |
| 280 | Ga0105239_10785223 | 3300010375 | Bacteria | 1091 |
| 281 | Ga0105246_10002105 | 3300011119 | Bacteria | 12003 |
| 282 | Ga0105246_10271763 | 3300011119 | Bacteria | 1355 |
| 283 | Ga0157373_10021327 | 3300013100 | Bacteria | 4705 |
| 284 | Ga0157373_10260975 | 3300013100 | Bacteria | 1226 |
| 285 | Ga0157370_10095674 | 3300013104 | Unclassified | 2786 |
| 286 | Ga0157370_10419983 | 3300013104 | Bacteria | 1230 |
| 287 | Ga0157369_10000314 | 3300013105 | Bacteria | 65179 |
| 288 | Ga0157369_10144005 | 3300013105 | Unclassified | 2520 |
| 289 | Ga0157374_10000570 | 3300013296 | Bacteria | 32716 |
| 290 | Ga0157374_10002417 | 3300013296 | Bacteria | 15756 |
| 291 | Ga0157374_10015171 | 3300013296 | Bacteria | 6757 |
| 292 | Ga0157374_10051549 | 3300013296 | Bacteria | 3830 |
| 293 | Ga0157374_10106569 | 3300013296 | Bacteria | 2693 |
| 294 | Ga0157378_10000107 | 3300013297 | Bacteria | 79357 |
| 295 | Ga0157378_10000525 | 3300013297 | Bacteria | 36446 |
| 296 | Ga0157378_10001631 | 3300013297 | Bacteria | 20278 |
| 297 | Ga0157378_10016091 | 3300013297 | Bacteria | 6550 |
| 298 | Ga0157378_10085317 | 3300013297 | Bacteria | 2860 |
| 299 | Ga0157378_10176963 | 3300013297 | Bacteria | 2004 |
| 300 | Ga0163162_10136119 | 3300013306 | Unclassified | 2567 |
| 301 | Ga0163162_10148597 | 3300013306 | Bacteria | 2460 |
| 302 | Ga0163162_10258286 | 3300013306 | Unclassified | 1874 |
| 303 | Ga0163162_10310766 | 3300013306 | Unclassified | 1708 |
| 304 | Ga0157372_10000688 | 3300013307 | Bacteria | 37068 |
| 305 | Ga0157372_10002333 | 3300013307 | Bacteria | 20558 |
| 306 | Ga0157372_10069166 | 3300013307 | Plasmid | 3971 |
| 307 | Ga0157372_10099516 | 3300013307 | Unclassified | 3317 |
| 308 | Ga0157372_10220128 | 3300013307 | Bacteria | 2200 |
| 309 | Ga0157372_10498528 | 3300013307 | Unclassified | 1420 |
| 310 | Ga0157375_10019854 | 3300013308 | Bacteria | 6125 |
| 311 | Ga0157375_10351149 | 3300013308 | Unclassified | 1640 |
| 312 | Ga0157375_10432656 | 3300013308 | Bacteria | 1482 |
| 313 | Ga0157375_10631381 | 3300013308 | Bacteria | 1228 |
| 314 | Ga0163163_10001364 | 3300014325 | Bacteria | 20601 |
| 315 | Ga0163163_10007649 | 3300014325 | Bacteria | 9546 |
| 316 | Ga0163163_10009863 | 3300014325 | Bacteria | 8558 |
| 317 | Ga0163163_10046497 | 3300014325 | Bacteria | 4263 |
| 318 | Ga0163163_10083638 | 3300014325 | Unclassified | 3197 |
| 319 | Ga0163163_10098545 | 3300014325 | Bacteria | 2944 |
| 320 | Ga0163163_10176919 | 3300014325 | Bacteria | 2180 |
| 321 | Ga0163163_10200789 | 3300014325 | Bacteria | 2042 |
| 322 | Ga0163163_10246879 | 3300014325 | Bacteria | 1835 |
| 323 | Ga0163163_10387393 | 3300014325 | Bacteria | 1455 |
| 324 | Ga0163163_10474368 | 3300014325 | Bacteria | 1312 |
| 325 | Ga0157380_10017936 | 3300014326 | Bacteria | 5248 |
| 326 | Ga0157380_10101361 | 3300014326 | Bacteria | 2399 |
| 327 | Ga0157377_10023846 | 3300014745 | Bacteria | 3247 |
| 328 | Ga0157379_10002834 | 3300014968 | Bacteria | 14617 |
| 329 | Ga0157379_10176290 | 3300014968 | Bacteria | 1930 |
| 330 | Ga0157379_10360626 | 3300014968 | Bacteria | 1332 |
| 331 | Ga0157376_10015632 | 3300014969 | Bacteria | 5740 |
| 332 | Ga0157376_10016931 | 3300014969 | Bacteria | 5548 |
| 333 | Ga0157376_10024010 | 3300014969 | Unclassified | 4781 |
| 334 | Ga0157376_10025966 | 3300014969 | Bacteria | 4622 |
| 335 | Ga0157376_10136144 | 3300014969 | Bacteria | 2198 |
| 336 | Ga0157376_10195606 | 3300014969 | Bacteria | 1857 |
| 337 | Ga0157376_10387578 | 3300014969 | Unclassified | 1348 |
| 338 | Ga0163161_10367264 | 3300017792 | Bacteria | 1147 |
| 339 | Ga0207697_10005064 | 3300025315 | Bacteria | 6172 |
| 340 | Ga0207710_10003580 | 3300025900 | Bacteria | 6897 |
| 341 | Ga0207710_10031811 | 3300025900 | Bacteria | 2310 |
| 342 | Ga0207688_10001012 | 3300025901 | Bacteria | 14333 |
| 343 | Ga0207680_10022704 | 3300025903 | Unclassified | 3417 |
| 344 | Ga0207699_10043788 | 3300025906 | Unclassified | 2602 |
| 345 | Ga0207699_10114237 | 3300025906 | Bacteria | 1736 |
| 346 | Ga0207699_10154498 | 3300025906 | Bacteria | 1522 |
| 347 | Ga0207699_10188073 | 3300025906 | Bacteria | 1392 |
| 348 | Ga0207645_10333328 | 3300025907 | Bacteria | 1014 |
| 349 | Ga0207643_10009866 | 3300025908 | Bacteria | 5131 |
| 350 | Ga0207654_10010170 | 3300025911 | Bacteria | 4787 |
| 351 | Ga0207654_10029892 | 3300025911 | Unclassified | 2987 |
| 352 | Ga0207654_10040123 | 3300025911 | Bacteria | 2636 |
| 353 | Ga0207707_10002001 | 3300025912 | Bacteria | 18506 |
| 354 | Ga0207707_10011920 | 3300025912 | Bacteria | 7564 |
| 355 | Ga0207707_10250462 | 3300025912 | Bacteria | 1539 |
| 356 | Ga0207707_10319995 | 3300025912 | Unclassified | 1340 |
| 357 | Ga0207695_10112696 | 3300025913 | Bacteria | 2697 |
| 358 | Ga0207695_10228573 | 3300025913 | Unclassified | 1766 |
| 359 | Ga0207671_10030506 | 3300025914 | Unclassified | 4021 |
| 360 | Ga0207671_10118445 | 3300025914 | Bacteria | 2022 |
| 361 | Ga0207671_10516569 | 3300025914 | Bacteria | 952 |
| 362 | Ga0207693_10000368 | 3300025915 | Bacteria | 41317 |
| 363 | Ga0207693_10003156 | 3300025915 | Bacteria | 14170 |
| 364 | Ga0207693_10088102 | 3300025915 | Bacteria | 2433 |
| 365 | Ga0207663_10004612 | 3300025916 | Bacteria | 6869 |
| 366 | Ga0207663_10379002 | 3300025916 | Bacteria | 1077 |
| 367 | Ga0207660_10153918 | 3300025917 | Unclassified | 1769 |
| 368 | Ga0207662_10015819 | 3300025918 | Bacteria | 4249 |
| 369 | Ga0207649_10039548 | 3300025920 | Unclassified | 2861 |
| 370 | Ga0207649_10099625 | 3300025920 | Bacteria | 1920 |
| 371 | Ga0207649_10161979 | 3300025920 | Bacteria | 1551 |
| 372 | Ga0207652_10383850 | 3300025921 | Bacteria | 1268 |
| 373 | Ga0207646_10015286 | 3300025922 | Bacteria | 7258 |
| 374 | Ga0207681_10003450 | 3300025923 | Bacteria | 9852 |
| 375 | Ga0207681_10068306 | 3300025923 | Bacteria | 2468 |
| 376 | Ga0207681_10224168 | 3300025923 | Bacteria | 1456 |
| 377 | Ga0207694_10002245 | 3300025924 | Bacteria | 15824 |
| 378 | Ga0207694_10014691 | 3300025924 | Bacteria | 5904 |
| 379 | Ga0207694_10022838 | 3300025924 | Unclassified | 4744 |
| 380 | Ga0207694_10194584 | 3300025924 | Bacteria | 1648 |
| 381 | Ga0207694_10339735 | 3300025924 | Unclassified | 1242 |
| 382 | Ga0207650_10012777 | 3300025925 | Bacteria | 5802 |
| 383 | Ga0207650_10039898 | 3300025925 | Bacteria | 3433 |
| 384 | Ga0207650_10127339 | 3300025925 | Bacteria | 1989 |
| 385 | Ga0207650_10130562 | 3300025925 | Bacteria | 1965 |
| 386 | Ga0207650_10285893 | 3300025925 | Bacteria | 1344 |
| 387 | Ga0207650_10511609 | 3300025925 | Bacteria | 1004 |
| 388 | Ga0207659_10000812 | 3300025926 | Bacteria | 18459 |
| 389 | Ga0207659_10006593 | 3300025926 | Bacteria | 7127 |
| 390 | Ga0207659_10183795 | 3300025926 | Bacteria | 1659 |
| 391 | Ga0207659_10406661 | 3300025926 | Bacteria | 1139 |
| 392 | Ga0207687_10003140 | 3300025927 | Bacteria | 11204 |
| 393 | Ga0207687_10004079 | 3300025927 | Bacteria | 9794 |
| 394 | Ga0207687_10010058 | 3300025927 | Bacteria | 6189 |
| 395 | Ga0207687_10111390 | 3300025927 | Bacteria | 2032 |
| 396 | Ga0207700_10058195 | 3300025928 | Unclassified | 2918 |
| 397 | Ga0207700_10061832 | 3300025928 | Bacteria | 2842 |
| 398 | Ga0207700_10070086 | 3300025928 | Unclassified | 2694 |
| 399 | Ga0207700_10073001 | 3300025928 | Bacteria | 2648 |
| 400 | Ga0207700_10322067 | 3300025928 | Unclassified | 1340 |
| 401 | Ga0207664_10118956 | 3300025929 | Unclassified | 2208 |
| 402 | Ga0207664_10526965 | 3300025929 | Unclassified | 1059 |
| 403 | Ga0207644_10046942 | 3300025931 | Bacteria | 3080 |
| 404 | Ga0207644_10258274 | 3300025931 | Unclassified | 1392 |
| 405 | Ga0207706_10059259 | 3300025933 | Unclassified | 3372 |
| 406 | Ga0207686_10007319 | 3300025934 | Bacteria | 5940 |
| 407 | Ga0207686_10016598 | 3300025934 | Unclassified | 4134 |
| 408 | Ga0207686_10047147 | 3300025934 | Unclassified | 2662 |
| 409 | Ga0207686_10047397 | 3300025934 | Bacteria | 2656 |
| 410 | Ga0207686_10084239 | 3300025934 | Bacteria | 2083 |
| 411 | Ga0207670_10004690 | 3300025936 | Bacteria | 7412 |
| 412 | Ga0207670_10123377 | 3300025936 | Bacteria | 1887 |
| 413 | Ga0207669_10079635 | 3300025937 | Bacteria | 2092 |
| 414 | Ga0207669_10090972 | 3300025937 | Bacteria | 1986 |
| 415 | Ga0207669_10414404 | 3300025937 | Bacteria | 1059 |
| 416 | Ga0207704_10009914 | 3300025938 | Bacteria | 4620 |
| 417 | Ga0207704_10057719 | 3300025938 | Unclassified | 2386 |
| 418 | Ga0207704_10064164 | 3300025938 | Bacteria | 2293 |
| 419 | Ga0207704_10490915 | 3300025938 | Unclassified | 988 |
| 420 | Ga0207665_10012222 | 3300025939 | Bacteria | 5639 |
| 421 | Ga0207691_10038862 | 3300025940 | Bacteria | 4403 |
| 422 | Ga0207691_10048087 | 3300025940 | Bacteria | 3912 |
| 423 | Ga0207691_10182915 | 3300025940 | Bacteria | 1831 |
| 424 | Ga0207691_10228343 | 3300025940 | Bacteria | 1612 |
| 425 | Ga0207711_10000655 | 3300025941 | Bacteria | 34545 |
| 426 | Ga0207711_10001410 | 3300025941 | Bacteria | 22505 |
| 427 | Ga0207711_10008169 | 3300025941 | Bacteria | 8761 |
| 428 | Ga0207711_10011460 | 3300025941 | Bacteria | 7371 |
| 429 | Ga0207711_10012057 | 3300025941 | Bacteria | 7184 |
| 430 | Ga0207711_10013548 | 3300025941 | Bacteria | 6771 |
| 431 | Ga0207711_10065149 | 3300025941 | Bacteria | 3149 |
| 432 | Ga0207711_10137584 | 3300025941 | Bacteria | 2195 |
| 433 | Ga0207711_10277161 | 3300025941 | Unclassified | 1544 |
| 434 | Ga0207711_10308419 | 3300025941 | Bacteria | 1461 |
| 435 | Ga0207711_10499205 | 3300025941 | Bacteria | 1134 |
| 436 | Ga0207689_10071711 | 3300025942 | Bacteria | 2845 |
| 437 | Ga0207689_10179489 | 3300025942 | Bacteria | 1746 |
| 438 | Ga0207689_10201472 | 3300025942 | Bacteria | 1643 |
| 439 | Ga0207661_10019184 | 3300025944 | Bacteria | 5094 |
| 440 | Ga0207661_10058271 | 3300025944 | Bacteria | 3108 |
| 441 | Ga0207661_10063039 | 3300025944 | Bacteria | 3001 |
| 442 | Ga0207679_10018466 | 3300025945 | Bacteria | 4673 |
| 443 | Ga0207679_10033562 | 3300025945 | Bacteria | 3613 |
| 444 | Ga0207679_10075442 | 3300025945 | Bacteria | 2559 |
| 445 | Ga0207679_10123448 | 3300025945 | Bacteria | 2065 |
| 446 | Ga0207679_10171931 | 3300025945 | Unclassified | 1785 |
| 447 | Ga0207679_10451486 | 3300025945 | Unclassified | 1140 |
| 448 | Ga0207667_10008625 | 3300025949 | Bacteria | 12092 |
| 449 | Ga0207667_10012940 | 3300025949 | Bacteria | 9582 |
| 450 | Ga0207667_10147763 | 3300025949 | Bacteria | 2419 |
| 451 | Ga0207651_10030205 | 3300025960 | Bacteria | 3446 |
| 452 | Ga0207651_10098614 | 3300025960 | Bacteria | 2161 |
| 453 | Ga0207651_10333272 | 3300025960 | Bacteria | 1272 |
| 454 | Ga0207712_10003440 | 3300025961 | Bacteria | 9999 |
| 455 | Ga0207712_10005352 | 3300025961 | Bacteria | 8105 |
| 456 | Ga0207712_10119915 | 3300025961 | Bacteria | 1988 |
| 457 | Ga0207712_10212887 | 3300025961 | Unclassified | 1540 |
| 458 | Ga0207658_10045670 | 3300025986 | Unclassified | 3194 |
| 459 | Ga0207677_10033128 | 3300026023 | Unclassified | 3329 |
| 460 | Ga0207677_10035930 | 3300026023 | Bacteria | 3223 |
| 461 | Ga0207677_10055628 | 3300026023 | Unclassified | 2707 |
| 462 | Ga0207677_10086760 | 3300026023 | Unclassified | 2263 |
| 463 | Ga0207677_10155166 | 3300026023 | Bacteria | 1772 |
| 464 | Ga0207703_10007946 | 3300026035 | Bacteria | 8383 |
| 465 | Ga0207703_10010148 | 3300026035 | Bacteria | 7383 |
| 466 | Ga0207703_10010815 | 3300026035 | Bacteria | 7117 |
| 467 | Ga0207703_10014433 | 3300026035 | Bacteria | 6160 |
| 468 | Ga0207703_10048441 | 3300026035 | Bacteria | 3431 |
| 469 | Ga0207703_10054674 | 3300026035 | Unclassified | 3248 |
| 470 | Ga0207639_10091264 | 3300026041 | Unclassified | 2438 |
| 471 | Ga0207708_10064071 | 3300026075 | Bacteria | 2808 |
| 472 | Ga0207708_10130545 | 3300026075 | Unclassified | 1964 |
| 473 | Ga0207702_10001290 | 3300026078 | Bacteria | 25078 |
| 474 | Ga0207702_10006085 | 3300026078 | Bacteria | 10462 |
| 475 | Ga0207641_10039067 | 3300026088 | Unclassified | 3969 |
| 476 | Ga0207641_10060910 | 3300026088 | Bacteria | 3218 |
| 477 | Ga0207641_10224865 | 3300026088 | Unclassified | 1742 |
| 478 | Ga0207641_10266977 | 3300026088 | Unclassified | 1604 |
| 479 | Ga0207648_10001037 | 3300026089 | Bacteria | 31185 |
| 480 | Ga0207648_10063216 | 3300026089 | Bacteria | 3227 |
| 481 | Ga0207648_10108896 | 3300026089 | Unclassified | 2432 |
| 482 | Ga0207648_10134216 | 3300026089 | Unclassified | 2179 |
| 483 | Ga0207648_10554844 | 3300026089 | Bacteria | 1056 |
| 484 | Ga0207676_10003187 | 3300026095 | Bacteria | 11685 |
| 485 | Ga0207676_10004912 | 3300026095 | Bacteria | 9481 |
| 486 | Ga0207676_10032056 | 3300026095 | Bacteria | 3957 |
| 487 | Ga0207676_10050812 | 3300026095 | Bacteria | 3234 |
| 488 | Ga0207674_10000126 | 3300026116 | Bacteria | 88965 |
| 489 | Ga0207674_10002270 | 3300026116 | Bacteria | 24365 |
| 490 | Ga0207674_10017642 | 3300026116 | Bacteria | 7784 |
| 491 | Ga0207674_10032195 | 3300026116 | Bacteria | 5501 |
| 492 | Ga0207675_100000826 | 3300026118 | Bacteria | 30859 |
| 493 | Ga0207675_100308738 | 3300026118 | Bacteria | 1542 |
| 494 | Ga0207675_100700389 | 3300026118 | Bacteria | 1022 |
| 495 | Ga0207683_10132683 | 3300026121 | Bacteria | 2240 |
| 496 | Ga0207683_10209018 | 3300026121 | Bacteria | 1776 |
| 497 | Ga0207698_10461148 | 3300026142 | Bacteria | 1229 |
| 498 | Ga0207428_10005716 | 3300027907 | Bacteria | 11560 |
| 499 | Ga0207428_10369536 | 3300027907 | Bacteria | 1053 |
| 500 | Ga0268266_10148295 | 3300028379 | Bacteria | 2112 |
| 501 | Ga0268265_10002008 | 3300028380 | Bacteria | 16025 |
| 502 | Ga0268264_10085467 | 3300028381 | Bacteria | 2708 |
| 503 | Ga0268264_10094602 | 3300028381 | Unclassified | 2583 |
| 504 | Ga0268264_10242661 | 3300028381 | Unclassified | 1669 |
| 505 | Ga0268264_10248450 | 3300028381 | Bacteria | 1651 |
| 506 | Ga0268264_10606999 | 3300028381 | Unclassified | 1079 |
| 507 | Ga0307408_100089538 | 3300031548 | Bacteria | 2320 |
| 508 | Ga0316575_10025187 | 3300031665 | Bacteria | 2306 |
| 509 | Ga0307416_100125442 | 3300032002 | Bacteria | 2299 |
| 510 | Ga0373926_0007781 | 3300035083 | Bacteria | 3568 |
| 511 | Ga0373926_0126747 | 3300035083 | Unclassified | 965 |
| 512 | Ga0373949_0022536 | 3300035090 | Bacteria | 1453 |
| 513 | Ga0373923_0020878 | 3300035111 | Bacteria | 2551 |
| 514 | Ga0373943_0002721 | 3300035170 | Bacteria | 8036 |
| 515 | Ga0373955_0008502 | 3300035172 | Bacteria | 4770 |
| 516 | Ga0373942_0091311 | 3300035207 | Unclassified | 918 |
| 517 | Ga0373924_0001418 | 3300035410 | Bacteria | 7770 |
| 518 | Ga0373931_0150297 | 3300035691 | Unclassified | 1357 |
| 519 | Ga0373931_0192393 | 3300035691 | Bacteria | 1214 |
| 520 | Ga0373935_0028231 | 3300035692 | Bacteria | 3468 |
| 521 | Ga0373935_0246557 | 3300035692 | Unclassified | 1249 |
| 522 | Ga0373933_0124312 | 3300035724 | Bacteria | 1618 |
| 523 | Ga0373947_0004237 | 3300035725 | Bacteria | 8412 |
| 524 | Ga0373947_0263592 | 3300035725 | Unclassified | 1142 |
| 525 | Ga0373937_0022464 | 3300036401 | Bacteria | 5673 |
| 526 | Ga0373937_0113555 | 3300036401 | Unclassified | 2520 |
| 527 | Ga0373937_0222756 | 3300036401 | Unclassified | 1776 |
| 528 | Ga0373937_0886291 | 3300036401 | Bacteria | 841 |
| 529 | Ga0373925_0017642 | 3300037068 | Bacteria | 5179 |
| 530 | Ga0373925_0351472 | 3300037068 | Bacteria | 1197 |
| 531 | Ga0439450_026741 | 3300042008 | Bacteria | 1274 |
| 532 | Ga0451577_0097615 | 3300042876 | Bacteria | 2624 |
| 533 | Ga0451577_0364541 | 3300042876 | Bacteria | 1311 |
| 534 | Ga0453683_0000129 | 3300044673 | Bacteria | 110609 |
| 535 | Ga0451576_0029314 | 3300045051 | Bacteria | 5889 |
| 536 | Ga0451576_0054888 | 3300045051 | Bacteria | 4170 |
| 537 | Ga0451576_0094389 | 3300045051 | Bacteria | 3111 |
| 538 | Ga0451576_0338163 | 3300045051 | Bacteria | 1576 |
| 539 | Ga0495592_0069690 | 3300046454 | Bacteria | 2564 |
| 540 | Ga0495592_0084663 | 3300046454 | Unclassified | 2287 |
| 541 | Ga0495603_0010363 | 3300046455 | Bacteria | 5642 |
| 542 | Ga0495629_0009461 | 3300046459 | Bacteria | 7128 |
| 543 | Ga0495629_0199415 | 3300046459 | Bacteria | 1384 |
| 544 | Ga0495629_0287754 | 3300046459 | Bacteria | 1127 |
| 545 | Ga0495629_0351104 | 3300046459 | Bacteria | 1006 |
| 546 | Ga0495651_0004725 | 3300046462 | Bacteria | 10424 |
| 547 | Ga0495651_0017568 | 3300046462 | Bacteria | 5538 |
| 548 | Ga0495580_0027251 | 3300046472 | Bacteria | 4158 |
| 549 | Ga0495580_0057118 | 3300046472 | Bacteria | 2747 |
| 550 | Ga0495580_0057853 | 3300046472 | Unclassified | 2728 |
| 551 | Ga0495580_0151533 | 3300046472 | Unclassified | 1606 |
| 552 | Ga0495580_0152413 | 3300046472 | Unclassified | 1601 |
| 553 | Ga0495580_0243003 | 3300046472 | Bacteria | 1234 |
| 554 | Ga0495582_0003346 | 3300046473 | Bacteria | 9015 |
| 555 | Ga0495582_0171635 | 3300046473 | Bacteria | 1235 |
| 556 | Ga0495605_0177326 | 3300046474 | Unclassified | 939 |
| 557 | Ga0495639_0030687 | 3300046475 | Bacteria | 2390 |
| 558 | Ga0495664_0013877 | 3300046477 | Bacteria | 4568 |
| 559 | Ga0495664_0132925 | 3300046477 | Unclassified | 1507 |
| 560 | Ga0495664_0327438 | 3300046477 | Bacteria | 924 |
| 561 | Ga0495584_0057945 | 3300046491 | Bacteria | 1949 |
| 562 | Ga0495594_0008898 | 3300046499 | Bacteria | 5177 |
| 563 | Ga0495594_0032662 | 3300046499 | Bacteria | 2826 |
| 564 | Ga0495594_0049475 | 3300046499 | Bacteria | 2310 |
| 565 | Ga0495594_0053419 | 3300046499 | Bacteria | 2225 |
| 566 | Ga0495594_0179236 | 3300046499 | Bacteria | 1206 |
| 567 | Ga0495608_0061676 | 3300046511 | Unclassified | 2465 |
| 568 | Ga0495618_0100225 | 3300046514 | Bacteria | 1854 |
| 569 | Ga0495618_0270603 | 3300046514 | Unclassified | 1062 |
| 570 | Ga0495628_0011166 | 3300046516 | Bacteria | 7601 |
| 571 | Ga0495628_0200740 | 3300046516 | Unclassified | 1503 |
| 572 | Ga0495628_0276425 | 3300046516 | Unclassified | 1248 |
| 573 | Ga0495628_0346062 | 3300046516 | Bacteria | 1094 |
| 574 | Ga0495630_0000561 | 3300046517 | Bacteria | 27052 |
| 575 | Ga0495630_0054528 | 3300046517 | Unclassified | 2995 |
| 576 | Ga0495666_0013871 | 3300046526 | Bacteria | 4018 |
| 577 | Ga0495642_0012940 | 3300046528 | Bacteria | 3222 |
| 578 | Ga0495652_0038444 | 3300046529 | Unclassified | 4146 |
| 579 | Ga0495652_0125338 | 3300046529 | Bacteria | 2041 |
| 580 | Ga0495665_0037610 | 3300046531 | Bacteria | 2583 |
| 581 | Ga0495665_0057111 | 3300046531 | Bacteria | 2060 |
| 582 | Ga0495665_0063351 | 3300046531 | Unclassified | 1952 |
| 583 | Ga0495640_0038428 | 3300046533 | Bacteria | 3366 |
| 584 | Ga0495640_0180108 | 3300046533 | Bacteria | 1347 |
| 585 | Ga0495587_0002935 | 3300046536 | Bacteria | 11406 |
| 586 | Ga0495587_0117569 | 3300046536 | Unclassified | 1524 |
| 587 | Ga0495621_0009972 | 3300046539 | Unclassified | 2899 |
| 588 | Ga0495645_0006375 | 3300046543 | Bacteria | 8187 |
| 589 | Ga0495645_0031575 | 3300046543 | Unclassified | 3860 |
| 590 | Ga0495645_0092771 | 3300046543 | Unclassified | 2156 |
| 591 | Ga0495645_0169013 | 3300046543 | Bacteria | 1506 |
| 592 | Ga0495667_0003475 | 3300046559 | Bacteria | 10556 |
| 593 | Ga0495667_0015202 | 3300046559 | Bacteria | 5196 |
| 594 | Ga0495667_0015277 | 3300046559 | Bacteria | 5185 |
| 595 | Ga0495635_0352631 | 3300046663 | Bacteria | 981 |
| 596 | Ga0495659_0001546 | 3300046664 | Bacteria | 7757 |
| 597 | Ga0495659_0006568 | 3300046664 | Bacteria | 3673 |
| 598 | Ga0495659_0008086 | 3300046664 | Unclassified | 3342 |
| 599 | Ga0495659_0093697 | 3300046664 | Unclassified | 1156 |
| 600 | Ga0495588_0036301 | 3300046674 | Bacteria | 2500 |
| 601 | Ga0495657_0020827 | 3300046675 | Unclassified | 4713 |
| 602 | Ga0495599_0016981 | 3300046678 | Unclassified | 4523 |
| 603 | Ga0495623_0031200 | 3300046679 | Bacteria | 3427 |
| 604 | Ga0495646_0047500 | 3300046680 | Bacteria | 2613 |
| 605 | Ga0495647_0047882 | 3300046681 | Bacteria | 1651 |
| 606 | Ga0495658_0000515 | 3300046683 | Bacteria | 21193 |
| 607 | Ga0495613_0047024 | 3300046689 | Bacteria | 3188 |
| 608 | Ga0495613_0098557 | 3300046689 | Unclassified | 2112 |
| 609 | Ga0495613_0211215 | 3300046689 | Bacteria | 1365 |
| 610 | Ga0495613_0213063 | 3300046689 | Bacteria | 1358 |
| 611 | Ga0495613_0309903 | 3300046689 | Bacteria | 1091 |
| 612 | Ga0495670_0268014 | 3300046691 | Unclassified | 912 |
| 613 | Ga0495600_0018764 | 3300046809 | Bacteria | 4412 |
| 614 | Ga0495600_0021402 | 3300046809 | Unclassified | 4141 |
| 615 | Ga0495581_0128092 | 3300047315 | Bacteria | 1479 |
| 616 | Ga0495604_0014121 | 3300047317 | Bacteria | 6369 |
| 617 | Ga0495604_0033082 | 3300047317 | Unclassified | 4095 |
| 618 | Ga0495604_0131872 | 3300047317 | Unclassified | 1795 |
| 619 | Ga0495604_0171550 | 3300047317 | Bacteria | 1525 |
| 620 | Ga0495604_0204227 | 3300047317 | Unclassified | 1369 |
| 621 | Ga0495636_0007491 | 3300047318 | Bacteria | 4297 |
| 622 | Ga0495636_0014645 | 3300047318 | Bacteria | 3120 |
| 623 | Ga0495674_0001437 | 3300047319 | Bacteria | 23339 |
| 624 | Ga0495674_0008689 | 3300047319 | Bacteria | 9660 |
| 625 | Ga0495674_0010648 | 3300047319 | Bacteria | 8701 |
| 626 | Ga0495674_0082105 | 3300047319 | Bacteria | 2764 |
| 627 | Ga0495674_0144135 | 3300047319 | Unclassified | 2000 |
| 628 | Ga0495676_0016362 | 3300047321 | Bacteria | 6587 |
| 629 | Ga0495680_0011065 | 3300047322 | Bacteria | 8010 |
| 630 | Ga0495680_0063199 | 3300047322 | Unclassified | 2843 |
| 631 | Ga0495680_0094857 | 3300047322 | Bacteria | 2232 |
| 632 | Ga0495680_0210875 | 3300047322 | Bacteria | 1391 |
| 633 | Ga0495675_0002040 | 3300047444 | Bacteria | 12084 |
| 634 | Ga0495675_0002416 | 3300047444 | Bacteria | 11160 |
| 635 | Ga0495675_0004269 | 3300047444 | Bacteria | 8645 |
| 636 | Ga0495675_0119653 | 3300047444 | Bacteria | 1640 |
| 637 | Ga0495684_0007057 | 3300047471 | Bacteria | 8721 |
| 638 | Ga0495684_0141279 | 3300047471 | Archaea | 1805 |
| 639 | Ga0495602_0062844 | 3300048088 | Unclassified | 3220 |
| 640 | Ga0496100_0180983 | 3300048903 | Unclassified | 1524 |
| 641 | Ga0496102_0015730 | 3300048905 | Bacteria | 6591 |
| 642 | Ga0496103_0007619 | 3300048906 | Bacteria | 6441 |
| 643 | Ga0496104_0014322 | 3300048907 | Bacteria | 7161 |
| 644 | Ga0496104_0173036 | 3300048907 | Unclassified | 2070 |
| 645 | Ga0496104_0197423 | 3300048907 | Bacteria | 1924 |
| 646 | Ga0496104_0200871 | 3300048907 | Unclassified | 1906 |
| 647 | Ga0496104_0539801 | 3300048907 | Unclassified | 1077 |
| 648 | Ga0496105_0121263 | 3300048908 | Bacteria | 2156 |
| 649 | Ga0496105_0144854 | 3300048908 | Unclassified | 1954 |
| 650 | Ga0496106_0099403 | 3300048909 | Unclassified | 2255 |
| 651 | Ga0496107_0188966 | 3300048910 | Bacteria | 1530 |
| 652 | Ga0496108_0006690 | 3300048911 | Bacteria | 9334 |
| 653 | Ga0496109_0390601 | 3300048912 | Unclassified | 1315 |
| 654 | Ga0496109_0434898 | 3300048912 | Unclassified | 1239 |
| 655 | Ga0496110_0047175 | 3300048913 | Bacteria | 3771 |
| 656 | Ga0496111_0207152 | 3300048914 | Unclassified | 1457 |
| 657 | Ga0496112_0013767 | 3300048915 | Bacteria | 7480 |
| 658 | Ga0496112_0058797 | 3300048915 | Bacteria | 3787 |
| 659 | Ga0496112_0073659 | 3300048915 | Bacteria | 3376 |
| 660 | Ga0496112_0181814 | 3300048915 | Bacteria | 2066 |
| 661 | Ga0496113_0067336 | 3300048916 | Bacteria | 2715 |
| 662 | Ga0496115_0039424 | 3300048918 | Bacteria | 3751 |
| 663 | Ga0496115_0130190 | 3300048918 | Unclassified | 2074 |
| 664 | Ga0501031_0347844 | 3300049568 | Unclassified | 960 |
| 665 | Ga0501036_0142110 | 3300049572 | Unclassified | 2025 |
| 666 | Ga0501048_0392893 | 3300049582 | Unclassified | 991 |
| 667 | Ga0501067_0035915 | 3300049583 | Unclassified | 2752 |
| 668 | Ga0501075_0013484 | 3300049591 | Bacteria | 5834 |
| 669 | Ga0501075_0077997 | 3300049591 | Bacteria | 2507 |
| 670 | Ga0501076_0152047 | 3300049592 | Unclassified | 1883 |
| 671 | Ga0501076_0324938 | 3300049592 | Unclassified | 1262 |
| 672 | nmdc:mga0k408_10935_c1 | 3300050493 | Bacteria | 4924 |
| 673 | nmdc:mga07m45_135595_c1 | 3300050496 | Bacteria | 1425 |
| 674 | nmdc:mga05p37_211064_c1 | 3300050507 | Bacteria | 2347 |
| 675 | nmdc:mga05p37_2311_c1 | 3300050507 | Bacteria | 12378 |
| 676 | nmdc:mga05p37_427856_c1 | 3300050507 | Bacteria | 1539 |
| 677 | nmdc:mga05p37_525581_c1 | 3300050507 | Bacteria | 1352 |
| 678 | nmdc:mga05p37_548205_c1 | 3300050507 | Unclassified | 1317 |
| 679 | nmdc:mga05p37_6458_c1 | 3300050507 | Bacteria | 12095 |
| 680 | nmdc:mga05p37_83728_c1 | 3300050507 | Bacteria | 3929 |
| 681 | nmdc:mga09592_45560_c1 | 3300050508 | Bacteria | 3695 |
| 682 | nmdc:mga09592_752672_c1 | 3300050508 | Unclassified | 827 |
| 683 | nmdc:mga0qj67_113832_c1 | 3300050509 | Bacteria | 2185 |
| 684 | nmdc:mga0qj67_15413_c1 | 3300050509 | Bacteria | 5788 |
| 685 | nmdc:mga06r32_120118_c1 | 3300050510 | Bacteria | 2592 |
| 686 | nmdc:mga06r32_140369_c1 | 3300050510 | Bacteria | 2392 |
| 687 | nmdc:mga06r32_18430_c1 | 3300050510 | Bacteria | 6391 |
| 688 | nmdc:mga08y16_117323_c1 | 3300050511 | Bacteria | 2771 |
| 689 | nmdc:mga08y16_183117_c1 | 3300050511 | Bacteria | 2174 |
| 690 | nmdc:mga08y16_237943_c1 | 3300050511 | Unclassified | 1882 |
| 691 | nmdc:mga0n895_102631_c1 | 3300050512 | Bacteria | 2871 |
| 692 | nmdc:mga0n895_111999_c1 | 3300050512 | Bacteria | 2746 |
| 693 | nmdc:mga0n895_46703_c1 | 3300050512 | Unclassified | 4231 |
| 694 | nmdc:mga0rr50_210018_c1 | 3300050513 | Bacteria | 1603 |
| 695 | nmdc:mga08x19_89984_c1 | 3300050514 | Bacteria | 2025 |
| 696 | nmdc:mga0a205_54676_c2 | 3300050515 | Bacteria | 2589 |
| 697 | nmdc:mga0a205_598483_c1 | 3300050515 | Bacteria | 956 |
| 698 | nmdc:mga0a205_62708_c1 | 3300050515 | Bacteria | 3591 |
| 699 | Ga0495595_0040528 | 3300053084 | Bacteria | 2129 |
| 700 | Ga0495619_0174595 | 3300053085 | Bacteria | 1486 |
| 701 | Ga0501084_0555007 | 3300054114 | Bacteria | 971 |
| 702 | Ga0070709_10008870 | |||
| 703 | Ga0065712_10007200 | |||
| 704 | Ga0065712_10084010 | |||
| 705 | Ga0065715_10157136 | |||
| 706 | Ga0065707_10008911 | |||
| 707 | Ga0065707_10011530 | |||
| 708 | Ga0070676_10020595 | |||
| 709 | Ga0070676_10226580 | |||
| 710 | Ga0070676_10292487 | |||
| 711 | Ga0070683_100043393 | |||
| 712 | Ga0070683_100060680 | |||
| 713 | Ga0070683_100137178 | |||
| 714 | Ga0070690_100125576 | |||
| 715 | Ga0070690_100145888 | |||
| 716 | Ga0070670_100000980 | |||
| 717 | Ga0070670_100023524 | |||
| 718 | Ga0070670_100038827 | |||
| 719 | Ga0070670_100054934 | |||
| 720 | Ga0070670_100080664 | |||
| 721 | Ga0070670_100257881 | |||
| 722 | Ga0068869_100120331 | |||
| 723 | Ga0070666_10009508 | |||
| 724 | Ga0070680_100513362 | |||
| 725 | Ga0068868_100047963 | |||
| 726 | Ga0068868_100111457 | |||
| 727 | Ga0068868_100148196 | |||
| 728 | Ga0068868_100161651 | |||
| 729 | Ga0068868_100438489 | |||
| 730 | Ga0070660_100076509 | |||
| 731 | Ga0070689_100010826 | |||
| 732 | Ga0070689_100031094 | |||
| 733 | Ga0070687_100021411 | |||
| 734 | Ga0070661_100084721 | |||
| 735 | Ga0070661_100115426 | |||
| 736 | Ga0070661_100199012 | |||
| 737 | Ga0070669_100001432 | |||
| 738 | Ga0070675_100004642 | |||
| 739 | Ga0070675_100006220 | |||
| 740 | Ga0070675_100132931 | |||
| 741 | Ga0070675_100221027 | |||
| 742 | Ga0070671_100247207 | |||
| 743 | Ga0070671_100517010 | |||
| 744 | Ga0070674_100011803 | |||
| 745 | Ga0070674_100090522 | |||
| 746 | Ga0070673_100025882 | |||
| 747 | Ga0070673_100099469 | |||
| 748 | Ga0070688_100086600 | |||
| 749 | Ga0070688_100153545 | |||
| 750 | Ga0070659_100035103 | |||
| 751 | Ga0070667_100057092 | |||
| 752 | Ga0070667_100352934 | |||
| 753 | Ga0070709_10190611 | |||
| 754 | Ga0070714_100086561 | |||
| 755 | Ga0070714_100526011 | |||
| 756 | Ga0070713_100002726 | |||
| 757 | Ga0070713_100008525 | |||
| 758 | Ga0070713_100012642 | |||
| 759 | Ga0070713_100018872 | |||
| 760 | Ga0070713_100032939 | |||
| 761 | Ga0070713_100198421 | |||
| 762 | Ga0070713_100283256 | |||
| 763 | Ga0070713_100301916 | |||
| 764 | Ga0070710_10305782 | |||
| 765 | Ga0070711_100000111 | |||
| 766 | Ga0070711_100002761 | |||
| 767 | Ga0070711_100440460 | |||
| 768 | Ga0070700_100008707 | |||
| 769 | Ga0070700_100087448 | |||
| 770 | Ga0070694_100123407 | |||
| 771 | Ga0070708_100098056 | |||
| 772 | Ga0070708_100262845 | |||
| 773 | Ga0070678_100009655 | |||
| 774 | Ga0070678_100135065 | |||
| 775 | Ga0070662_100057393 | |||
| 776 | Ga0070681_10010740 | |||
| 777 | Ga0070681_10315316 | |||
| 778 | Ga0070681_10404745 | |||
| 779 | Ga0068867_100020517 | |||
| 780 | Ga0068867_100061938 | |||
| 781 | Ga0068867_100135965 | |||
| 782 | Ga0068867_100541235 | |||
| 783 | Ga0068867_100632796 | |||
| 784 | Ga0070706_100100417 | |||
| 785 | Ga0070707_100014693 | |||
| 786 | Ga0070698_100340228 | |||
| 787 | Ga0070679_100013137 | |||
| 788 | Ga0070684_100050616 | |||
| 789 | Ga0070684_100078744 | |||
| 790 | Ga0070684_100090100 | |||
| 791 | Ga0070697_100014531 | |||
| 792 | Ga0070697_100162137 | |||
| 793 | Ga0068853_100048180 | |||
| 794 | Ga0070672_100025343 | |||
| 795 | Ga0070672_100045157 | |||
| 796 | Ga0070672_100388069 | |||
| 797 | Ga0070686_100083552 | |||
| 798 | Ga0070695_100307352 | |||
| 799 | Ga0070693_100028535 | |||
| 800 | Ga0070693_100081838 | |||
| 801 | Ga0070693_100163548 | |||
| 802 | Ga0070665_100044381 | |||
| 803 | Ga0070704_100002288 | |||
| 804 | Ga0070704_100595128 | |||
| 805 | Ga0068855_100001075 | |||
| 806 | Ga0068855_100015384 | |||
| 807 | Ga0068855_100082070 | |||
| 808 | Ga0068855_100175308 | |||
| 809 | Ga0068855_100274114 | |||
| 810 | Ga0070664_100008078 | |||
| 811 | Ga0070664_100011113 | |||
| 812 | Ga0070664_100021979 | |||
| 813 | Ga0070664_100034700 | |||
| 814 | Ga0070664_100064966 | |||
| 815 | Ga0070664_100089372 | |||
| 816 | Ga0070664_100135597 | |||
| 817 | Ga0070664_100226926 | |||
| 818 | Ga0070664_100324107 | |||
| 819 | Ga0070664_100734204 | |||
| 820 | Ga0068857_100000091 | |||
| 821 | Ga0068857_100005889 | |||
| 822 | Ga0068857_100029279 | |||
| 823 | Ga0068856_100002148 | |||
| 824 | Ga0068856_100010450 | |||
| 825 | Ga0068856_100118719 | |||
| 826 | Ga0068856_100291031 | |||
| 827 | Ga0070702_100165270 | |||
| 828 | Ga0068852_100575169 | |||
| 829 | Ga0068859_100002342 | |||
| 830 | Ga0068859_100090476 | |||
| 831 | Ga0068859_100177335 | |||
| 832 | Ga0068864_100005198 | |||
| 833 | Ga0068864_100012162 | |||
| 834 | Ga0068864_100024210 | |||
| 835 | Ga0068864_100024710 | |||
| 836 | Ga0068864_100056404 | |||
| 837 | Ga0068864_100240256 | |||
| 838 | Ga0068864_100372455 | |||
| 839 | Ga0068861_100006026 | |||
| 840 | Ga0068861_100280749 | |||
| 841 | Ga0068851_10199770 | |||
| 842 | Ga0068870_10119874 | |||
| 843 | Ga0068863_100005319 | |||
| 844 | Ga0068863_100048620 | |||
| 845 | Ga0068863_100060102 | |||
| 846 | Ga0068863_100071617 | |||
| 847 | Ga0068863_100134763 | |||
| 848 | Ga0068863_100290145 | |||
| 849 | Ga0068863_100470540 | |||
| 850 | Ga0068858_100004558 | |||
| 851 | Ga0068858_100005359 | |||
| 852 | Ga0068858_100010258 | |||
| 853 | Ga0068858_100066344 | |||
| 854 | Ga0068858_100103580 | |||
| 855 | Ga0068858_100438591 | |||
| 856 | Ga0068858_100532302 | |||
| 857 | Ga0068860_100004722 | |||
| 858 | Ga0068860_100021862 | |||
| 859 | Ga0068860_100619510 | |||
| 860 | Ga0068862_100001212 | |||
| 861 | Ga0081455_10143357 | |||
| 862 | Ga0081455_10158519 | |||
| 863 | Ga0070717_10007582 | |||
| 864 | Ga0070717_10271266 | |||
| 865 | Ga0075368_10045231 | |||
| 866 | Ga0070716_100082022 | |||
| 867 | Ga0070712_100007166 | |||
| 868 | Ga0070712_100010213 | |||
| 869 | Ga0070712_100114352 | |||
| 870 | Ga0075366_10080090 | |||
| 871 | Ga0097621_100000413 | |||
| 872 | Ga0097621_100000452 | |||
| 873 | Ga0097621_100006552 | |||
| 874 | Ga0097621_100007741 | |||
| 875 | Ga0097621_100010149 | |||
| 876 | Ga0097621_100014081 | |||
| 877 | Ga0097621_100067234 | |||
| 878 | Ga0097621_100085917 | |||
| 879 | Ga0097621_100087326 | |||
| 880 | Ga0097621_100116300 | |||
| 881 | Ga0097621_100551808 | |||
| 882 | Ga0075370_10201654 | |||
| 883 | Ga0068871_100000150 | |||
| 884 | Ga0068871_100001131 | |||
| 885 | Ga0068871_100011632 | |||
| 886 | Ga0068871_100030891 | |||
| 887 | Ga0068871_100054996 | |||
| 888 | Ga0068871_100133172 | |||
| 889 | Ga0068871_100146593 | |||
| 890 | Ga0068871_100197421 | |||
| 891 | Ga0068871_100363188 | |||
| 892 | Ga0075428_100001755 | |||
| 893 | Ga0075428_100004899 | |||
| 894 | Ga0075428_100009217 | |||
| 895 | Ga0075428_100052707 | |||
| 896 | Ga0075428_100160414 | |||
| 897 | Ga0075428_100481637 | |||
| 898 | Ga0075430_100118067 | |||
| 899 | Ga0075431_100005555 | |||
| 900 | Ga0075431_100040167 | |||
| 901 | Ga0075431_100059994 | |||
| 902 | Ga0075433_10098585 | |||
| 903 | Ga0075433_10136659 | |||
| 904 | Ga0075434_100002940 | |||
| 905 | Ga0075434_100085483 | |||
| 906 | Ga0075434_100252531 | |||
| 907 | Ga0075429_100000393 | |||
| 908 | Ga0068865_100026809 | |||
| 909 | Ga0068865_100062401 | |||
| 910 | Ga0075436_100177388 | |||
| 911 | Ga0097620_100002342 | |||
| 912 | Ga0097620_100090484 | |||
| 913 | Ga0097620_100177338 | |||
| 914 | Ga0075435_100045538 | |||
| 915 | Ga0075435_100065016 | |||
| 916 | Ga0075435_100125595 | |||
| 917 | Ga0075435_100139011 | |||
| 918 | Ga0075435_100140680 | |||
| 919 | Ga0105240_10031356 | |||
| 920 | Ga0105240_10046457 | |||
| 921 | Ga0105240_10080117 | |||
| 922 | Ga0105240_10256245 | |||
| 923 | Ga0111539_10052657 | |||
| 924 | Ga0111539_10109840 | |||
| 925 | Ga0111539_10122258 | |||
| 926 | Ga0111539_10136427 | |||
| 927 | Ga0111539_10798814 | |||
| 928 | Ga0105245_10002872 | |||
| 929 | Ga0105245_10003043 | |||
| 930 | Ga0105245_10008455 | |||
| 931 | Ga0105245_10035242 | |||
| 932 | Ga0105245_10297232 | |||
| 933 | Ga0105247_10001523 | |||
| 934 | Ga0105247_10034952 | |||
| 935 | Ga0114129_10015277 | |||
| 936 | Ga0114129_10066618 | |||
| 937 | Ga0114129_10126089 | |||
| 938 | Ga0114129_10128583 | |||
| 939 | Ga0114129_10389422 | |||
| 940 | Ga0105243_10790876 | |||
| 941 | Ga0105241_10030797 | |||
| 942 | Ga0105241_10045108 | |||
| 943 | Ga0105241_10046298 | |||
| 944 | Ga0105241_10059559 | |||
| 945 | Ga0105241_10110904 | |||
| 946 | Ga0105241_10297342 | |||
| 947 | Ga0105242_10005778 | |||
| 948 | Ga0105242_10006636 | |||
| 949 | Ga0105242_10018454 | |||
| 950 | Ga0105242_10019208 | |||
| 951 | Ga0105242_10020961 | |||
| 952 | Ga0105242_10141645 | |||
| 953 | Ga0105242_10249044 | |||
| 954 | Ga0105242_10356783 | |||
| 955 | Ga0105248_10001154 | |||
| 956 | Ga0105248_10001212 | |||
| 957 | Ga0105248_10006132 | |||
| 958 | Ga0105248_10047986 | |||
| 959 | Ga0105248_10055587 | |||
| 960 | Ga0105248_10058639 | |||
| 961 | Ga0105248_10067736 | |||
| 962 | Ga0105248_10070741 | |||
| 963 | Ga0105248_10100459 | |||
| 964 | Ga0105248_10276537 | |||
| 965 | Ga0105248_10368399 | |||
| 966 | Ga0105248_10909401 | |||
| 967 | Ga0105237_10188650 | |||
| 968 | Ga0105237_10770596 | |||
| 969 | Ga0105238_10000995 | |||
| 970 | Ga0105238_10001793 | |||
| 971 | Ga0105238_10015296 | |||
| 972 | Ga0105238_10112711 | |||
| 973 | Ga0105238_10238741 | |||
| 974 | Ga0105249_10007702 | |||
| 975 | Ga0105249_10025151 | |||
| 976 | Ga0105249_10289738 | |||
| 977 | Ga0105239_10064693 | |||
| 978 | Ga0105239_10122848 | |||
| 979 | Ga0105239_10224732 | |||
| 980 | Ga0105239_10601548 | |||
| 981 | Ga0105239_10785223 | |||
| 982 | Ga0105246_10002105 | |||
| 983 | Ga0105246_10271763 | |||
| 984 | Ga0157373_10021327 | |||
| 985 | Ga0157373_10260975 | |||
| 986 | Ga0157370_10095674 | |||
| 987 | Ga0157370_10419983 | |||
| 988 | Ga0157369_10000314 | |||
| 989 | Ga0157369_10144005 | |||
| 990 | Ga0157374_10000570 | |||
| 991 | Ga0157374_10002417 | |||
| 992 | Ga0157374_10015171 | |||
| 993 | Ga0157374_10051549 | |||
| 994 | Ga0157374_10106569 | |||
| 995 | Ga0157378_10000107 | |||
| 996 | Ga0157378_10000525 | |||
| 997 | Ga0157378_10001631 | |||
| 998 | Ga0157378_10016091 | |||
| 999 | Ga0157378_10085317 | |||
| 1000 | Ga0157378_10176963 | |||
| 1001 | Ga0163162_10136119 | |||
| 1002 | Ga0163162_10148597 | |||
| 1003 | Ga0163162_10258286 | |||
| 1004 | Ga0163162_10310766 | |||
| 1005 | Ga0157372_10000688 | |||
| 1006 | Ga0157372_10002333 | |||
| 1007 | Ga0157372_10069166 | |||
| 1008 | Ga0157372_10099516 | |||
| 1009 | Ga0157372_10220128 | |||
| 1010 | Ga0157372_10498528 | |||
| 1011 | Ga0157375_10019854 | |||
| 1012 | Ga0157375_10351149 | |||
| 1013 | Ga0157375_10432656 | |||
| 1014 | Ga0157375_10631381 | |||
| 1015 | Ga0163163_10001364 | |||
| 1016 | Ga0163163_10007649 | |||
| 1017 | Ga0163163_10009863 | |||
| 1018 | Ga0163163_10046497 | |||
| 1019 | Ga0163163_10083638 | |||
| 1020 | Ga0163163_10098545 | |||
| 1021 | Ga0163163_10176919 | |||
| 1022 | Ga0163163_10200789 | |||
| 1023 | Ga0163163_10246879 | |||
| 1024 | Ga0163163_10387393 | |||
| 1025 | Ga0163163_10474368 | |||
| 1026 | Ga0157380_10017936 | |||
| 1027 | Ga0157380_10101361 | |||
| 1028 | Ga0157377_10023846 | |||
| 1029 | Ga0157379_10002834 | |||
| 1030 | Ga0157379_10176290 | |||
| 1031 | Ga0157379_10360626 | |||
| 1032 | Ga0157376_10015632 | |||
| 1033 | Ga0157376_10016931 | |||
| 1034 | Ga0157376_10024010 | |||
| 1035 | Ga0157376_10025966 | |||
| 1036 | Ga0157376_10136144 | |||
| 1037 | Ga0157376_10195606 | |||
| 1038 | Ga0157376_10387578 | |||
| 1039 | Ga0163161_10367264 | |||
| 1040 | Ga0207697_10005064 | |||
| 1041 | Ga0207710_10003580 | |||
| 1042 | Ga0207710_10031811 | |||
| 1043 | Ga0207688_10001012 | |||
| 1044 | Ga0207680_10022704 | |||
| 1045 | Ga0207699_10043788 | |||
| 1046 | Ga0207699_10114237 | |||
| 1047 | Ga0207699_10154498 | |||
| 1048 | Ga0207699_10188073 | |||
| 1049 | Ga0207645_10333328 | |||
| 1050 | Ga0207643_10009866 | |||
| 1051 | Ga0207654_10010170 | |||
| 1052 | Ga0207654_10029892 | |||
| 1053 | Ga0207654_10040123 | |||
| 1054 | Ga0207707_10002001 | |||
| 1055 | Ga0207707_10011920 | |||
| 1056 | Ga0207707_10250462 | |||
| 1057 | Ga0207707_10319995 | |||
| 1058 | Ga0207695_10112696 | |||
| 1059 | Ga0207695_10228573 | |||
| 1060 | Ga0207671_10030506 | |||
| 1061 | Ga0207671_10118445 | |||
| 1062 | Ga0207671_10516569 | |||
| 1063 | Ga0207693_10000368 | |||
| 1064 | Ga0207693_10003156 | |||
| 1065 | Ga0207693_10088102 | |||
| 1066 | Ga0207663_10004612 | |||
| 1067 | Ga0207663_10379002 | |||
| 1068 | Ga0207660_10153918 | |||
| 1069 | Ga0207662_10015819 | |||
| 1070 | Ga0207649_10039548 | |||
| 1071 | Ga0207649_10099625 | |||
| 1072 | Ga0207649_10161979 | |||
| 1073 | Ga0207652_10383850 | |||
| 1074 | Ga0207646_10015286 | |||
| 1075 | Ga0207681_10003450 | |||
| 1076 | Ga0207681_10068306 | |||
| 1077 | Ga0207681_10224168 | |||
| 1078 | Ga0207694_10002245 | |||
| 1079 | Ga0207694_10014691 | |||
| 1080 | Ga0207694_10022838 | |||
| 1081 | Ga0207694_10194584 | |||
| 1082 | Ga0207694_10339735 | |||
| 1083 | Ga0207650_10012777 | |||
| 1084 | Ga0207650_10039898 | |||
| 1085 | Ga0207650_10127339 | |||
| 1086 | Ga0207650_10130562 | |||
| 1087 | Ga0207650_10285893 | |||
| 1088 | Ga0207650_10511609 | |||
| 1089 | Ga0207659_10000812 | |||
| 1090 | Ga0207659_10006593 | |||
| 1091 | Ga0207659_10183795 | |||
| 1092 | Ga0207659_10406661 | |||
| 1093 | Ga0207687_10003140 | |||
| 1094 | Ga0207687_10004079 | |||
| 1095 | Ga0207687_10010058 | |||
| 1096 | Ga0207687_10111390 | |||
| 1097 | Ga0207700_10058195 | |||
| 1098 | Ga0207700_10061832 | |||
| 1099 | Ga0207700_10070086 | |||
| 1100 | Ga0207700_10073001 | |||
| 1101 | Ga0207700_10322067 | |||
| 1102 | Ga0207664_10118956 | |||
| 1103 | Ga0207664_10526965 | |||
| 1104 | Ga0207644_10046942 | |||
| 1105 | Ga0207644_10258274 | |||
| 1106 | Ga0207706_10059259 | |||
| 1107 | Ga0207686_10007319 | |||
| 1108 | Ga0207686_10016598 | |||
| 1109 | Ga0207686_10047147 | |||
| 1110 | Ga0207686_10047397 | |||
| 1111 | Ga0207686_10084239 | |||
| 1112 | Ga0207670_10004690 | |||
| 1113 | Ga0207670_10123377 | |||
| 1114 | Ga0207669_10079635 | |||
| 1115 | Ga0207669_10090972 | |||
| 1116 | Ga0207669_10414404 | |||
| 1117 | Ga0207704_10009914 | |||
| 1118 | Ga0207704_10057719 | |||
| 1119 | Ga0207704_10064164 | |||
| 1120 | Ga0207704_10490915 | |||
| 1121 | Ga0207665_10012222 | |||
| 1122 | Ga0207691_10038862 | |||
| 1123 | Ga0207691_10048087 | |||
| 1124 | Ga0207691_10182915 | |||
| 1125 | Ga0207691_10228343 | |||
| 1126 | Ga0207711_10000655 | |||
| 1127 | Ga0207711_10001410 | |||
| 1128 | Ga0207711_10008169 | |||
| 1129 | Ga0207711_10011460 | |||
| 1130 | Ga0207711_10012057 | |||
| 1131 | Ga0207711_10013548 | |||
| 1132 | Ga0207711_10065149 | |||
| 1133 | Ga0207711_10137584 | |||
| 1134 | Ga0207711_10277161 | |||
| 1135 | Ga0207711_10308419 | |||
| 1136 | Ga0207711_10499205 | |||
| 1137 | Ga0207689_10071711 | |||
| 1138 | Ga0207689_10179489 | |||
| 1139 | Ga0207689_10201472 | |||
| 1140 | Ga0207661_10019184 | |||
| 1141 | Ga0207661_10058271 | |||
| 1142 | Ga0207661_10063039 | |||
| 1143 | Ga0207679_10018466 | |||
| 1144 | Ga0207679_10033562 | |||
| 1145 | Ga0207679_10075442 | |||
| 1146 | Ga0207679_10123448 | |||
| 1147 | Ga0207679_10171931 | |||
| 1148 | Ga0207679_10451486 | |||
| 1149 | Ga0207667_10008625 | |||
| 1150 | Ga0207667_10012940 | |||
| 1151 | Ga0207667_10147763 | |||
| 1152 | Ga0207651_10030205 | |||
| 1153 | Ga0207651_10098614 | |||
| 1154 | Ga0207651_10333272 | |||
| 1155 | Ga0207712_10003440 | |||
| 1156 | Ga0207712_10005352 | |||
| 1157 | Ga0207712_10119915 | |||
| 1158 | Ga0207712_10212887 | |||
| 1159 | Ga0207658_10045670 | |||
| 1160 | Ga0207677_10033128 | |||
| 1161 | Ga0207677_10035930 | |||
| 1162 | Ga0207677_10055628 | |||
| 1163 | Ga0207677_10086760 | |||
| 1164 | Ga0207677_10155166 | |||
| 1165 | Ga0207703_10007946 | |||
| 1166 | Ga0207703_10010148 | |||
| 1167 | Ga0207703_10010815 | |||
| 1168 | Ga0207703_10014433 | |||
| 1169 | Ga0207703_10048441 | |||
| 1170 | Ga0207703_10054674 | |||
| 1171 | Ga0207639_10091264 | |||
| 1172 | Ga0207708_10064071 | |||
| 1173 | Ga0207708_10130545 | |||
| 1174 | Ga0207702_10001290 | |||
| 1175 | Ga0207702_10006085 | |||
| 1176 | Ga0207641_10039067 | |||
| 1177 | Ga0207641_10060910 | |||
| 1178 | Ga0207641_10224865 | |||
| 1179 | Ga0207641_10266977 | |||
| 1180 | Ga0207648_10001037 | |||
| 1181 | Ga0207648_10063216 | |||
| 1182 | Ga0207648_10108896 | |||
| 1183 | Ga0207648_10134216 | |||
| 1184 | Ga0207648_10554844 | |||
| 1185 | Ga0207676_10003187 | |||
| 1186 | Ga0207676_10004912 | |||
| 1187 | Ga0207676_10032056 | |||
| 1188 | Ga0207676_10050812 | |||
| 1189 | Ga0207674_10000126 | |||
| 1190 | Ga0207674_10002270 | |||
| 1191 | Ga0207674_10017642 | |||
| 1192 | Ga0207674_10032195 | |||
| 1193 | Ga0207675_100000826 | |||
| 1194 | Ga0207675_100308738 | |||
| 1195 | Ga0207675_100700389 | |||
| 1196 | Ga0207683_10132683 | |||
| 1197 | Ga0207683_10209018 | |||
| 1198 | Ga0207698_10461148 | |||
| 1199 | Ga0207428_10005716 | |||
| 1200 | Ga0207428_10369536 | |||
| 1201 | Ga0268266_10148295 | |||
| 1202 | Ga0268265_10002008 | |||
| 1203 | Ga0268264_10085467 | |||
| 1204 | Ga0268264_10094602 | |||
| 1205 | Ga0268264_10242661 | |||
| 1206 | Ga0268264_10248450 | |||
| 1207 | Ga0268264_10606999 | |||
| 1208 | Ga0307408_100089538 | |||
| 1209 | Ga0316575_10025187 | |||
| 1210 | Ga0307416_100125442 | |||
| 1211 | Ga0373926_0007781 | |||
| 1212 | Ga0373926_0126747 | |||
| 1213 | Ga0373949_0022536 | |||
| 1214 | Ga0373923_0020878 | |||
| 1215 | Ga0373943_0002721 | |||
| 1216 | Ga0373955_0008502 | |||
| 1217 | Ga0373942_0091311 | |||
| 1218 | Ga0373924_0001418 | |||
| 1219 | Ga0373931_0150297 | |||
| 1220 | Ga0373931_0192393 | |||
| 1221 | Ga0373935_0028231 | |||
| 1222 | Ga0373935_0246557 | |||
| 1223 | Ga0373933_0124312 | |||
| 1224 | Ga0373947_0004237 | |||
| 1225 | Ga0373947_0263592 | |||
| 1226 | Ga0373937_0022464 | |||
| 1227 | Ga0373937_0113555 | |||
| 1228 | Ga0373937_0222756 | |||
| 1229 | Ga0373937_0886291 | |||
| 1230 | Ga0373925_0017642 | |||
| 1231 | Ga0373925_0351472 | |||
| 1232 | Ga0439450_026741 | |||
| 1233 | Ga0451577_0097615 | |||
| 1234 | Ga0451577_0364541 | |||
| 1235 | Ga0453683_0000129 | |||
| 1236 | Ga0451576_0029314 | |||
| 1237 | Ga0451576_0054888 | |||
| 1238 | Ga0451576_0094389 | |||
| 1239 | Ga0451576_0338163 | |||
| 1240 | Ga0495592_0069690 | |||
| 1241 | Ga0495592_0084663 | |||
| 1242 | Ga0495603_0010363 | |||
| 1243 | Ga0495629_0009461 | |||
| 1244 | Ga0495629_0199415 | |||
| 1245 | Ga0495629_0287754 | |||
| 1246 | Ga0495629_0351104 | |||
| 1247 | Ga0495651_0004725 | |||
| 1248 | Ga0495651_0017568 | |||
| 1249 | Ga0495580_0027251 | |||
| 1250 | Ga0495580_0057118 | |||
| 1251 | Ga0495580_0057853 | |||
| 1252 | Ga0495580_0151533 | |||
| 1253 | Ga0495580_0152413 | |||
| 1254 | Ga0495580_0243003 | |||
| 1255 | Ga0495582_0003346 | |||
| 1256 | Ga0495582_0171635 | |||
| 1257 | Ga0495605_0177326 | |||
| 1258 | Ga0495639_0030687 | |||
| 1259 | Ga0495664_0013877 | |||
| 1260 | Ga0495664_0132925 | |||
| 1261 | Ga0495664_0327438 | |||
| 1262 | Ga0495584_0057945 | |||
| 1263 | Ga0495594_0008898 | |||
| 1264 | Ga0495594_0032662 | |||
| 1265 | Ga0495594_0049475 | |||
| 1266 | Ga0495594_0053419 | |||
| 1267 | Ga0495594_0179236 | |||
| 1268 | Ga0495608_0061676 | |||
| 1269 | Ga0495618_0100225 | |||
| 1270 | Ga0495618_0270603 | |||
| 1271 | Ga0495628_0011166 | |||
| 1272 | Ga0495628_0200740 | |||
| 1273 | Ga0495628_0276425 | |||
| 1274 | Ga0495628_0346062 | |||
| 1275 | Ga0495630_0000561 | |||
| 1276 | Ga0495630_0054528 | |||
| 1277 | Ga0495666_0013871 | |||
| 1278 | Ga0495642_0012940 | |||
| 1279 | Ga0495652_0038444 | |||
| 1280 | Ga0495652_0125338 | |||
| 1281 | Ga0495665_0037610 | |||
| 1282 | Ga0495665_0057111 | |||
| 1283 | Ga0495665_0063351 | |||
| 1284 | Ga0495640_0038428 | |||
| 1285 | Ga0495640_0180108 | |||
| 1286 | Ga0495587_0002935 | |||
| 1287 | Ga0495587_0117569 | |||
| 1288 | Ga0495621_0009972 | |||
| 1289 | Ga0495645_0006375 | |||
| 1290 | Ga0495645_0031575 | |||
| 1291 | Ga0495645_0092771 | |||
| 1292 | Ga0495645_0169013 | |||
| 1293 | Ga0495667_0003475 | |||
| 1294 | Ga0495667_0015202 | |||
| 1295 | Ga0495667_0015277 | |||
| 1296 | Ga0495635_0352631 | |||
| 1297 | Ga0495659_0001546 | |||
| 1298 | Ga0495659_0006568 | |||
| 1299 | Ga0495659_0008086 | |||
| 1300 | Ga0495659_0093697 | |||
| 1301 | Ga0495588_0036301 | |||
| 1302 | Ga0495657_0020827 | |||
| 1303 | Ga0495599_0016981 | |||
| 1304 | Ga0495623_0031200 | |||
| 1305 | Ga0495646_0047500 | |||
| 1306 | Ga0495647_0047882 | |||
| 1307 | Ga0495658_0000515 | |||
| 1308 | Ga0495613_0047024 | |||
| 1309 | Ga0495613_0098557 | |||
| 1310 | Ga0495613_0211215 | |||
| 1311 | Ga0495613_0213063 | |||
| 1312 | Ga0495613_0309903 | |||
| 1313 | Ga0495670_0268014 | |||
| 1314 | Ga0495600_0018764 | |||
| 1315 | Ga0495600_0021402 | |||
| 1316 | Ga0495581_0128092 | |||
| 1317 | Ga0495604_0014121 | |||
| 1318 | Ga0495604_0033082 | |||
| 1319 | Ga0495604_0131872 | |||
| 1320 | Ga0495604_0171550 | |||
| 1321 | Ga0495604_0204227 | |||
| 1322 | Ga0495636_0007491 | |||
| 1323 | Ga0495636_0014645 | |||
| 1324 | Ga0495674_0001437 | |||
| 1325 | Ga0495674_0008689 | |||
| 1326 | Ga0495674_0010648 | |||
| 1327 | Ga0495674_0082105 | |||
| 1328 | Ga0495674_0144135 | |||
| 1329 | Ga0495676_0016362 | |||
| 1330 | Ga0495680_0011065 | |||
| 1331 | Ga0495680_0063199 | |||
| 1332 | Ga0495680_0094857 | |||
| 1333 | Ga0495680_0210875 | |||
| 1334 | Ga0495675_0002040 | |||
| 1335 | Ga0495675_0002416 | |||
| 1336 | Ga0495675_0004269 | |||
| 1337 | Ga0495675_0119653 | |||
| 1338 | Ga0495684_0007057 | |||
| 1339 | Ga0495684_0141279 | |||
| 1340 | Ga0495602_0062844 | |||
| 1341 | Ga0496100_0180983 | |||
| 1342 | Ga0496102_0015730 | |||
| 1343 | Ga0496103_0007619 | |||
| 1344 | Ga0496104_0014322 | |||
| 1345 | Ga0496104_0173036 | |||
| 1346 | Ga0496104_0197423 | |||
| 1347 | Ga0496104_0200871 | |||
| 1348 | Ga0496104_0539801 | |||
| 1349 | Ga0496105_0121263 | |||
| 1350 | Ga0496105_0144854 | |||
| 1351 | Ga0496106_0099403 | |||
| 1352 | Ga0496107_0188966 | |||
| 1353 | Ga0496108_0006690 | |||
| 1354 | Ga0496109_0390601 | |||
| 1355 | Ga0496109_0434898 | |||
| 1356 | Ga0496110_0047175 | |||
| 1357 | Ga0496111_0207152 | |||
| 1358 | Ga0496112_0013767 | |||
| 1359 | Ga0496112_0058797 | |||
| 1360 | Ga0496112_0073659 | |||
| 1361 | Ga0496112_0181814 | |||
| 1362 | Ga0496113_0067336 | |||
| 1363 | Ga0496115_0039424 | |||
| 1364 | Ga0496115_0130190 | |||
| 1365 | Ga0501031_0347844 | |||
| 1366 | Ga0501036_0142110 | |||
| 1367 | Ga0501048_0392893 | |||
| 1368 | Ga0501067_0035915 | |||
| 1369 | Ga0501075_0013484 | |||
| 1370 | Ga0501075_0077997 | |||
| 1371 | Ga0501076_0152047 | |||
| 1372 | Ga0501076_0324938 | |||
| 1373 | nmdc:mga0k408_10935_c1 | |||
| 1374 | nmdc:mga07m45_135595_c1 | |||
| 1375 | nmdc:mga05p37_211064_c1 | |||
| 1376 | nmdc:mga05p37_2311_c1 | |||
| 1377 | nmdc:mga05p37_427856_c1 | |||
| 1378 | nmdc:mga05p37_525581_c1 | |||
| 1379 | nmdc:mga05p37_548205_c1 | |||
| 1380 | nmdc:mga05p37_6458_c1 | |||
| 1381 | nmdc:mga05p37_83728_c1 | |||
| 1382 | nmdc:mga09592_45560_c1 | |||
| 1383 | nmdc:mga09592_752672_c1 | |||
| 1384 | nmdc:mga0qj67_113832_c1 | |||
| 1385 | nmdc:mga0qj67_15413_c1 | |||
| 1386 | nmdc:mga06r32_120118_c1 | |||
| 1387 | nmdc:mga06r32_140369_c1 | |||
| 1388 | nmdc:mga06r32_18430_c1 | |||
| 1389 | nmdc:mga08y16_117323_c1 | |||
| 1390 | nmdc:mga08y16_183117_c1 | |||
| 1391 | nmdc:mga08y16_237943_c1 | |||
| 1392 | nmdc:mga0n895_102631_c1 | |||
| 1393 | nmdc:mga0n895_111999_c1 | |||
| 1394 | nmdc:mga0n895_46703_c1 | |||
| 1395 | nmdc:mga0rr50_210018_c1 | |||
| 1396 | nmdc:mga08x19_89984_c1 | |||
| 1397 | nmdc:mga0a205_54676_c2 | |||
| 1398 | nmdc:mga0a205_598483_c1 | |||
| 1399 | nmdc:mga0a205_62708_c1 | |||
| 1400 | Ga0495595_0040528 | |||
| 1401 | Ga0495619_0174595 | |||
| 1402 | Ga0501084_0555007 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8bgo-assembly1.cif.gz_C | n,n-diacetylchitobiose deacetylase from pyrococcus chitonophagus with substrate n,n-diacetylchitobiose | 0.837 | 4 | 252 |
| 3we7-assembly1.cif.gz_A | crystal structure of diacetylchitobiose deacetylase from pyrococcus horikoshii | 0.8292 | 6 | 252 |
| 1uan-assembly1.cif.gz_B | crystal structure of the conserved protein tt1542 from thermus thermophilus hb8 | 0.8264 | 6 | 258 |
| 4xm0-assembly1.cif.gz_C | n,n'-diacetylchitobiose deacetylase (semet derivative) from pyrococcus furiosus in the absence of cadmium | 0.8264 | 3 | 253 |
| 1uan-assembly1.cif.gz_A | crystal structure of the conserved protein tt1542 from thermus thermophilus hb8 | 0.8192 | 6 | 258 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_L0T643_2_220_3.40.50.10320 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like | 0.8665 | 1 | 252 | 3.40.50.10320 |
| af_L0T643_2_220_3.40.50.10320 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like | 0.8407 | 1 | 252 | 3.40.50.10320 |
| af_Q2G0L0_1_219_3.40.50.10320 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like | 0.8397 | 2 | 253 | 3.40.50.10320 |
| af_P9WJN1_3_287_3.40.50.10320 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like | 0.8329 | 5 | 271 | 3.40.50.10320 |
| af_Q2G0L0_1_219_3.40.50.10320 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like | 0.8328 | 2 | 253 | 3.40.50.10320 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A832AIX1-F1-model_v4 | PIG-L family deacetylase | 0.9855 | 4 | 138 |
GO:0016811
|
| AF-A0A3M2KV35-F1-model_v4 | PIG-L family deacetylase | 0.9827 | 6 | 138 |
GO:0016811
|
| AF-A0A2W4P3X9-F1-model_v4 | PIG-L family deacetylase | 0.9792 | 4 | 117 |
GO:0016811
|
| AF-A0A846FWZ1-F1-model_v4 | deleted | 0.9784 | 5 | 236 |
|
| AF-A0A3D4JCM5-F1-model_v4 | GlcNAc-PI de-N-acetylase | 0.9766 | 4 | 165 |
GO:0016811
|