F476077
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 700 | 234 | 1400 | 120 |
Family's Representative Sequence
| Representative Sequence | 3300005344|Ga0070661_101424695|Ga0070661_1014246951 |
| Length | 118 |
| Sequence | MQTATKVVRRDATAASGDSVAILAFSGDIASTSKDTMLQAYHGVGAVKKVLLDFSGVDYINSSGIAIIIQMLIEERAAGHRTIGIFGLTPHFKKVFTMVGVSKYATISPDEPTALAEM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 53 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 54 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 56 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 85 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 86 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 87 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 138 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 142 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 143 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 144 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 145 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 146 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 147 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 148 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 149 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 150 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 151 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 152 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 153 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 154 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 155 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 156 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 157 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 158 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 159 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 160 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 161 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 162 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 163 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 164 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 165 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 168 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 169 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 170 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 171 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 172 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 173 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 174 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 175 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 176 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 205 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 206 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 207 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 208 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 209 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 210 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 211 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 212 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 215 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 216 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 217 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 218 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 219 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 220 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300059629 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 231 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 234 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.71 |
| Metatranscriptomes | 3.29 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.57 |
| Nodule | 0 |
| Rhizoplane | 3 |
| Rhizosphere | 95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 27.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070661_101424695 | 3300005344 | Unclassified | 583 |
| 2 | rootH2_10042999 | 3300003320 | Unclassified | 1640 |
| 3 | rootH2_10066083 | 3300003320 | Bacteria | 4909 |
| 4 | rootH2_10066096 | 3300003320 | Bacteria | 1898 |
| 5 | rootH1_10187309 | 3300003323 | Bacteria | 1842 |
| 6 | Ga0065715_10375777 | 3300005293 | Unclassified | 914 |
| 7 | Ga0070658_10000142 | 3300005327 | Bacteria | 63262 |
| 8 | Ga0070658_10005408 | 3300005327 | Bacteria | 10361 |
| 9 | Ga0070658_10006481 | 3300005327 | Bacteria | 9484 |
| 10 | Ga0070658_10010431 | 3300005327 | Bacteria | 7449 |
| 11 | Ga0070658_10011101 | 3300005327 | Bacteria | 7222 |
| 12 | Ga0070658_10273427 | 3300005327 | Bacteria | 1437 |
| 13 | Ga0070658_11239601 | 3300005327 | Bacteria | 648 |
| 14 | Ga0070676_10013742 | 3300005328 | Bacteria | 4438 |
| 15 | Ga0070683_100001294 | 3300005329 | Bacteria | 19050 |
| 16 | Ga0070683_100026956 | 3300005329 | Bacteria | 5179 |
| 17 | Ga0070683_100150487 | 3300005329 | Unclassified | 2206 |
| 18 | Ga0070683_100214984 | 3300005329 | Bacteria | 1827 |
| 19 | Ga0070683_100581527 | 3300005329 | Bacteria | 1071 |
| 20 | Ga0070683_100658668 | 3300005329 | Bacteria | 1002 |
| 21 | Ga0070690_100277073 | 3300005330 | Bacteria | 1195 |
| 22 | Ga0070670_100002947 | 3300005331 | Bacteria | 14096 |
| 23 | Ga0070670_100063184 | 3300005331 | Bacteria | 3178 |
| 24 | Ga0068869_100001913 | 3300005334 | Bacteria | 12502 |
| 25 | Ga0068869_100281621 | 3300005334 | Bacteria | 1337 |
| 26 | Ga0070666_10062598 | 3300005335 | Unclassified | 2521 |
| 27 | Ga0070666_10306518 | 3300005335 | Unclassified | 1131 |
| 28 | Ga0070680_100081136 | 3300005336 | Bacteria | 2676 |
| 29 | Ga0070680_100162693 | 3300005336 | Bacteria | 1876 |
| 30 | Ga0070680_100620016 | 3300005336 | Bacteria | 929 |
| 31 | Ga0068868_100000009 | 3300005338 | Bacteria | 120604 |
| 32 | Ga0068868_100015740 | 3300005338 | Bacteria | 5601 |
| 33 | Ga0068868_100022926 | 3300005338 | Bacteria | 4720 |
| 34 | Ga0070660_100000311 | 3300005339 | Bacteria | 32366 |
| 35 | Ga0070660_100067433 | 3300005339 | Bacteria | 2788 |
| 36 | Ga0070660_100135327 | 3300005339 | Bacteria | 1974 |
| 37 | Ga0070660_100409213 | 3300005339 | Unclassified | 1122 |
| 38 | Ga0070660_101435628 | 3300005339 | Bacteria | 586 |
| 39 | Ga0070661_100021911 | 3300005344 | Bacteria | 4570 |
| 40 | Ga0070661_100136155 | 3300005344 | Bacteria | 1848 |
| 41 | Ga0070661_100165020 | 3300005344 | Bacteria | 1679 |
| 42 | Ga0070661_100274925 | 3300005344 | Unclassified | 1305 |
| 43 | Ga0070661_100490448 | 3300005344 | Bacteria | 982 |
| 44 | Ga0070692_10543707 | 3300005345 | Bacteria | 760 |
| 45 | Ga0070668_100084709 | 3300005347 | Bacteria | 2490 |
| 46 | Ga0070675_100034487 | 3300005354 | Bacteria | 4108 |
| 47 | Ga0070671_100022721 | 3300005355 | Bacteria | 5125 |
| 48 | Ga0070671_100154151 | 3300005355 | Bacteria | 1941 |
| 49 | Ga0070671_100887489 | 3300005355 | Bacteria | 779 |
| 50 | Ga0070673_100010611 | 3300005364 | Bacteria | 6243 |
| 51 | Ga0070659_100172730 | 3300005366 | Bacteria | 1771 |
| 52 | Ga0070659_100181963 | 3300005366 | Bacteria | 1725 |
| 53 | Ga0070667_100001882 | 3300005367 | Bacteria | 18639 |
| 54 | Ga0070667_100012140 | 3300005367 | Bacteria | 7130 |
| 55 | Ga0070709_10858029 | 3300005434 | Unclassified | 716 |
| 56 | Ga0070709_11236034 | 3300005434 | Unclassified | 601 |
| 57 | Ga0070714_100017303 | 3300005435 | Bacteria | 5838 |
| 58 | Ga0070714_100168901 | 3300005435 | Bacteria | 1984 |
| 59 | Ga0070714_100209289 | 3300005435 | Bacteria | 1787 |
| 60 | Ga0070714_101293480 | 3300005435 | Bacteria | 712 |
| 61 | Ga0070714_102487064 | 3300005435 | Unclassified | 503 |
| 62 | Ga0070713_100003713 | 3300005436 | Bacteria | 10110 |
| 63 | Ga0070713_100108311 | 3300005436 | Bacteria | 2419 |
| 64 | Ga0070713_100190228 | 3300005436 | Bacteria | 1849 |
| 65 | Ga0070713_100235136 | 3300005436 | Bacteria | 1667 |
| 66 | Ga0070713_100256280 | 3300005436 | Unclassified | 1598 |
| 67 | Ga0070713_100332734 | 3300005436 | Unclassified | 1405 |
| 68 | Ga0070713_100978151 | 3300005436 | Bacteria | 816 |
| 69 | Ga0070713_101211836 | 3300005436 | Unclassified | 731 |
| 70 | Ga0070711_100221272 | 3300005439 | Unclassified | 1472 |
| 71 | Ga0070711_100947947 | 3300005439 | Unclassified | 736 |
| 72 | Ga0070711_100979344 | 3300005439 | Unclassified | 725 |
| 73 | Ga0070663_100056019 | 3300005455 | Bacteria | 2824 |
| 74 | Ga0070663_100188084 | 3300005455 | Bacteria | 1606 |
| 75 | Ga0070663_100382837 | 3300005455 | Unclassified | 1146 |
| 76 | Ga0070663_100489032 | 3300005455 | Unclassified | 1020 |
| 77 | Ga0070663_100494166 | 3300005455 | Bacteria | 1015 |
| 78 | Ga0070678_100062022 | 3300005456 | Bacteria | 2758 |
| 79 | Ga0070662_100010729 | 3300005457 | Bacteria | 6032 |
| 80 | Ga0070681_10000804 | 3300005458 | Bacteria | 26179 |
| 81 | Ga0070681_10046056 | 3300005458 | Unclassified | 4361 |
| 82 | Ga0070681_10387789 | 3300005458 | Bacteria | 1308 |
| 83 | Ga0068867_100203700 | 3300005459 | Unclassified | 1585 |
| 84 | Ga0068867_100525045 | 3300005459 | Bacteria | 1021 |
| 85 | Ga0070685_11361589 | 3300005466 | Unclassified | 544 |
| 86 | Ga0070679_100000226 | 3300005530 | Bacteria | 46282 |
| 87 | Ga0070679_100044742 | 3300005530 | Unclassified | 4410 |
| 88 | Ga0070679_100607471 | 3300005530 | Unclassified | 1037 |
| 89 | Ga0070684_100025564 | 3300005535 | Bacteria | 4965 |
| 90 | Ga0070684_100078675 | 3300005535 | Unclassified | 2914 |
| 91 | Ga0070684_100111897 | 3300005535 | Bacteria | 2449 |
| 92 | Ga0070684_100216012 | 3300005535 | Bacteria | 1749 |
| 93 | Ga0070684_100347897 | 3300005535 | Bacteria | 1363 |
| 94 | Ga0070684_100446949 | 3300005535 | Bacteria | 1194 |
| 95 | Ga0070684_100502105 | 3300005535 | Bacteria | 1123 |
| 96 | Ga0068853_100000914 | 3300005539 | Bacteria | 20625 |
| 97 | Ga0068853_100034028 | 3300005539 | Bacteria | 4324 |
| 98 | Ga0068853_100037459 | 3300005539 | Viruses | 4126 |
| 99 | Ga0068853_100042984 | 3300005539 | Bacteria | 3865 |
| 100 | Ga0070665_100024182 | 3300005548 | Bacteria | 6118 |
| 101 | Ga0070665_100030820 | 3300005548 | Bacteria | 5398 |
| 102 | Ga0070665_100069665 | 3300005548 | Unclassified | 3525 |
| 103 | Ga0070665_100104651 | 3300005548 | Unclassified | 2832 |
| 104 | Ga0070665_100169901 | 3300005548 | Bacteria | 2182 |
| 105 | Ga0070665_100326624 | 3300005548 | Bacteria | 1538 |
| 106 | Ga0068855_100003316 | 3300005563 | Bacteria | 19696 |
| 107 | Ga0068855_100007673 | 3300005563 | Bacteria | 13036 |
| 108 | Ga0068855_100015507 | 3300005563 | Bacteria | 9174 |
| 109 | Ga0068855_100028667 | 3300005563 | Bacteria | 6661 |
| 110 | Ga0068855_100032512 | 3300005563 | Bacteria | 6228 |
| 111 | Ga0068855_100045317 | 3300005563 | Bacteria | 5201 |
| 112 | Ga0068855_100074105 | 3300005563 | Bacteria | 3954 |
| 113 | Ga0068855_100322461 | 3300005563 | Unclassified | 1707 |
| 114 | Ga0068855_101603030 | 3300005563 | Unclassified | 666 |
| 115 | Ga0070664_100171960 | 3300005564 | Unclassified | 1922 |
| 116 | Ga0068857_100000181 | 3300005577 | Bacteria | 40250 |
| 117 | Ga0068857_100000269 | 3300005577 | Bacteria | 35388 |
| 118 | Ga0068857_100014310 | 3300005577 | Bacteria | 6914 |
| 119 | Ga0068857_100054215 | 3300005577 | Unclassified | 3557 |
| 120 | Ga0068857_100055906 | 3300005577 | Bacteria | 3502 |
| 121 | Ga0068857_100833861 | 3300005577 | Bacteria | 882 |
| 122 | Ga0068857_100972750 | 3300005577 | Unclassified | 816 |
| 123 | Ga0068854_100003621 | 3300005578 | Bacteria | 9666 |
| 124 | Ga0068854_100030603 | 3300005578 | Unclassified | 3734 |
| 125 | Ga0068854_100596284 | 3300005578 | Bacteria | 943 |
| 126 | Ga0068856_100000809 | 3300005614 | Bacteria | 33774 |
| 127 | Ga0068856_100015932 | 3300005614 | Bacteria | 7268 |
| 128 | Ga0068856_100017479 | 3300005614 | Bacteria | 6949 |
| 129 | Ga0068856_100028898 | 3300005614 | Bacteria | 5417 |
| 130 | Ga0068856_100076409 | 3300005614 | Unclassified | 3318 |
| 131 | Ga0068856_100087860 | 3300005614 | Unclassified | 3091 |
| 132 | Ga0068856_100129642 | 3300005614 | Bacteria | 2526 |
| 133 | Ga0068856_100215543 | 3300005614 | Bacteria | 1935 |
| 134 | Ga0068856_100241622 | 3300005614 | Bacteria | 1821 |
| 135 | Ga0068856_100446206 | 3300005614 | Bacteria | 1314 |
| 136 | Ga0068856_100481900 | 3300005614 | Bacteria | 1261 |
| 137 | Ga0068856_100868069 | 3300005614 | Bacteria | 921 |
| 138 | Ga0068856_101224217 | 3300005614 | Bacteria | 767 |
| 139 | Ga0068856_101272533 | 3300005614 | Unclassified | 751 |
| 140 | Ga0068856_101713317 | 3300005614 | Unclassified | 641 |
| 141 | Ga0068852_100000199 | 3300005616 | Bacteria | 40929 |
| 142 | Ga0068852_100000887 | 3300005616 | Bacteria | 19805 |
| 143 | Ga0068852_100001654 | 3300005616 | Bacteria | 15203 |
| 144 | Ga0068852_100027066 | 3300005616 | Bacteria | 4668 |
| 145 | Ga0068852_100044386 | 3300005616 | Bacteria | 3775 |
| 146 | Ga0068852_100097933 | 3300005616 | Bacteria | 2640 |
| 147 | Ga0068852_100147539 | 3300005616 | Unclassified | 2184 |
| 148 | Ga0068852_100203299 | 3300005616 | Unclassified | 1875 |
| 149 | Ga0068852_100400092 | 3300005616 | Bacteria | 1351 |
| 150 | Ga0068852_100419216 | 3300005616 | Unclassified | 1320 |
| 151 | Ga0068852_100549498 | 3300005616 | Bacteria | 1155 |
| 152 | Ga0068859_100002712 | 3300005617 | Bacteria | 17961 |
| 153 | Ga0068859_100184430 | 3300005617 | Bacteria | 2170 |
| 154 | Ga0068864_100003465 | 3300005618 | Bacteria | 13030 |
| 155 | Ga0068864_100410702 | 3300005618 | Bacteria | 1288 |
| 156 | Ga0068861_100428645 | 3300005719 | Bacteria | 1180 |
| 157 | Ga0068851_10012603 | 3300005834 | Bacteria | 3989 |
| 158 | Ga0068851_10026100 | 3300005834 | Bacteria | 2869 |
| 159 | Ga0068851_10048580 | 3300005834 | Unclassified | 2150 |
| 160 | Ga0068851_10149862 | 3300005834 | Bacteria | 1274 |
| 161 | Ga0068863_100000273 | 3300005841 | Bacteria | 53827 |
| 162 | Ga0068863_100019580 | 3300005841 | Bacteria | 6472 |
| 163 | Ga0068858_100026536 | 3300005842 | Bacteria | 5381 |
| 164 | Ga0068858_100058900 | 3300005842 | Unclassified | 3551 |
| 165 | Ga0068858_100683606 | 3300005842 | Unclassified | 998 |
| 166 | Ga0068858_101913027 | 3300005842 | Bacteria | 586 |
| 167 | Ga0068860_100000031 | 3300005843 | Bacteria | 255068 |
| 168 | Ga0068862_100112116 | 3300005844 | Unclassified | 2395 |
| 169 | Ga0070717_10000898 | 3300006028 | Bacteria | 19756 |
| 170 | Ga0070717_10576571 | 3300006028 | Bacteria | 1020 |
| 171 | Ga0070717_10926923 | 3300006028 | Bacteria | 793 |
| 172 | Ga0070717_11022179 | 3300006028 | Bacteria | 753 |
| 173 | Ga0097621_100005630 | 3300006237 | Bacteria | 8835 |
| 174 | Ga0097621_100007467 | 3300006237 | Bacteria | 7820 |
| 175 | Ga0097621_101937389 | 3300006237 | Unclassified | 563 |
| 176 | Ga0097621_101977481 | 3300006237 | Unclassified | 557 |
| 177 | Ga0068871_100002198 | 3300006358 | Bacteria | 13257 |
| 178 | Ga0068865_100044913 | 3300006881 | Bacteria | 3026 |
| 179 | Ga0097620_100002712 | 3300006931 | Bacteria | 17961 |
| 180 | Ga0097620_100184430 | 3300006931 | Bacteria | 2170 |
| 181 | Ga0099794_10778805 | 3300007265 | Unclassified | 511 |
| 182 | Ga0105240_10000451 | 3300009093 | Bacteria | 75544 |
| 183 | Ga0105240_10001070 | 3300009093 | Bacteria | 48381 |
| 184 | Ga0105240_10002552 | 3300009093 | Bacteria | 29190 |
| 185 | Ga0105240_10002933 | 3300009093 | Bacteria | 26905 |
| 186 | Ga0105240_10003422 | 3300009093 | Bacteria | 24653 |
| 187 | Ga0105240_10068958 | 3300009093 | Bacteria | 4379 |
| 188 | Ga0105240_10092329 | 3300009093 | Bacteria | 3697 |
| 189 | Ga0105240_10956117 | 3300009093 | Unclassified | 918 |
| 190 | Ga0105240_11043451 | 3300009093 | Unclassified | 872 |
| 191 | Ga0105240_11097967 | 3300009093 | Bacteria | 847 |
| 192 | Ga0105240_11610709 | 3300009093 | Unclassified | 679 |
| 193 | Ga0105240_12317437 | 3300009093 | Bacteria | 556 |
| 194 | Ga0105245_10003181 | 3300009098 | Bacteria | 14677 |
| 195 | Ga0105245_10273907 | 3300009098 | Unclassified | 1647 |
| 196 | Ga0105245_10318564 | 3300009098 | Bacteria | 1531 |
| 197 | Ga0105247_10003136 | 3300009101 | Bacteria | 10892 |
| 198 | Ga0105247_10037922 | 3300009101 | Bacteria | 2940 |
| 199 | Ga0105247_10423707 | 3300009101 | Unclassified | 954 |
| 200 | Ga0105247_10600420 | 3300009101 | Bacteria | 816 |
| 201 | Ga0105247_11503282 | 3300009101 | Unclassified | 549 |
| 202 | Ga0105241_10000123 | 3300009174 | Bacteria | 56005 |
| 203 | Ga0105241_10019959 | 3300009174 | Bacteria | 4947 |
| 204 | Ga0105241_10098299 | 3300009174 | Bacteria | 2322 |
| 205 | Ga0105241_10274294 | 3300009174 | Bacteria | 1438 |
| 206 | Ga0105241_10292523 | 3300009174 | Bacteria | 1395 |
| 207 | Ga0105242_10795250 | 3300009176 | Bacteria | 936 |
| 208 | Ga0105248_10000047 | 3300009177 | Bacteria | 163513 |
| 209 | Ga0105248_10001233 | 3300009177 | Bacteria | 28557 |
| 210 | Ga0105248_10187362 | 3300009177 | Unclassified | 2332 |
| 211 | Ga0105237_10035217 | 3300009545 | Bacteria | 5066 |
| 212 | Ga0105237_10048761 | 3300009545 | Bacteria | 4257 |
| 213 | Ga0105237_10588877 | 3300009545 | Bacteria | 1119 |
| 214 | Ga0105237_11062054 | 3300009545 | Bacteria | 817 |
| 215 | Ga0105238_10000334 | 3300009551 | Bacteria | 51408 |
| 216 | Ga0105238_10011830 | 3300009551 | Bacteria | 8791 |
| 217 | Ga0105238_10021179 | 3300009551 | Bacteria | 6626 |
| 218 | Ga0105238_10027432 | 3300009551 | Bacteria | 5803 |
| 219 | Ga0105238_10041018 | 3300009551 | Bacteria | 4689 |
| 220 | Ga0105238_10212015 | 3300009551 | Bacteria | 1913 |
| 221 | Ga0105238_10532705 | 3300009551 | Bacteria | 1178 |
| 222 | Ga0105238_11869161 | 3300009551 | Bacteria | 633 |
| 223 | Ga0105238_12220059 | 3300009551 | Unclassified | 584 |
| 224 | Ga0105249_10037654 | 3300009553 | Bacteria | 4389 |
| 225 | Ga0105249_10397884 | 3300009553 | Bacteria | 1407 |
| 226 | Ga0105249_11746262 | 3300009553 | Unclassified | 695 |
| 227 | Ga0105239_10001864 | 3300010375 | Bacteria | 27591 |
| 228 | Ga0105239_10014176 | 3300010375 | Bacteria | 8844 |
| 229 | Ga0105239_10118191 | 3300010375 | Unclassified | 2942 |
| 230 | Ga0105239_10163775 | 3300010375 | Bacteria | 2486 |
| 231 | Ga0105239_10975988 | 3300010375 | Bacteria | 974 |
| 232 | Ga0105239_11491450 | 3300010375 | Bacteria | 781 |
| 233 | Ga0105239_11611946 | 3300010375 | Bacteria | 751 |
| 234 | Ga0105239_11937895 | 3300010375 | Bacteria | 684 |
| 235 | Ga0105246_10001815 | 3300011119 | Bacteria | 12795 |
| 236 | Ga0157373_10547909 | 3300013100 | Bacteria | 839 |
| 237 | Ga0157371_10215085 | 3300013102 | Bacteria | 1380 |
| 238 | Ga0157371_10226122 | 3300013102 | Bacteria | 1344 |
| 239 | Ga0157371_10643964 | 3300013102 | Bacteria | 791 |
| 240 | Ga0157371_11537311 | 3300013102 | Unclassified | 520 |
| 241 | Ga0157370_10000542 | 3300013104 | Bacteria | 47157 |
| 242 | Ga0157370_10010623 | 3300013104 | Bacteria | 9691 |
| 243 | Ga0157370_10020842 | 3300013104 | Bacteria | 6541 |
| 244 | Ga0157370_10035992 | 3300013104 | Bacteria | 4807 |
| 245 | Ga0157370_10041906 | 3300013104 | Bacteria | 4414 |
| 246 | Ga0157370_10077967 | 3300013104 | Bacteria | 3120 |
| 247 | Ga0157370_10211653 | 3300013104 | Bacteria | 1797 |
| 248 | Ga0157369_10001280 | 3300013105 | Bacteria | 31263 |
| 249 | Ga0157369_10002372 | 3300013105 | Bacteria | 22630 |
| 250 | Ga0157369_10002679 | 3300013105 | Bacteria | 21243 |
| 251 | Ga0157369_10032494 | 3300013105 | Bacteria | 5738 |
| 252 | Ga0157369_10046264 | 3300013105 | Bacteria | 4729 |
| 253 | Ga0157369_10054341 | 3300013105 | Bacteria | 4325 |
| 254 | Ga0157369_10055887 | 3300013105 | Unclassified | 4260 |
| 255 | Ga0157369_10077934 | 3300013105 | Bacteria | 3551 |
| 256 | Ga0157369_10081995 | 3300013105 | Bacteria | 3451 |
| 257 | Ga0157369_10171211 | 3300013105 | Bacteria | 2288 |
| 258 | Ga0157369_10213948 | 3300013105 | Bacteria | 2020 |
| 259 | Ga0157369_10364961 | 3300013105 | Unclassified | 1499 |
| 260 | Ga0157369_10419336 | 3300013105 | Unclassified | 1388 |
| 261 | Ga0157369_10459021 | 3300013105 | Bacteria | 1319 |
| 262 | Ga0157374_10002229 | 3300013296 | Bacteria | 16328 |
| 263 | Ga0157374_10014906 | 3300013296 | Bacteria | 6812 |
| 264 | Ga0157374_10145427 | 3300013296 | Bacteria | 2302 |
| 265 | Ga0157374_10790048 | 3300013296 | Bacteria | 965 |
| 266 | Ga0157374_10806501 | 3300013296 | Bacteria | 955 |
| 267 | Ga0157374_10917756 | 3300013296 | Bacteria | 894 |
| 268 | Ga0157374_10929026 | 3300013296 | Unclassified | 888 |
| 269 | Ga0157374_11198623 | 3300013296 | Unclassified | 781 |
| 270 | Ga0157374_11430260 | 3300013296 | Unclassified | 714 |
| 271 | Ga0157374_12483266 | 3300013296 | Unclassified | 546 |
| 272 | Ga0157378_10007247 | 3300013297 | Bacteria | 9682 |
| 273 | Ga0157378_10013136 | 3300013297 | Bacteria | 7247 |
| 274 | Ga0157378_10647715 | 3300013297 | Bacteria | 1072 |
| 275 | Ga0163162_10077817 | 3300013306 | Bacteria | 3381 |
| 276 | Ga0163162_10231752 | 3300013306 | Bacteria | 1977 |
| 277 | Ga0163162_10733848 | 3300013306 | Unclassified | 1108 |
| 278 | Ga0163162_10931717 | 3300013306 | Unclassified | 980 |
| 279 | Ga0157372_10000408 | 3300013307 | Bacteria | 47157 |
| 280 | Ga0157372_10002226 | 3300013307 | Bacteria | 21043 |
| 281 | Ga0157372_10003039 | 3300013307 | Bacteria | 18084 |
| 282 | Ga0157372_10003426 | 3300013307 | Bacteria | 17114 |
| 283 | Ga0157372_10021880 | 3300013307 | Bacteria | 6912 |
| 284 | Ga0157372_10025053 | 3300013307 | Bacteria | 6483 |
| 285 | Ga0157372_10041630 | 3300013307 | Bacteria | 5080 |
| 286 | Ga0157372_10047498 | 3300013307 | Bacteria | 4771 |
| 287 | Ga0157372_10100329 | 3300013307 | Bacteria | 3304 |
| 288 | Ga0157372_10102167 | 3300013307 | Bacteria | 3274 |
| 289 | Ga0157372_10386506 | 3300013307 | Bacteria | 1630 |
| 290 | Ga0157372_10393699 | 3300013307 | Bacteria | 1614 |
| 291 | Ga0157372_10485241 | 3300013307 | Bacteria | 1441 |
| 292 | Ga0157372_10704794 | 3300013307 | Bacteria | 1175 |
| 293 | Ga0157372_10914201 | 3300013307 | Bacteria | 1018 |
| 294 | Ga0157372_12904786 | 3300013307 | Unclassified | 549 |
| 295 | Ga0157375_10006678 | 3300013308 | Bacteria | 10046 |
| 296 | Ga0157375_11553062 | 3300013308 | Unclassified | 782 |
| 297 | Ga0163163_10000237 | 3300014325 | Bacteria | 56191 |
| 298 | Ga0163163_10759977 | 3300014325 | Unclassified | 1033 |
| 299 | Ga0163163_10905378 | 3300014325 | Unclassified | 945 |
| 300 | Ga0163163_11874661 | 3300014325 | Unclassified | 660 |
| 301 | Ga0157377_10140699 | 3300014745 | Bacteria | 1483 |
| 302 | Ga0157377_10368702 | 3300014745 | Unclassified | 969 |
| 303 | Ga0157379_10015308 | 3300014968 | Bacteria | 6727 |
| 304 | Ga0157379_10052254 | 3300014968 | Bacteria | 3650 |
| 305 | Ga0157379_10062672 | 3300014968 | Bacteria | 3325 |
| 306 | Ga0157379_10351789 | 3300014968 | Unclassified | 1349 |
| 307 | Ga0157379_10407930 | 3300014968 | Bacteria | 1250 |
| 308 | Ga0157379_10869796 | 3300014968 | Bacteria | 854 |
| 309 | Ga0157376_10000386 | 3300014969 | Bacteria | 28694 |
| 310 | Ga0157376_10062577 | 3300014969 | Bacteria | 3132 |
| 311 | Ga0157376_10231004 | 3300014969 | Unclassified | 1718 |
| 312 | Ga0157376_10320068 | 3300014969 | Unclassified | 1474 |
| 313 | Ga0157376_10908825 | 3300014969 | Unclassified | 899 |
| 314 | Ga0163161_10128650 | 3300017792 | Bacteria | 1908 |
| 315 | Ga0206352_10596306 | 3300020078 | Unclassified | 990 |
| 316 | Ga0206350_11537616 | 3300020080 | Bacteria | 680 |
| 317 | Ga0206353_10193638 | 3300020082 | Bacteria | 1161 |
| 318 | Ga0154015_1519660 | 3300020610 | Unclassified | 743 |
| 319 | Ga0213875_10199458 | 3300021388 | Bacteria | 941 |
| 320 | Ga0213875_10230869 | 3300021388 | Bacteria | 872 |
| 321 | Ga0228598_1109088 | 3300024227 | Unclassified | 560 |
| 322 | Ga0207656_10003780 | 3300025321 | Bacteria | 5243 |
| 323 | Ga0207656_10004677 | 3300025321 | Bacteria | 4797 |
| 324 | Ga0207710_10001408 | 3300025900 | Bacteria | 12030 |
| 325 | Ga0207680_10051850 | 3300025903 | Bacteria | 2455 |
| 326 | Ga0207680_10072280 | 3300025903 | Bacteria | 2141 |
| 327 | Ga0207647_10020414 | 3300025904 | Unclassified | 4443 |
| 328 | Ga0207647_10487376 | 3300025904 | Unclassified | 688 |
| 329 | Ga0207699_10421939 | 3300025906 | Bacteria | 953 |
| 330 | Ga0207645_10057989 | 3300025907 | Bacteria | 2472 |
| 331 | Ga0207705_10000020 | 3300025909 | Bacteria | 311745 |
| 332 | Ga0207705_10005946 | 3300025909 | Bacteria | 9077 |
| 333 | Ga0207705_10008749 | 3300025909 | Bacteria | 7376 |
| 334 | Ga0207705_10048665 | 3300025909 | Bacteria | 3050 |
| 335 | Ga0207705_10050352 | 3300025909 | Bacteria | 2998 |
| 336 | Ga0207705_10110854 | 3300025909 | Unclassified | 2027 |
| 337 | Ga0207654_10000078 | 3300025911 | Bacteria | 63974 |
| 338 | Ga0207654_10000095 | 3300025911 | Bacteria | 59415 |
| 339 | Ga0207654_10000236 | 3300025911 | Bacteria | 33775 |
| 340 | Ga0207654_10021215 | 3300025911 | Bacteria | 3452 |
| 341 | Ga0207654_10060307 | 3300025911 | Bacteria | 2216 |
| 342 | Ga0207654_10698751 | 3300025911 | Bacteria | 728 |
| 343 | Ga0207707_10020940 | 3300025912 | Bacteria | 5713 |
| 344 | Ga0207707_10143838 | 3300025912 | Bacteria | 2084 |
| 345 | Ga0207707_10662634 | 3300025912 | Bacteria | 879 |
| 346 | Ga0207707_11539939 | 3300025912 | Unclassified | 525 |
| 347 | Ga0207695_10000075 | 3300025913 | Bacteria | 308496 |
| 348 | Ga0207695_10000145 | 3300025913 | Bacteria | 209555 |
| 349 | Ga0207695_10000787 | 3300025913 | Bacteria | 59756 |
| 350 | Ga0207695_10001098 | 3300025913 | Bacteria | 47165 |
| 351 | Ga0207695_10001570 | 3300025913 | Bacteria | 37221 |
| 352 | Ga0207695_10005982 | 3300025913 | Bacteria | 15912 |
| 353 | Ga0207695_10020928 | 3300025913 | Bacteria | 7476 |
| 354 | Ga0207695_10081808 | 3300025913 | Bacteria | 3267 |
| 355 | Ga0207695_10120524 | 3300025913 | Bacteria | 2592 |
| 356 | Ga0207695_10124594 | 3300025913 | Bacteria | 2541 |
| 357 | Ga0207671_10000032 | 3300025914 | Bacteria | 245878 |
| 358 | Ga0207671_10000324 | 3300025914 | Bacteria | 70145 |
| 359 | Ga0207671_10114340 | 3300025914 | Bacteria | 2057 |
| 360 | Ga0207671_10151264 | 3300025914 | Bacteria | 1793 |
| 361 | Ga0207671_10487113 | 3300025914 | Unclassified | 983 |
| 362 | Ga0207693_11146856 | 3300025915 | Bacteria | 588 |
| 363 | Ga0207663_10770651 | 3300025916 | Unclassified | 765 |
| 364 | Ga0207660_10061047 | 3300025917 | Bacteria | 2712 |
| 365 | Ga0207657_10001924 | 3300025919 | Bacteria | 22428 |
| 366 | Ga0207657_10366494 | 3300025919 | Unclassified | 1135 |
| 367 | Ga0207657_10841480 | 3300025919 | Unclassified | 708 |
| 368 | Ga0207649_10007760 | 3300025920 | Bacteria | 5836 |
| 369 | Ga0207649_10044728 | 3300025920 | Bacteria | 2712 |
| 370 | Ga0207649_10136784 | 3300025920 | Unclassified | 1671 |
| 371 | Ga0207649_10245554 | 3300025920 | Unclassified | 1287 |
| 372 | Ga0207649_10423824 | 3300025920 | Bacteria | 1000 |
| 373 | Ga0207649_10741705 | 3300025920 | Unclassified | 764 |
| 374 | Ga0207652_10029748 | 3300025921 | Bacteria | 4570 |
| 375 | Ga0207652_10498832 | 3300025921 | Unclassified | 1096 |
| 376 | Ga0207652_10882957 | 3300025921 | Unclassified | 790 |
| 377 | Ga0207694_10000024 | 3300025924 | Bacteria | 259443 |
| 378 | Ga0207694_10000259 | 3300025924 | Bacteria | 50419 |
| 379 | Ga0207694_10004199 | 3300025924 | Bacteria | 11285 |
| 380 | Ga0207694_10005121 | 3300025924 | Bacteria | 10118 |
| 381 | Ga0207694_10038917 | 3300025924 | Bacteria | 3657 |
| 382 | Ga0207694_10152373 | 3300025924 | Bacteria | 1863 |
| 383 | Ga0207694_10538152 | 3300025924 | Unclassified | 980 |
| 384 | Ga0207694_10592570 | 3300025924 | Bacteria | 932 |
| 385 | Ga0207650_10002268 | 3300025925 | Bacteria | 13423 |
| 386 | Ga0207650_10253359 | 3300025925 | Bacteria | 1426 |
| 387 | Ga0207659_10060389 | 3300025926 | Bacteria | 2728 |
| 388 | Ga0207687_10000208 | 3300025927 | Bacteria | 39686 |
| 389 | Ga0207687_10015318 | 3300025927 | Bacteria | 5024 |
| 390 | Ga0207687_10083925 | 3300025927 | Bacteria | 2308 |
| 391 | Ga0207687_10113093 | 3300025927 | Bacteria | 2019 |
| 392 | Ga0207700_10065471 | 3300025928 | Bacteria | 2773 |
| 393 | Ga0207700_10089799 | 3300025928 | Bacteria | 2423 |
| 394 | Ga0207700_10133289 | 3300025928 | Bacteria | 2032 |
| 395 | Ga0207700_10319184 | 3300025928 | Unclassified | 1346 |
| 396 | Ga0207700_10673156 | 3300025928 | Unclassified | 923 |
| 397 | Ga0207700_10775773 | 3300025928 | Bacteria | 857 |
| 398 | Ga0207700_11643728 | 3300025928 | Bacteria | 568 |
| 399 | Ga0207664_10149234 | 3300025929 | Bacteria | 1985 |
| 400 | Ga0207664_10215984 | 3300025929 | Bacteria | 1661 |
| 401 | Ga0207664_10328096 | 3300025929 | Bacteria | 1351 |
| 402 | Ga0207664_10385618 | 3300025929 | Unclassified | 1244 |
| 403 | Ga0207644_10041760 | 3300025931 | Bacteria | 3247 |
| 404 | Ga0207690_10072881 | 3300025932 | Unclassified | 2373 |
| 405 | Ga0207690_10141739 | 3300025932 | Bacteria | 1772 |
| 406 | Ga0207706_10002070 | 3300025933 | Bacteria | 19666 |
| 407 | Ga0207686_11116609 | 3300025934 | Unclassified | 643 |
| 408 | Ga0207704_10021101 | 3300025938 | Bacteria | 3461 |
| 409 | Ga0207665_10421223 | 3300025939 | Unclassified | 1020 |
| 410 | Ga0207711_10000040 | 3300025941 | Bacteria | 162754 |
| 411 | Ga0207711_10007378 | 3300025941 | Bacteria | 9203 |
| 412 | Ga0207711_10143846 | 3300025941 | Bacteria | 2147 |
| 413 | Ga0207711_10175034 | 3300025941 | Unclassified | 1949 |
| 414 | Ga0207689_10000487 | 3300025942 | Bacteria | 37505 |
| 415 | Ga0207689_10171493 | 3300025942 | Bacteria | 1788 |
| 416 | Ga0207661_10000123 | 3300025944 | Bacteria | 49544 |
| 417 | Ga0207661_10016981 | 3300025944 | Bacteria | 5376 |
| 418 | Ga0207661_10117736 | 3300025944 | Bacteria | 2257 |
| 419 | Ga0207661_10134026 | 3300025944 | Unclassified | 2126 |
| 420 | Ga0207661_10232131 | 3300025944 | Bacteria | 1634 |
| 421 | Ga0207661_10240726 | 3300025944 | Unclassified | 1605 |
| 422 | Ga0207661_10610603 | 3300025944 | Bacteria | 1001 |
| 423 | Ga0207661_10905406 | 3300025944 | Bacteria | 812 |
| 424 | Ga0207679_10799658 | 3300025945 | Bacteria | 860 |
| 425 | Ga0207667_10000188 | 3300025949 | Bacteria | 90598 |
| 426 | Ga0207667_10000659 | 3300025949 | Bacteria | 44741 |
| 427 | Ga0207667_10009596 | 3300025949 | Bacteria | 11389 |
| 428 | Ga0207667_10015503 | 3300025949 | Bacteria | 8650 |
| 429 | Ga0207667_10022471 | 3300025949 | Bacteria | 6967 |
| 430 | Ga0207667_10051723 | 3300025949 | Bacteria | 4329 |
| 431 | Ga0207667_10070194 | 3300025949 | Bacteria | 3646 |
| 432 | Ga0207667_10258308 | 3300025949 | Bacteria | 1782 |
| 433 | Ga0207667_10261180 | 3300025949 | Bacteria | 1771 |
| 434 | Ga0207667_10402885 | 3300025949 | Bacteria | 1393 |
| 435 | Ga0207667_11107841 | 3300025949 | Unclassified | 775 |
| 436 | Ga0207651_10042316 | 3300025960 | Bacteria | 3031 |
| 437 | Ga0207712_10144166 | 3300025961 | Unclassified | 1831 |
| 438 | Ga0207712_10605126 | 3300025961 | Unclassified | 948 |
| 439 | Ga0207712_10844064 | 3300025961 | Unclassified | 807 |
| 440 | Ga0207668_10050977 | 3300025972 | Bacteria | 2856 |
| 441 | Ga0207640_10012003 | 3300025981 | Bacteria | 4923 |
| 442 | Ga0207640_10297816 | 3300025981 | Bacteria | 1275 |
| 443 | Ga0207658_10000135 | 3300025986 | Bacteria | 77651 |
| 444 | Ga0207658_10013447 | 3300025986 | Bacteria | 5590 |
| 445 | Ga0207677_10000034 | 3300026023 | Bacteria | 117922 |
| 446 | Ga0207677_10090329 | 3300026023 | Bacteria | 2225 |
| 447 | Ga0207703_10023052 | 3300026035 | Unclassified | 4888 |
| 448 | Ga0207703_10181957 | 3300026035 | Bacteria | 1855 |
| 449 | Ga0207703_10607108 | 3300026035 | Unclassified | 1035 |
| 450 | Ga0207639_10000050 | 3300026041 | Bacteria | 121432 |
| 451 | Ga0207639_10009673 | 3300026041 | Bacteria | 6660 |
| 452 | Ga0207639_10061719 | 3300026041 | Bacteria | 2896 |
| 453 | Ga0207639_10271473 | 3300026041 | Unclassified | 1488 |
| 454 | Ga0207639_10344726 | 3300026041 | Bacteria | 1329 |
| 455 | Ga0207678_10001214 | 3300026067 | Bacteria | 23694 |
| 456 | Ga0207678_10051293 | 3300026067 | Bacteria | 3562 |
| 457 | Ga0207678_10462456 | 3300026067 | Bacteria | 1104 |
| 458 | Ga0207678_10550219 | 3300026067 | Unclassified | 1009 |
| 459 | Ga0207702_10000109 | 3300026078 | Bacteria | 95381 |
| 460 | Ga0207702_10003095 | 3300026078 | Bacteria | 15424 |
| 461 | Ga0207702_10186276 | 3300026078 | Bacteria | 1914 |
| 462 | Ga0207702_10215466 | 3300026078 | Bacteria | 1787 |
| 463 | Ga0207702_10319703 | 3300026078 | Bacteria | 1478 |
| 464 | Ga0207702_10320706 | 3300026078 | Bacteria | 1475 |
| 465 | Ga0207702_10383608 | 3300026078 | Unclassified | 1352 |
| 466 | Ga0207702_10413592 | 3300026078 | Bacteria | 1303 |
| 467 | Ga0207702_10509872 | 3300026078 | Bacteria | 1173 |
| 468 | Ga0207702_10885189 | 3300026078 | Unclassified | 884 |
| 469 | Ga0207702_12041854 | 3300026078 | Unclassified | 563 |
| 470 | Ga0207641_10004397 | 3300026088 | Bacteria | 12208 |
| 471 | Ga0207641_10091516 | 3300026088 | Bacteria | 2662 |
| 472 | Ga0207648_10205244 | 3300026089 | Bacteria | 1749 |
| 473 | Ga0207676_10000316 | 3300026095 | Bacteria | 41392 |
| 474 | Ga0207674_10000815 | 3300026116 | Bacteria | 40507 |
| 475 | Ga0207674_10000968 | 3300026116 | Bacteria | 37588 |
| 476 | Ga0207674_10082621 | 3300026116 | Bacteria | 3213 |
| 477 | Ga0207674_10165399 | 3300026116 | Unclassified | 2166 |
| 478 | Ga0207683_10042955 | 3300026121 | Bacteria | 3948 |
| 479 | Ga0207698_10000129 | 3300026142 | Bacteria | 47118 |
| 480 | Ga0207698_10000393 | 3300026142 | Bacteria | 25270 |
| 481 | Ga0207698_10019288 | 3300026142 | Unclassified | 4666 |
| 482 | Ga0207698_10023255 | 3300026142 | Bacteria | 4326 |
| 483 | Ga0207698_10023960 | 3300026142 | Bacteria | 4274 |
| 484 | Ga0207698_10063497 | 3300026142 | Bacteria | 2890 |
| 485 | Ga0207698_10189601 | 3300026142 | Unclassified | 1830 |
| 486 | Ga0207698_10335910 | 3300026142 | Bacteria | 1421 |
| 487 | Ga0207698_11338344 | 3300026142 | Unclassified | 731 |
| 488 | Ga0207698_11440199 | 3300026142 | Unclassified | 704 |
| 489 | Ga0265354_1006393 | 3300028016 | Bacteria | 1171 |
| 490 | Ga0268266_10001402 | 3300028379 | Bacteria | 28793 |
| 491 | Ga0268266_10002790 | 3300028379 | Bacteria | 18209 |
| 492 | Ga0268266_10015978 | 3300028379 | Bacteria | 6420 |
| 493 | Ga0268266_10126035 | 3300028379 | Bacteria | 2285 |
| 494 | Ga0268266_10259411 | 3300028379 | Bacteria | 1610 |
| 495 | Ga0268266_10383842 | 3300028379 | Bacteria | 1325 |
| 496 | Ga0268266_11088112 | 3300028379 | Bacteria | 773 |
| 497 | Ga0268265_10087580 | 3300028380 | Unclassified | 2478 |
| 498 | Ga0268264_10000540 | 3300028381 | Bacteria | 47743 |
| 499 | Ga0268264_10038935 | 3300028381 | Bacteria | 3926 |
| 500 | Ga0265318_10005203 | 3300028577 | Bacteria | 6140 |
| 501 | Ga0265318_10028158 | 3300028577 | Unclassified | 2200 |
| 502 | Ga0265323_10045661 | 3300028653 | Bacteria | 1573 |
| 503 | Ga0265336_10000499 | 3300028666 | Bacteria | 22942 |
| 504 | Ga0265336_10008807 | 3300028666 | Bacteria | 3519 |
| 505 | Ga0265338_10000529 | 3300028800 | Bacteria | 67074 |
| 506 | Ga0265338_10011218 | 3300028800 | Bacteria | 10384 |
| 507 | Ga0265338_10039724 | 3300028800 | Unclassified | 4434 |
| 508 | Ga0265338_10084444 | 3300028800 | Bacteria | 2651 |
| 509 | Ga0265338_10102619 | 3300028800 | Bacteria | 2325 |
| 510 | Ga0265338_10108441 | 3300028800 | Bacteria | 2243 |
| 511 | Ga0265338_10121178 | 3300028800 | Unclassified | 2085 |
| 512 | Ga0265338_10253757 | 3300028800 | Bacteria | 1296 |
| 513 | Ga0265338_10306454 | 3300028800 | Unclassified | 1153 |
| 514 | Ga0265338_10317333 | 3300028800 | Unclassified | 1129 |
| 515 | Ga0265338_10525947 | 3300028800 | Bacteria | 830 |
| 516 | Ga0265338_10679159 | 3300028800 | Unclassified | 712 |
| 517 | Ga0265338_10727030 | 3300028800 | Bacteria | 684 |
| 518 | Ga0265324_10048953 | 3300029957 | Bacteria | 1453 |
| 519 | Ga0265770_1041445 | 3300030878 | Unclassified | 807 |
| 520 | Ga0265760_10038134 | 3300031090 | Bacteria | 1428 |
| 521 | Ga0265330_10000726 | 3300031235 | Bacteria | 20709 |
| 522 | Ga0265330_10001029 | 3300031235 | Bacteria | 16863 |
| 523 | Ga0265330_10006052 | 3300031235 | Bacteria | 5991 |
| 524 | Ga0265330_10057097 | 3300031235 | Bacteria | 1703 |
| 525 | Ga0265330_10079413 | 3300031235 | Bacteria | 1415 |
| 526 | Ga0265330_10091461 | 3300031235 | Unclassified | 1306 |
| 527 | Ga0265330_10182470 | 3300031235 | Bacteria | 889 |
| 528 | Ga0265328_10003631 | 3300031239 | Bacteria | 6808 |
| 529 | Ga0265328_10007337 | 3300031239 | Bacteria | 4602 |
| 530 | Ga0265328_10101610 | 3300031239 | Unclassified | 1065 |
| 531 | Ga0265328_10280140 | 3300031239 | Unclassified | 641 |
| 532 | Ga0265325_10000249 | 3300031241 | Bacteria | 38332 |
| 533 | Ga0265325_10000335 | 3300031241 | Bacteria | 33298 |
| 534 | Ga0265325_10037046 | 3300031241 | Bacteria | 2580 |
| 535 | Ga0265325_10136484 | 3300031241 | Bacteria | 1170 |
| 536 | Ga0265325_10139868 | 3300031241 | Bacteria | 1152 |
| 537 | Ga0265325_10262046 | 3300031241 | Unclassified | 780 |
| 538 | Ga0265329_10022784 | 3300031242 | Bacteria | 2091 |
| 539 | Ga0265329_10029539 | 3300031242 | Bacteria | 1790 |
| 540 | Ga0265329_10294832 | 3300031242 | Unclassified | 547 |
| 541 | Ga0265340_10009847 | 3300031247 | Bacteria | 5122 |
| 542 | Ga0265340_10017776 | 3300031247 | Bacteria | 3678 |
| 543 | Ga0265340_10137139 | 3300031247 | Unclassified | 1120 |
| 544 | Ga0265340_10301751 | 3300031247 | Unclassified | 710 |
| 545 | Ga0265339_10000183 | 3300031249 | Bacteria | 53140 |
| 546 | Ga0265339_10003154 | 3300031249 | Bacteria | 11607 |
| 547 | Ga0265339_10003965 | 3300031249 | Bacteria | 10229 |
| 548 | Ga0265339_10004030 | 3300031249 | Bacteria | 10148 |
| 549 | Ga0265339_10019838 | 3300031249 | Unclassified | 3937 |
| 550 | Ga0265339_10020874 | 3300031249 | Unclassified | 3821 |
| 551 | Ga0265339_10030191 | 3300031249 | Bacteria | 3071 |
| 552 | Ga0265339_10093982 | 3300031249 | Bacteria | 1568 |
| 553 | Ga0265339_10242787 | 3300031249 | Unclassified | 874 |
| 554 | Ga0265327_10200930 | 3300031251 | Unclassified | 903 |
| 555 | Ga0265327_10318951 | 3300031251 | Bacteria | 682 |
| 556 | Ga0265316_10001212 | 3300031344 | Bacteria | 27775 |
| 557 | Ga0265316_10001361 | 3300031344 | Bacteria | 26314 |
| 558 | Ga0265316_10007811 | 3300031344 | Bacteria | 10013 |
| 559 | Ga0265316_10011127 | 3300031344 | Bacteria | 8143 |
| 560 | Ga0265316_10012098 | 3300031344 | Bacteria | 7750 |
| 561 | Ga0265316_10035952 | 3300031344 | Bacteria | 4008 |
| 562 | Ga0265316_10043045 | 3300031344 | Bacteria | 3604 |
| 563 | Ga0265316_10062172 | 3300031344 | Bacteria | 2898 |
| 564 | Ga0265316_10117671 | 3300031344 | Bacteria | 2009 |
| 565 | Ga0265316_10129118 | 3300031344 | Bacteria | 1905 |
| 566 | Ga0265316_10288897 | 3300031344 | Bacteria | 1197 |
| 567 | Ga0265316_10398234 | 3300031344 | Bacteria | 992 |
| 568 | Ga0265316_10689119 | 3300031344 | Unclassified | 721 |
| 569 | Ga0265313_10007115 | 3300031595 | Bacteria | 7714 |
| 570 | Ga0265313_10007256 | 3300031595 | Bacteria | 7614 |
| 571 | Ga0265313_10036859 | 3300031595 | Unclassified | 2452 |
| 572 | Ga0265313_10040410 | 3300031595 | Bacteria | 2306 |
| 573 | Ga0265313_10087658 | 3300031595 | Unclassified | 1402 |
| 574 | Ga0265314_10000239 | 3300031711 | Bacteria | 80839 |
| 575 | Ga0265314_10005184 | 3300031711 | Bacteria | 11831 |
| 576 | Ga0265314_10031922 | 3300031711 | Bacteria | 3881 |
| 577 | Ga0265314_10198084 | 3300031711 | Bacteria | 1190 |
| 578 | Ga0265342_10001134 | 3300031712 | Bacteria | 25443 |
| 579 | Ga0265342_10001693 | 3300031712 | Bacteria | 20222 |
| 580 | Ga0265342_10002138 | 3300031712 | Bacteria | 17433 |
| 581 | Ga0265342_10006731 | 3300031712 | Bacteria | 8516 |
| 582 | Ga0265342_10010813 | 3300031712 | Bacteria | 6288 |
| 583 | Ga0265342_10085101 | 3300031712 | Bacteria | 1820 |
| 584 | Ga0265342_10124818 | 3300031712 | Bacteria | 1446 |
| 585 | Ga0265342_10220666 | 3300031712 | Bacteria | 1021 |
| 586 | Ga0373954_0116407 | 3300035118 | Bacteria | 1295 |
| 587 | Ga0373956_0063787 | 3300035119 | Bacteria | 1672 |
| 588 | Ga0373955_0028996 | 3300035172 | Bacteria | 2875 |
| 589 | Ga0373955_0228085 | 3300035172 | Bacteria | 1114 |
| 590 | Ga0373955_0727978 | 3300035172 | Unclassified | 609 |
| 591 | Ga0373924_0508109 | 3300035410 | Bacteria | 542 |
| 592 | Ga0373935_0389820 | 3300035692 | Bacteria | 999 |
| 593 | Ga0373933_0035547 | 3300035724 | Bacteria | 2910 |
| 594 | Ga0373937_0043808 | 3300036401 | Bacteria | 4087 |
| 595 | Ga0373937_0520558 | 3300036401 | Unclassified | 1130 |
| 596 | Ga0373937_1256123 | 3300036401 | Bacteria | 689 |
| 597 | Ga0373925_0767781 | 3300037068 | Unclassified | 795 |
| 598 | Ga0436364_0135193 | 3300037853 | Bacteria | 6544 |
| 599 | Ga0436364_0336794 | 3300037853 | Bacteria | 981 |
| 600 | Ga0436360_1290831 | 3300039438 | Unclassified | 697 |
| 601 | Ga0436362_1195660 | 3300039453 | Unclassified | 581 |
| 602 | Ga0466969_0121069 | 3300044656 | Bacteria | 1218 |
| 603 | Ga0466969_0181573 | 3300044656 | Unclassified | 963 |
| 604 | Ga0466961_0044708 | 3300044693 | Bacteria | 2834 |
| 605 | Ga0466961_0059942 | 3300044693 | Bacteria | 2420 |
| 606 | Ga0466961_0182123 | 3300044693 | Bacteria | 1304 |
| 607 | Ga0466963_0499998 | 3300044694 | Unclassified | 858 |
| 608 | Ga0466971_0135604 | 3300044719 | Bacteria | 1145 |
| 609 | Ga0466959_0238849 | 3300045049 | Bacteria | 1256 |
| 610 | Ga0466967_0023757 | 3300045976 | Bacteria | 5029 |
| 611 | Ga0466967_0770059 | 3300045976 | Bacteria | 955 |
| 612 | Ga0466967_1133987 | 3300045976 | Bacteria | 779 |
| 613 | Ga0495629_0033730 | 3300046459 | Unclassified | 3620 |
| 614 | Ga0495629_0041392 | 3300046459 | Unclassified | 3242 |
| 615 | Ga0495629_0251369 | 3300046459 | Unclassified | 1216 |
| 616 | Ga0495651_0729820 | 3300046462 | Unclassified | 616 |
| 617 | Ga0495650_0001877 | 3300046471 | Bacteria | 18730 |
| 618 | Ga0495580_0032557 | 3300046472 | Unclassified | 3762 |
| 619 | Ga0495580_0732900 | 3300046472 | Bacteria | 645 |
| 620 | Ga0495582_0609372 | 3300046473 | Bacteria | 632 |
| 621 | Ga0495639_0571303 | 3300046475 | Unclassified | 580 |
| 622 | Ga0495664_0016591 | 3300046477 | Bacteria | 4198 |
| 623 | Ga0495628_0166508 | 3300046516 | Bacteria | 1673 |
| 624 | Ga0495652_0017267 | 3300046529 | Bacteria | 6443 |
| 625 | Ga0495665_0094382 | 3300046531 | Bacteria | 1571 |
| 626 | Ga0495665_0148265 | 3300046531 | Unclassified | 1225 |
| 627 | Ga0495587_0249133 | 3300046536 | Unclassified | 999 |
| 628 | Ga0495587_0329117 | 3300046536 | Unclassified | 853 |
| 629 | Ga0495645_0000851 | 3300046543 | Bacteria | 20792 |
| 630 | Ga0495645_0004067 | 3300046543 | Bacteria | 9990 |
| 631 | Ga0495645_0233260 | 3300046543 | Bacteria | 1232 |
| 632 | Ga0495634_0793123 | 3300046642 | Unclassified | 540 |
| 633 | Ga0495625_0000377 | 3300046660 | Bacteria | 68156 |
| 634 | Ga0495635_0937244 | 3300046663 | Unclassified | 553 |
| 635 | Ga0495657_0437144 | 3300046675 | Bacteria | 767 |
| 636 | Ga0495623_0114051 | 3300046679 | Bacteria | 1634 |
| 637 | Ga0495646_0087380 | 3300046680 | Unclassified | 1807 |
| 638 | Ga0495613_0053082 | 3300046689 | Bacteria | 2984 |
| 639 | Ga0495613_0104672 | 3300046689 | Bacteria | 2043 |
| 640 | Ga0495613_0120640 | 3300046689 | Bacteria | 1883 |
| 641 | Ga0495613_0170750 | 3300046689 | Unclassified | 1543 |
| 642 | Ga0495613_0348711 | 3300046689 | Bacteria | 1017 |
| 643 | Ga0495649_0285420 | 3300046694 | Unclassified | 843 |
| 644 | Ga0495600_0035008 | 3300046809 | Unclassified | 3261 |
| 645 | Ga0495604_0023379 | 3300047317 | Bacteria | 4931 |
| 646 | Ga0495604_0425424 | 3300047317 | Unclassified | 871 |
| 647 | Ga0495674_0646254 | 3300047319 | Unclassified | 834 |
| 648 | Ga0495674_1091190 | 3300047319 | Unclassified | 608 |
| 649 | Ga0495672_0002094 | 3300047320 | Bacteria | 18701 |
| 650 | Ga0495684_0086302 | 3300047471 | Bacteria | 2379 |
| 651 | Ga0495684_0325763 | 3300047471 | Unclassified | 1097 |
| 652 | Ga0495602_0112543 | 3300048088 | Unclassified | 2209 |
| 653 | Ga0495602_0153560 | 3300048088 | Unclassified | 1806 |
| 654 | Ga0495602_0263342 | 3300048088 | Bacteria | 1278 |
| 655 | Ga0496100_0006877 | 3300048903 | Bacteria | 6230 |
| 656 | Ga0496100_0252700 | 3300048903 | Bacteria | 1304 |
| 657 | Ga0496100_1219329 | 3300048903 | Bacteria | 594 |
| 658 | Ga0496101_0040914 | 3300048904 | Bacteria | 3302 |
| 659 | Ga0496101_1273749 | 3300048904 | Unclassified | 575 |
| 660 | Ga0496102_0976511 | 3300048905 | Unclassified | 768 |
| 661 | Ga0496104_0023520 | 3300048907 | Bacteria | 5665 |
| 662 | Ga0496104_0800032 | 3300048907 | Unclassified | 849 |
| 663 | Ga0496105_0024502 | 3300048908 | Unclassified | 4903 |
| 664 | Ga0496105_0033315 | 3300048908 | Bacteria | 4229 |
| 665 | Ga0496105_0313877 | 3300048908 | Bacteria | 1258 |
| 666 | Ga0496107_0015330 | 3300048910 | Bacteria | 5370 |
| 667 | Ga0496107_0055383 | 3300048910 | Unclassified | 2864 |
| 668 | Ga0496110_0234798 | 3300048913 | Bacteria | 1668 |
| 669 | Ga0496114_0052128 | 3300048917 | Bacteria | 3408 |
| 670 | Ga0496114_0296303 | 3300048917 | Bacteria | 1428 |
| 671 | Ga0496115_0040424 | 3300048918 | Unclassified | 3707 |
| 672 | Ga0496115_0154171 | 3300048918 | Unclassified | 1897 |
| 673 | Ga0496115_0269720 | 3300048918 | Bacteria | 1398 |
| 674 | Ga0496115_0355317 | 3300048918 | Unclassified | 1195 |
| 675 | Ga0496115_0553145 | 3300048918 | Unclassified | 919 |
| 676 | Ga0496126_0000010 | 3300048929 | Bacteria | 744888 |
| 677 | Ga0496126_0340037 | 3300048929 | Bacteria | 1230 |
| 678 | Ga0495682_0263267 | 3300049460 | Unclassified | 609 |
| 679 | Ga0495601_0253612 | 3300053077 | Unclassified | 1149 |
| 680 | Ga0500644_0030343 | 3300053088 | Bacteria | 1709 |
| 681 | Ga0500554_284451 | 3300053102 | Unclassified | 538 |
| 682 | Ga0500595_032198 | 3300053119 | Bacteria | 1752 |
| 683 | Ga0500661_000441 | 3300055283 | Bacteria | 7693 |
| 684 | Ga0587084_028037 | 3300059477 | Unclassified | 889 |
| 685 | Ga0587077_108308 | 3300059493 | Unclassified | 677 |
| 686 | Ga0587086_040316 | 3300059507 | Unclassified | 721 |
| 687 | Ga0587088_049105 | 3300059508 | Unclassified | 821 |
| 688 | Ga0587090_123390 | 3300059510 | Unclassified | 564 |
| 689 | Ga0587092_014861 | 3300059512 | Bacteria | 1133 |
| 690 | Ga0587101_019722 | 3300059623 | Unclassified | 958 |
| 691 | Ga0587109_033136 | 3300059624 | Unclassified | 991 |
| 692 | Ga0587117_017967 | 3300059627 | Unclassified | 957 |
| 693 | Ga0587127_005862 | 3300059629 | Bacteria | 855 |
| 694 | Ga0587068_024958 | 3300059641 | Unclassified | 1004 |
| 695 | Ga0587069_032617 | 3300059642 | Unclassified | 850 |
| 696 | Ga0587072_185709 | 3300059643 | Unclassified | 521 |
| 697 | Ga0587075_044164 | 3300059644 | Unclassified | 757 |
| 698 | Ga0587119_020379 | 3300059658 | Bacteria | 842 |
| 699 | Ga0587124_018382 | 3300059660 | Unclassified | 696 |
| 700 | Ga0587111_0069032 | 3300060346 | Unclassified | 821 |
| 701 | Ga0070661_101424695 | |||
| 702 | rootH2_10042999 | |||
| 703 | rootH2_10066083 | |||
| 704 | rootH2_10066096 | |||
| 705 | rootH1_10187309 | |||
| 706 | Ga0065715_10375777 | |||
| 707 | Ga0070658_10000142 | |||
| 708 | Ga0070658_10005408 | |||
| 709 | Ga0070658_10006481 | |||
| 710 | Ga0070658_10010431 | |||
| 711 | Ga0070658_10011101 | |||
| 712 | Ga0070658_10273427 | |||
| 713 | Ga0070658_11239601 | |||
| 714 | Ga0070676_10013742 | |||
| 715 | Ga0070683_100001294 | |||
| 716 | Ga0070683_100026956 | |||
| 717 | Ga0070683_100150487 | |||
| 718 | Ga0070683_100214984 | |||
| 719 | Ga0070683_100581527 | |||
| 720 | Ga0070683_100658668 | |||
| 721 | Ga0070690_100277073 | |||
| 722 | Ga0070670_100002947 | |||
| 723 | Ga0070670_100063184 | |||
| 724 | Ga0068869_100001913 | |||
| 725 | Ga0068869_100281621 | |||
| 726 | Ga0070666_10062598 | |||
| 727 | Ga0070666_10306518 | |||
| 728 | Ga0070680_100081136 | |||
| 729 | Ga0070680_100162693 | |||
| 730 | Ga0070680_100620016 | |||
| 731 | Ga0068868_100000009 | |||
| 732 | Ga0068868_100015740 | |||
| 733 | Ga0068868_100022926 | |||
| 734 | Ga0070660_100000311 | |||
| 735 | Ga0070660_100067433 | |||
| 736 | Ga0070660_100135327 | |||
| 737 | Ga0070660_100409213 | |||
| 738 | Ga0070660_101435628 | |||
| 739 | Ga0070661_100021911 | |||
| 740 | Ga0070661_100136155 | |||
| 741 | Ga0070661_100165020 | |||
| 742 | Ga0070661_100274925 | |||
| 743 | Ga0070661_100490448 | |||
| 744 | Ga0070692_10543707 | |||
| 745 | Ga0070668_100084709 | |||
| 746 | Ga0070675_100034487 | |||
| 747 | Ga0070671_100022721 | |||
| 748 | Ga0070671_100154151 | |||
| 749 | Ga0070671_100887489 | |||
| 750 | Ga0070673_100010611 | |||
| 751 | Ga0070659_100172730 | |||
| 752 | Ga0070659_100181963 | |||
| 753 | Ga0070667_100001882 | |||
| 754 | Ga0070667_100012140 | |||
| 755 | Ga0070709_10858029 | |||
| 756 | Ga0070709_11236034 | |||
| 757 | Ga0070714_100017303 | |||
| 758 | Ga0070714_100168901 | |||
| 759 | Ga0070714_100209289 | |||
| 760 | Ga0070714_101293480 | |||
| 761 | Ga0070714_102487064 | |||
| 762 | Ga0070713_100003713 | |||
| 763 | Ga0070713_100108311 | |||
| 764 | Ga0070713_100190228 | |||
| 765 | Ga0070713_100235136 | |||
| 766 | Ga0070713_100256280 | |||
| 767 | Ga0070713_100332734 | |||
| 768 | Ga0070713_100978151 | |||
| 769 | Ga0070713_101211836 | |||
| 770 | Ga0070711_100221272 | |||
| 771 | Ga0070711_100947947 | |||
| 772 | Ga0070711_100979344 | |||
| 773 | Ga0070663_100056019 | |||
| 774 | Ga0070663_100188084 | |||
| 775 | Ga0070663_100382837 | |||
| 776 | Ga0070663_100489032 | |||
| 777 | Ga0070663_100494166 | |||
| 778 | Ga0070678_100062022 | |||
| 779 | Ga0070662_100010729 | |||
| 780 | Ga0070681_10000804 | |||
| 781 | Ga0070681_10046056 | |||
| 782 | Ga0070681_10387789 | |||
| 783 | Ga0068867_100203700 | |||
| 784 | Ga0068867_100525045 | |||
| 785 | Ga0070685_11361589 | |||
| 786 | Ga0070679_100000226 | |||
| 787 | Ga0070679_100044742 | |||
| 788 | Ga0070679_100607471 | |||
| 789 | Ga0070684_100025564 | |||
| 790 | Ga0070684_100078675 | |||
| 791 | Ga0070684_100111897 | |||
| 792 | Ga0070684_100216012 | |||
| 793 | Ga0070684_100347897 | |||
| 794 | Ga0070684_100446949 | |||
| 795 | Ga0070684_100502105 | |||
| 796 | Ga0068853_100000914 | |||
| 797 | Ga0068853_100034028 | |||
| 798 | Ga0068853_100037459 | |||
| 799 | Ga0068853_100042984 | |||
| 800 | Ga0070665_100024182 | |||
| 801 | Ga0070665_100030820 | |||
| 802 | Ga0070665_100069665 | |||
| 803 | Ga0070665_100104651 | |||
| 804 | Ga0070665_100169901 | |||
| 805 | Ga0070665_100326624 | |||
| 806 | Ga0068855_100003316 | |||
| 807 | Ga0068855_100007673 | |||
| 808 | Ga0068855_100015507 | |||
| 809 | Ga0068855_100028667 | |||
| 810 | Ga0068855_100032512 | |||
| 811 | Ga0068855_100045317 | |||
| 812 | Ga0068855_100074105 | |||
| 813 | Ga0068855_100322461 | |||
| 814 | Ga0068855_101603030 | |||
| 815 | Ga0070664_100171960 | |||
| 816 | Ga0068857_100000181 | |||
| 817 | Ga0068857_100000269 | |||
| 818 | Ga0068857_100014310 | |||
| 819 | Ga0068857_100054215 | |||
| 820 | Ga0068857_100055906 | |||
| 821 | Ga0068857_100833861 | |||
| 822 | Ga0068857_100972750 | |||
| 823 | Ga0068854_100003621 | |||
| 824 | Ga0068854_100030603 | |||
| 825 | Ga0068854_100596284 | |||
| 826 | Ga0068856_100000809 | |||
| 827 | Ga0068856_100015932 | |||
| 828 | Ga0068856_100017479 | |||
| 829 | Ga0068856_100028898 | |||
| 830 | Ga0068856_100076409 | |||
| 831 | Ga0068856_100087860 | |||
| 832 | Ga0068856_100129642 | |||
| 833 | Ga0068856_100215543 | |||
| 834 | Ga0068856_100241622 | |||
| 835 | Ga0068856_100446206 | |||
| 836 | Ga0068856_100481900 | |||
| 837 | Ga0068856_100868069 | |||
| 838 | Ga0068856_101224217 | |||
| 839 | Ga0068856_101272533 | |||
| 840 | Ga0068856_101713317 | |||
| 841 | Ga0068852_100000199 | |||
| 842 | Ga0068852_100000887 | |||
| 843 | Ga0068852_100001654 | |||
| 844 | Ga0068852_100027066 | |||
| 845 | Ga0068852_100044386 | |||
| 846 | Ga0068852_100097933 | |||
| 847 | Ga0068852_100147539 | |||
| 848 | Ga0068852_100203299 | |||
| 849 | Ga0068852_100400092 | |||
| 850 | Ga0068852_100419216 | |||
| 851 | Ga0068852_100549498 | |||
| 852 | Ga0068859_100002712 | |||
| 853 | Ga0068859_100184430 | |||
| 854 | Ga0068864_100003465 | |||
| 855 | Ga0068864_100410702 | |||
| 856 | Ga0068861_100428645 | |||
| 857 | Ga0068851_10012603 | |||
| 858 | Ga0068851_10026100 | |||
| 859 | Ga0068851_10048580 | |||
| 860 | Ga0068851_10149862 | |||
| 861 | Ga0068863_100000273 | |||
| 862 | Ga0068863_100019580 | |||
| 863 | Ga0068858_100026536 | |||
| 864 | Ga0068858_100058900 | |||
| 865 | Ga0068858_100683606 | |||
| 866 | Ga0068858_101913027 | |||
| 867 | Ga0068860_100000031 | |||
| 868 | Ga0068862_100112116 | |||
| 869 | Ga0070717_10000898 | |||
| 870 | Ga0070717_10576571 | |||
| 871 | Ga0070717_10926923 | |||
| 872 | Ga0070717_11022179 | |||
| 873 | Ga0097621_100005630 | |||
| 874 | Ga0097621_100007467 | |||
| 875 | Ga0097621_101937389 | |||
| 876 | Ga0097621_101977481 | |||
| 877 | Ga0068871_100002198 | |||
| 878 | Ga0068865_100044913 | |||
| 879 | Ga0097620_100002712 | |||
| 880 | Ga0097620_100184430 | |||
| 881 | Ga0099794_10778805 | |||
| 882 | Ga0105240_10000451 | |||
| 883 | Ga0105240_10001070 | |||
| 884 | Ga0105240_10002552 | |||
| 885 | Ga0105240_10002933 | |||
| 886 | Ga0105240_10003422 | |||
| 887 | Ga0105240_10068958 | |||
| 888 | Ga0105240_10092329 | |||
| 889 | Ga0105240_10956117 | |||
| 890 | Ga0105240_11043451 | |||
| 891 | Ga0105240_11097967 | |||
| 892 | Ga0105240_11610709 | |||
| 893 | Ga0105240_12317437 | |||
| 894 | Ga0105245_10003181 | |||
| 895 | Ga0105245_10273907 | |||
| 896 | Ga0105245_10318564 | |||
| 897 | Ga0105247_10003136 | |||
| 898 | Ga0105247_10037922 | |||
| 899 | Ga0105247_10423707 | |||
| 900 | Ga0105247_10600420 | |||
| 901 | Ga0105247_11503282 | |||
| 902 | Ga0105241_10000123 | |||
| 903 | Ga0105241_10019959 | |||
| 904 | Ga0105241_10098299 | |||
| 905 | Ga0105241_10274294 | |||
| 906 | Ga0105241_10292523 | |||
| 907 | Ga0105242_10795250 | |||
| 908 | Ga0105248_10000047 | |||
| 909 | Ga0105248_10001233 | |||
| 910 | Ga0105248_10187362 | |||
| 911 | Ga0105237_10035217 | |||
| 912 | Ga0105237_10048761 | |||
| 913 | Ga0105237_10588877 | |||
| 914 | Ga0105237_11062054 | |||
| 915 | Ga0105238_10000334 | |||
| 916 | Ga0105238_10011830 | |||
| 917 | Ga0105238_10021179 | |||
| 918 | Ga0105238_10027432 | |||
| 919 | Ga0105238_10041018 | |||
| 920 | Ga0105238_10212015 | |||
| 921 | Ga0105238_10532705 | |||
| 922 | Ga0105238_11869161 | |||
| 923 | Ga0105238_12220059 | |||
| 924 | Ga0105249_10037654 | |||
| 925 | Ga0105249_10397884 | |||
| 926 | Ga0105249_11746262 | |||
| 927 | Ga0105239_10001864 | |||
| 928 | Ga0105239_10014176 | |||
| 929 | Ga0105239_10118191 | |||
| 930 | Ga0105239_10163775 | |||
| 931 | Ga0105239_10975988 | |||
| 932 | Ga0105239_11491450 | |||
| 933 | Ga0105239_11611946 | |||
| 934 | Ga0105239_11937895 | |||
| 935 | Ga0105246_10001815 | |||
| 936 | Ga0157373_10547909 | |||
| 937 | Ga0157371_10215085 | |||
| 938 | Ga0157371_10226122 | |||
| 939 | Ga0157371_10643964 | |||
| 940 | Ga0157371_11537311 | |||
| 941 | Ga0157370_10000542 | |||
| 942 | Ga0157370_10010623 | |||
| 943 | Ga0157370_10020842 | |||
| 944 | Ga0157370_10035992 | |||
| 945 | Ga0157370_10041906 | |||
| 946 | Ga0157370_10077967 | |||
| 947 | Ga0157370_10211653 | |||
| 948 | Ga0157369_10001280 | |||
| 949 | Ga0157369_10002372 | |||
| 950 | Ga0157369_10002679 | |||
| 951 | Ga0157369_10032494 | |||
| 952 | Ga0157369_10046264 | |||
| 953 | Ga0157369_10054341 | |||
| 954 | Ga0157369_10055887 | |||
| 955 | Ga0157369_10077934 | |||
| 956 | Ga0157369_10081995 | |||
| 957 | Ga0157369_10171211 | |||
| 958 | Ga0157369_10213948 | |||
| 959 | Ga0157369_10364961 | |||
| 960 | Ga0157369_10419336 | |||
| 961 | Ga0157369_10459021 | |||
| 962 | Ga0157374_10002229 | |||
| 963 | Ga0157374_10014906 | |||
| 964 | Ga0157374_10145427 | |||
| 965 | Ga0157374_10790048 | |||
| 966 | Ga0157374_10806501 | |||
| 967 | Ga0157374_10917756 | |||
| 968 | Ga0157374_10929026 | |||
| 969 | Ga0157374_11198623 | |||
| 970 | Ga0157374_11430260 | |||
| 971 | Ga0157374_12483266 | |||
| 972 | Ga0157378_10007247 | |||
| 973 | Ga0157378_10013136 | |||
| 974 | Ga0157378_10647715 | |||
| 975 | Ga0163162_10077817 | |||
| 976 | Ga0163162_10231752 | |||
| 977 | Ga0163162_10733848 | |||
| 978 | Ga0163162_10931717 | |||
| 979 | Ga0157372_10000408 | |||
| 980 | Ga0157372_10002226 | |||
| 981 | Ga0157372_10003039 | |||
| 982 | Ga0157372_10003426 | |||
| 983 | Ga0157372_10021880 | |||
| 984 | Ga0157372_10025053 | |||
| 985 | Ga0157372_10041630 | |||
| 986 | Ga0157372_10047498 | |||
| 987 | Ga0157372_10100329 | |||
| 988 | Ga0157372_10102167 | |||
| 989 | Ga0157372_10386506 | |||
| 990 | Ga0157372_10393699 | |||
| 991 | Ga0157372_10485241 | |||
| 992 | Ga0157372_10704794 | |||
| 993 | Ga0157372_10914201 | |||
| 994 | Ga0157372_12904786 | |||
| 995 | Ga0157375_10006678 | |||
| 996 | Ga0157375_11553062 | |||
| 997 | Ga0163163_10000237 | |||
| 998 | Ga0163163_10759977 | |||
| 999 | Ga0163163_10905378 | |||
| 1000 | Ga0163163_11874661 | |||
| 1001 | Ga0157377_10140699 | |||
| 1002 | Ga0157377_10368702 | |||
| 1003 | Ga0157379_10015308 | |||
| 1004 | Ga0157379_10052254 | |||
| 1005 | Ga0157379_10062672 | |||
| 1006 | Ga0157379_10351789 | |||
| 1007 | Ga0157379_10407930 | |||
| 1008 | Ga0157379_10869796 | |||
| 1009 | Ga0157376_10000386 | |||
| 1010 | Ga0157376_10062577 | |||
| 1011 | Ga0157376_10231004 | |||
| 1012 | Ga0157376_10320068 | |||
| 1013 | Ga0157376_10908825 | |||
| 1014 | Ga0163161_10128650 | |||
| 1015 | Ga0206352_10596306 | |||
| 1016 | Ga0206350_11537616 | |||
| 1017 | Ga0206353_10193638 | |||
| 1018 | Ga0154015_1519660 | |||
| 1019 | Ga0213875_10199458 | |||
| 1020 | Ga0213875_10230869 | |||
| 1021 | Ga0228598_1109088 | |||
| 1022 | Ga0207656_10003780 | |||
| 1023 | Ga0207656_10004677 | |||
| 1024 | Ga0207710_10001408 | |||
| 1025 | Ga0207680_10051850 | |||
| 1026 | Ga0207680_10072280 | |||
| 1027 | Ga0207647_10020414 | |||
| 1028 | Ga0207647_10487376 | |||
| 1029 | Ga0207699_10421939 | |||
| 1030 | Ga0207645_10057989 | |||
| 1031 | Ga0207705_10000020 | |||
| 1032 | Ga0207705_10005946 | |||
| 1033 | Ga0207705_10008749 | |||
| 1034 | Ga0207705_10048665 | |||
| 1035 | Ga0207705_10050352 | |||
| 1036 | Ga0207705_10110854 | |||
| 1037 | Ga0207654_10000078 | |||
| 1038 | Ga0207654_10000095 | |||
| 1039 | Ga0207654_10000236 | |||
| 1040 | Ga0207654_10021215 | |||
| 1041 | Ga0207654_10060307 | |||
| 1042 | Ga0207654_10698751 | |||
| 1043 | Ga0207707_10020940 | |||
| 1044 | Ga0207707_10143838 | |||
| 1045 | Ga0207707_10662634 | |||
| 1046 | Ga0207707_11539939 | |||
| 1047 | Ga0207695_10000075 | |||
| 1048 | Ga0207695_10000145 | |||
| 1049 | Ga0207695_10000787 | |||
| 1050 | Ga0207695_10001098 | |||
| 1051 | Ga0207695_10001570 | |||
| 1052 | Ga0207695_10005982 | |||
| 1053 | Ga0207695_10020928 | |||
| 1054 | Ga0207695_10081808 | |||
| 1055 | Ga0207695_10120524 | |||
| 1056 | Ga0207695_10124594 | |||
| 1057 | Ga0207671_10000032 | |||
| 1058 | Ga0207671_10000324 | |||
| 1059 | Ga0207671_10114340 | |||
| 1060 | Ga0207671_10151264 | |||
| 1061 | Ga0207671_10487113 | |||
| 1062 | Ga0207693_11146856 | |||
| 1063 | Ga0207663_10770651 | |||
| 1064 | Ga0207660_10061047 | |||
| 1065 | Ga0207657_10001924 | |||
| 1066 | Ga0207657_10366494 | |||
| 1067 | Ga0207657_10841480 | |||
| 1068 | Ga0207649_10007760 | |||
| 1069 | Ga0207649_10044728 | |||
| 1070 | Ga0207649_10136784 | |||
| 1071 | Ga0207649_10245554 | |||
| 1072 | Ga0207649_10423824 | |||
| 1073 | Ga0207649_10741705 | |||
| 1074 | Ga0207652_10029748 | |||
| 1075 | Ga0207652_10498832 | |||
| 1076 | Ga0207652_10882957 | |||
| 1077 | Ga0207694_10000024 | |||
| 1078 | Ga0207694_10000259 | |||
| 1079 | Ga0207694_10004199 | |||
| 1080 | Ga0207694_10005121 | |||
| 1081 | Ga0207694_10038917 | |||
| 1082 | Ga0207694_10152373 | |||
| 1083 | Ga0207694_10538152 | |||
| 1084 | Ga0207694_10592570 | |||
| 1085 | Ga0207650_10002268 | |||
| 1086 | Ga0207650_10253359 | |||
| 1087 | Ga0207659_10060389 | |||
| 1088 | Ga0207687_10000208 | |||
| 1089 | Ga0207687_10015318 | |||
| 1090 | Ga0207687_10083925 | |||
| 1091 | Ga0207687_10113093 | |||
| 1092 | Ga0207700_10065471 | |||
| 1093 | Ga0207700_10089799 | |||
| 1094 | Ga0207700_10133289 | |||
| 1095 | Ga0207700_10319184 | |||
| 1096 | Ga0207700_10673156 | |||
| 1097 | Ga0207700_10775773 | |||
| 1098 | Ga0207700_11643728 | |||
| 1099 | Ga0207664_10149234 | |||
| 1100 | Ga0207664_10215984 | |||
| 1101 | Ga0207664_10328096 | |||
| 1102 | Ga0207664_10385618 | |||
| 1103 | Ga0207644_10041760 | |||
| 1104 | Ga0207690_10072881 | |||
| 1105 | Ga0207690_10141739 | |||
| 1106 | Ga0207706_10002070 | |||
| 1107 | Ga0207686_11116609 | |||
| 1108 | Ga0207704_10021101 | |||
| 1109 | Ga0207665_10421223 | |||
| 1110 | Ga0207711_10000040 | |||
| 1111 | Ga0207711_10007378 | |||
| 1112 | Ga0207711_10143846 | |||
| 1113 | Ga0207711_10175034 | |||
| 1114 | Ga0207689_10000487 | |||
| 1115 | Ga0207689_10171493 | |||
| 1116 | Ga0207661_10000123 | |||
| 1117 | Ga0207661_10016981 | |||
| 1118 | Ga0207661_10117736 | |||
| 1119 | Ga0207661_10134026 | |||
| 1120 | Ga0207661_10232131 | |||
| 1121 | Ga0207661_10240726 | |||
| 1122 | Ga0207661_10610603 | |||
| 1123 | Ga0207661_10905406 | |||
| 1124 | Ga0207679_10799658 | |||
| 1125 | Ga0207667_10000188 | |||
| 1126 | Ga0207667_10000659 | |||
| 1127 | Ga0207667_10009596 | |||
| 1128 | Ga0207667_10015503 | |||
| 1129 | Ga0207667_10022471 | |||
| 1130 | Ga0207667_10051723 | |||
| 1131 | Ga0207667_10070194 | |||
| 1132 | Ga0207667_10258308 | |||
| 1133 | Ga0207667_10261180 | |||
| 1134 | Ga0207667_10402885 | |||
| 1135 | Ga0207667_11107841 | |||
| 1136 | Ga0207651_10042316 | |||
| 1137 | Ga0207712_10144166 | |||
| 1138 | Ga0207712_10605126 | |||
| 1139 | Ga0207712_10844064 | |||
| 1140 | Ga0207668_10050977 | |||
| 1141 | Ga0207640_10012003 | |||
| 1142 | Ga0207640_10297816 | |||
| 1143 | Ga0207658_10000135 | |||
| 1144 | Ga0207658_10013447 | |||
| 1145 | Ga0207677_10000034 | |||
| 1146 | Ga0207677_10090329 | |||
| 1147 | Ga0207703_10023052 | |||
| 1148 | Ga0207703_10181957 | |||
| 1149 | Ga0207703_10607108 | |||
| 1150 | Ga0207639_10000050 | |||
| 1151 | Ga0207639_10009673 | |||
| 1152 | Ga0207639_10061719 | |||
| 1153 | Ga0207639_10271473 | |||
| 1154 | Ga0207639_10344726 | |||
| 1155 | Ga0207678_10001214 | |||
| 1156 | Ga0207678_10051293 | |||
| 1157 | Ga0207678_10462456 | |||
| 1158 | Ga0207678_10550219 | |||
| 1159 | Ga0207702_10000109 | |||
| 1160 | Ga0207702_10003095 | |||
| 1161 | Ga0207702_10186276 | |||
| 1162 | Ga0207702_10215466 | |||
| 1163 | Ga0207702_10319703 | |||
| 1164 | Ga0207702_10320706 | |||
| 1165 | Ga0207702_10383608 | |||
| 1166 | Ga0207702_10413592 | |||
| 1167 | Ga0207702_10509872 | |||
| 1168 | Ga0207702_10885189 | |||
| 1169 | Ga0207702_12041854 | |||
| 1170 | Ga0207641_10004397 | |||
| 1171 | Ga0207641_10091516 | |||
| 1172 | Ga0207648_10205244 | |||
| 1173 | Ga0207676_10000316 | |||
| 1174 | Ga0207674_10000815 | |||
| 1175 | Ga0207674_10000968 | |||
| 1176 | Ga0207674_10082621 | |||
| 1177 | Ga0207674_10165399 | |||
| 1178 | Ga0207683_10042955 | |||
| 1179 | Ga0207698_10000129 | |||
| 1180 | Ga0207698_10000393 | |||
| 1181 | Ga0207698_10019288 | |||
| 1182 | Ga0207698_10023255 | |||
| 1183 | Ga0207698_10023960 | |||
| 1184 | Ga0207698_10063497 | |||
| 1185 | Ga0207698_10189601 | |||
| 1186 | Ga0207698_10335910 | |||
| 1187 | Ga0207698_11338344 | |||
| 1188 | Ga0207698_11440199 | |||
| 1189 | Ga0265354_1006393 | |||
| 1190 | Ga0268266_10001402 | |||
| 1191 | Ga0268266_10002790 | |||
| 1192 | Ga0268266_10015978 | |||
| 1193 | Ga0268266_10126035 | |||
| 1194 | Ga0268266_10259411 | |||
| 1195 | Ga0268266_10383842 | |||
| 1196 | Ga0268266_11088112 | |||
| 1197 | Ga0268265_10087580 | |||
| 1198 | Ga0268264_10000540 | |||
| 1199 | Ga0268264_10038935 | |||
| 1200 | Ga0265318_10005203 | |||
| 1201 | Ga0265318_10028158 | |||
| 1202 | Ga0265323_10045661 | |||
| 1203 | Ga0265336_10000499 | |||
| 1204 | Ga0265336_10008807 | |||
| 1205 | Ga0265338_10000529 | |||
| 1206 | Ga0265338_10011218 | |||
| 1207 | Ga0265338_10039724 | |||
| 1208 | Ga0265338_10084444 | |||
| 1209 | Ga0265338_10102619 | |||
| 1210 | Ga0265338_10108441 | |||
| 1211 | Ga0265338_10121178 | |||
| 1212 | Ga0265338_10253757 | |||
| 1213 | Ga0265338_10306454 | |||
| 1214 | Ga0265338_10317333 | |||
| 1215 | Ga0265338_10525947 | |||
| 1216 | Ga0265338_10679159 | |||
| 1217 | Ga0265338_10727030 | |||
| 1218 | Ga0265324_10048953 | |||
| 1219 | Ga0265770_1041445 | |||
| 1220 | Ga0265760_10038134 | |||
| 1221 | Ga0265330_10000726 | |||
| 1222 | Ga0265330_10001029 | |||
| 1223 | Ga0265330_10006052 | |||
| 1224 | Ga0265330_10057097 | |||
| 1225 | Ga0265330_10079413 | |||
| 1226 | Ga0265330_10091461 | |||
| 1227 | Ga0265330_10182470 | |||
| 1228 | Ga0265328_10003631 | |||
| 1229 | Ga0265328_10007337 | |||
| 1230 | Ga0265328_10101610 | |||
| 1231 | Ga0265328_10280140 | |||
| 1232 | Ga0265325_10000249 | |||
| 1233 | Ga0265325_10000335 | |||
| 1234 | Ga0265325_10037046 | |||
| 1235 | Ga0265325_10136484 | |||
| 1236 | Ga0265325_10139868 | |||
| 1237 | Ga0265325_10262046 | |||
| 1238 | Ga0265329_10022784 | |||
| 1239 | Ga0265329_10029539 | |||
| 1240 | Ga0265329_10294832 | |||
| 1241 | Ga0265340_10009847 | |||
| 1242 | Ga0265340_10017776 | |||
| 1243 | Ga0265340_10137139 | |||
| 1244 | Ga0265340_10301751 | |||
| 1245 | Ga0265339_10000183 | |||
| 1246 | Ga0265339_10003154 | |||
| 1247 | Ga0265339_10003965 | |||
| 1248 | Ga0265339_10004030 | |||
| 1249 | Ga0265339_10019838 | |||
| 1250 | Ga0265339_10020874 | |||
| 1251 | Ga0265339_10030191 | |||
| 1252 | Ga0265339_10093982 | |||
| 1253 | Ga0265339_10242787 | |||
| 1254 | Ga0265327_10200930 | |||
| 1255 | Ga0265327_10318951 | |||
| 1256 | Ga0265316_10001212 | |||
| 1257 | Ga0265316_10001361 | |||
| 1258 | Ga0265316_10007811 | |||
| 1259 | Ga0265316_10011127 | |||
| 1260 | Ga0265316_10012098 | |||
| 1261 | Ga0265316_10035952 | |||
| 1262 | Ga0265316_10043045 | |||
| 1263 | Ga0265316_10062172 | |||
| 1264 | Ga0265316_10117671 | |||
| 1265 | Ga0265316_10129118 | |||
| 1266 | Ga0265316_10288897 | |||
| 1267 | Ga0265316_10398234 | |||
| 1268 | Ga0265316_10689119 | |||
| 1269 | Ga0265313_10007115 | |||
| 1270 | Ga0265313_10007256 | |||
| 1271 | Ga0265313_10036859 | |||
| 1272 | Ga0265313_10040410 | |||
| 1273 | Ga0265313_10087658 | |||
| 1274 | Ga0265314_10000239 | |||
| 1275 | Ga0265314_10005184 | |||
| 1276 | Ga0265314_10031922 | |||
| 1277 | Ga0265314_10198084 | |||
| 1278 | Ga0265342_10001134 | |||
| 1279 | Ga0265342_10001693 | |||
| 1280 | Ga0265342_10002138 | |||
| 1281 | Ga0265342_10006731 | |||
| 1282 | Ga0265342_10010813 | |||
| 1283 | Ga0265342_10085101 | |||
| 1284 | Ga0265342_10124818 | |||
| 1285 | Ga0265342_10220666 | |||
| 1286 | Ga0373954_0116407 | |||
| 1287 | Ga0373956_0063787 | |||
| 1288 | Ga0373955_0028996 | |||
| 1289 | Ga0373955_0228085 | |||
| 1290 | Ga0373955_0727978 | |||
| 1291 | Ga0373924_0508109 | |||
| 1292 | Ga0373935_0389820 | |||
| 1293 | Ga0373933_0035547 | |||
| 1294 | Ga0373937_0043808 | |||
| 1295 | Ga0373937_0520558 | |||
| 1296 | Ga0373937_1256123 | |||
| 1297 | Ga0373925_0767781 | |||
| 1298 | Ga0436364_0135193 | |||
| 1299 | Ga0436364_0336794 | |||
| 1300 | Ga0436360_1290831 | |||
| 1301 | Ga0436362_1195660 | |||
| 1302 | Ga0466969_0121069 | |||
| 1303 | Ga0466969_0181573 | |||
| 1304 | Ga0466961_0044708 | |||
| 1305 | Ga0466961_0059942 | |||
| 1306 | Ga0466961_0182123 | |||
| 1307 | Ga0466963_0499998 | |||
| 1308 | Ga0466971_0135604 | |||
| 1309 | Ga0466959_0238849 | |||
| 1310 | Ga0466967_0023757 | |||
| 1311 | Ga0466967_0770059 | |||
| 1312 | Ga0466967_1133987 | |||
| 1313 | Ga0495629_0033730 | |||
| 1314 | Ga0495629_0041392 | |||
| 1315 | Ga0495629_0251369 | |||
| 1316 | Ga0495651_0729820 | |||
| 1317 | Ga0495650_0001877 | |||
| 1318 | Ga0495580_0032557 | |||
| 1319 | Ga0495580_0732900 | |||
| 1320 | Ga0495582_0609372 | |||
| 1321 | Ga0495639_0571303 | |||
| 1322 | Ga0495664_0016591 | |||
| 1323 | Ga0495628_0166508 | |||
| 1324 | Ga0495652_0017267 | |||
| 1325 | Ga0495665_0094382 | |||
| 1326 | Ga0495665_0148265 | |||
| 1327 | Ga0495587_0249133 | |||
| 1328 | Ga0495587_0329117 | |||
| 1329 | Ga0495645_0000851 | |||
| 1330 | Ga0495645_0004067 | |||
| 1331 | Ga0495645_0233260 | |||
| 1332 | Ga0495634_0793123 | |||
| 1333 | Ga0495625_0000377 | |||
| 1334 | Ga0495635_0937244 | |||
| 1335 | Ga0495657_0437144 | |||
| 1336 | Ga0495623_0114051 | |||
| 1337 | Ga0495646_0087380 | |||
| 1338 | Ga0495613_0053082 | |||
| 1339 | Ga0495613_0104672 | |||
| 1340 | Ga0495613_0120640 | |||
| 1341 | Ga0495613_0170750 | |||
| 1342 | Ga0495613_0348711 | |||
| 1343 | Ga0495649_0285420 | |||
| 1344 | Ga0495600_0035008 | |||
| 1345 | Ga0495604_0023379 | |||
| 1346 | Ga0495604_0425424 | |||
| 1347 | Ga0495674_0646254 | |||
| 1348 | Ga0495674_1091190 | |||
| 1349 | Ga0495672_0002094 | |||
| 1350 | Ga0495684_0086302 | |||
| 1351 | Ga0495684_0325763 | |||
| 1352 | Ga0495602_0112543 | |||
| 1353 | Ga0495602_0153560 | |||
| 1354 | Ga0495602_0263342 | |||
| 1355 | Ga0496100_0006877 | |||
| 1356 | Ga0496100_0252700 | |||
| 1357 | Ga0496100_1219329 | |||
| 1358 | Ga0496101_0040914 | |||
| 1359 | Ga0496101_1273749 | |||
| 1360 | Ga0496102_0976511 | |||
| 1361 | Ga0496104_0023520 | |||
| 1362 | Ga0496104_0800032 | |||
| 1363 | Ga0496105_0024502 | |||
| 1364 | Ga0496105_0033315 | |||
| 1365 | Ga0496105_0313877 | |||
| 1366 | Ga0496107_0015330 | |||
| 1367 | Ga0496107_0055383 | |||
| 1368 | Ga0496110_0234798 | |||
| 1369 | Ga0496114_0052128 | |||
| 1370 | Ga0496114_0296303 | |||
| 1371 | Ga0496115_0040424 | |||
| 1372 | Ga0496115_0154171 | |||
| 1373 | Ga0496115_0269720 | |||
| 1374 | Ga0496115_0355317 | |||
| 1375 | Ga0496115_0553145 | |||
| 1376 | Ga0496126_0000010 | |||
| 1377 | Ga0496126_0340037 | |||
| 1378 | Ga0495682_0263267 | |||
| 1379 | Ga0495601_0253612 | |||
| 1380 | Ga0500644_0030343 | |||
| 1381 | Ga0500554_284451 | |||
| 1382 | Ga0500595_032198 | |||
| 1383 | Ga0500661_000441 | |||
| 1384 | Ga0587084_028037 | |||
| 1385 | Ga0587077_108308 | |||
| 1386 | Ga0587086_040316 | |||
| 1387 | Ga0587088_049105 | |||
| 1388 | Ga0587090_123390 | |||
| 1389 | Ga0587092_014861 | |||
| 1390 | Ga0587101_019722 | |||
| 1391 | Ga0587109_033136 | |||
| 1392 | Ga0587117_017967 | |||
| 1393 | Ga0587127_005862 | |||
| 1394 | Ga0587068_024958 | |||
| 1395 | Ga0587069_032617 | |||
| 1396 | Ga0587072_185709 | |||
| 1397 | Ga0587075_044164 | |||
| 1398 | Ga0587119_020379 | |||
| 1399 | Ga0587124_018382 | |||
| 1400 | Ga0587111_0069032 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3if5-assembly1.cif.gz_A-2 | crystal structure analysis of mglu | 0.9377 | 20 | 86 |
| 3iha-assembly1.cif.gz_A-2 | crystal structure analysis of mglu in its glutamate form | 0.9306 | 20 | 86 |
| 3ih8-assembly1.cif.gz_A-2 | crystal structure analysis of mglu in its native form | 0.9242 | 20 | 86 |
| 3ihb-assembly1.cif.gz_A | crystal structure analysis of mglu in its tris and glutamate form | 0.9206 | 20 | 86 |
| 3ih8-assembly2.cif.gz_B-2 | crystal structure analysis of mglu in its native form | 0.9177 | 20 | 86 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3if5A02 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.9377 | 20 | 86 | 3.30.750.24 |
| 3ihaA02 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.9306 | 20 | 86 | 3.30.750.24 |
| 3ih8B02 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.9177 | 20 | 86 | 3.30.750.24 |
| af_A0A1D8PRZ2_628_764_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.872 | 22 | 118 | 3.30.750.24 |
| af_Q09764_608_740_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.868 | 22 | 118 | 3.30.750.24 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5M8SBS2-F1-model_v4 | STAS domain-containing protein | 0.9953 | 1 | 119 |
GO:0043856
|
| AF-A0A2D6NA53-F1-model_v4 | Anti-anti-sigma factor | 0.964 | 20 | 118 |
GO:0043856
|
| AF-A0A3M1LFU2-F1-model_v4 | Anti-sigma factor antagonist | 0.9578 | 1 | 118 |
GO:0043856
|
| AF-A0A359EIQ4-F1-model_v4 | Anti-sigma factor antagonist | 0.957 | 22 | 117 |
GO:0016020
GO:0043856 |
| AF-A0A6A7LNS7-F1-model_v4 | Anti-sigma factor antagonist | 0.9459 | 4 | 118 |
GO:0043856
|