F476077

General Info

Members Datasets Scaffolds Average Seq Length
700 234 1400 120

Family's Representative Sequence

Representative Sequence 3300005344|Ga0070661_101424695|Ga0070661_1014246951
Length 118
Sequence MQTATKVVRRDATAASGDSVAILAFSGDIASTSKDTMLQAYHGVGAVKKVLLDFSGVDYINSSGIAIIIQMLIEERAAGHRTIGIFGLTPHFKKVFTMVGVSKYATISPDEPTALAEM

Samples

Sample ID Description Type Environment
1 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
86 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
142 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
143 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
144 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
145 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
146 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
149 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
150 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
151 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
154 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
157 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
158 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
159 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
160 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
168 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
169 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
170 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
171 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
178 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
184 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
185 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
186 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
187 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
192 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
193 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
200 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
201 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
212 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
213 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
214 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
215 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
216 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
217 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
218 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.71
Metatranscriptomes 3.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.57
Nodule 0
Rhizoplane 3
Rhizosphere 95
Stem 0
Stem Tuber 0
Unclassified 27.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070661_101424695 3300005344 Unclassified 583
2 rootH2_10042999 3300003320 Unclassified 1640
3 rootH2_10066083 3300003320 Bacteria 4909
4 rootH2_10066096 3300003320 Bacteria 1898
5 rootH1_10187309 3300003323 Bacteria 1842
6 Ga0065715_10375777 3300005293 Unclassified 914
7 Ga0070658_10000142 3300005327 Bacteria 63262
8 Ga0070658_10005408 3300005327 Bacteria 10361
9 Ga0070658_10006481 3300005327 Bacteria 9484
10 Ga0070658_10010431 3300005327 Bacteria 7449
11 Ga0070658_10011101 3300005327 Bacteria 7222
12 Ga0070658_10273427 3300005327 Bacteria 1437
13 Ga0070658_11239601 3300005327 Bacteria 648
14 Ga0070676_10013742 3300005328 Bacteria 4438
15 Ga0070683_100001294 3300005329 Bacteria 19050
16 Ga0070683_100026956 3300005329 Bacteria 5179
17 Ga0070683_100150487 3300005329 Unclassified 2206
18 Ga0070683_100214984 3300005329 Bacteria 1827
19 Ga0070683_100581527 3300005329 Bacteria 1071
20 Ga0070683_100658668 3300005329 Bacteria 1002
21 Ga0070690_100277073 3300005330 Bacteria 1195
22 Ga0070670_100002947 3300005331 Bacteria 14096
23 Ga0070670_100063184 3300005331 Bacteria 3178
24 Ga0068869_100001913 3300005334 Bacteria 12502
25 Ga0068869_100281621 3300005334 Bacteria 1337
26 Ga0070666_10062598 3300005335 Unclassified 2521
27 Ga0070666_10306518 3300005335 Unclassified 1131
28 Ga0070680_100081136 3300005336 Bacteria 2676
29 Ga0070680_100162693 3300005336 Bacteria 1876
30 Ga0070680_100620016 3300005336 Bacteria 929
31 Ga0068868_100000009 3300005338 Bacteria 120604
32 Ga0068868_100015740 3300005338 Bacteria 5601
33 Ga0068868_100022926 3300005338 Bacteria 4720
34 Ga0070660_100000311 3300005339 Bacteria 32366
35 Ga0070660_100067433 3300005339 Bacteria 2788
36 Ga0070660_100135327 3300005339 Bacteria 1974
37 Ga0070660_100409213 3300005339 Unclassified 1122
38 Ga0070660_101435628 3300005339 Bacteria 586
39 Ga0070661_100021911 3300005344 Bacteria 4570
40 Ga0070661_100136155 3300005344 Bacteria 1848
41 Ga0070661_100165020 3300005344 Bacteria 1679
42 Ga0070661_100274925 3300005344 Unclassified 1305
43 Ga0070661_100490448 3300005344 Bacteria 982
44 Ga0070692_10543707 3300005345 Bacteria 760
45 Ga0070668_100084709 3300005347 Bacteria 2490
46 Ga0070675_100034487 3300005354 Bacteria 4108
47 Ga0070671_100022721 3300005355 Bacteria 5125
48 Ga0070671_100154151 3300005355 Bacteria 1941
49 Ga0070671_100887489 3300005355 Bacteria 779
50 Ga0070673_100010611 3300005364 Bacteria 6243
51 Ga0070659_100172730 3300005366 Bacteria 1771
52 Ga0070659_100181963 3300005366 Bacteria 1725
53 Ga0070667_100001882 3300005367 Bacteria 18639
54 Ga0070667_100012140 3300005367 Bacteria 7130
55 Ga0070709_10858029 3300005434 Unclassified 716
56 Ga0070709_11236034 3300005434 Unclassified 601
57 Ga0070714_100017303 3300005435 Bacteria 5838
58 Ga0070714_100168901 3300005435 Bacteria 1984
59 Ga0070714_100209289 3300005435 Bacteria 1787
60 Ga0070714_101293480 3300005435 Bacteria 712
61 Ga0070714_102487064 3300005435 Unclassified 503
62 Ga0070713_100003713 3300005436 Bacteria 10110
63 Ga0070713_100108311 3300005436 Bacteria 2419
64 Ga0070713_100190228 3300005436 Bacteria 1849
65 Ga0070713_100235136 3300005436 Bacteria 1667
66 Ga0070713_100256280 3300005436 Unclassified 1598
67 Ga0070713_100332734 3300005436 Unclassified 1405
68 Ga0070713_100978151 3300005436 Bacteria 816
69 Ga0070713_101211836 3300005436 Unclassified 731
70 Ga0070711_100221272 3300005439 Unclassified 1472
71 Ga0070711_100947947 3300005439 Unclassified 736
72 Ga0070711_100979344 3300005439 Unclassified 725
73 Ga0070663_100056019 3300005455 Bacteria 2824
74 Ga0070663_100188084 3300005455 Bacteria 1606
75 Ga0070663_100382837 3300005455 Unclassified 1146
76 Ga0070663_100489032 3300005455 Unclassified 1020
77 Ga0070663_100494166 3300005455 Bacteria 1015
78 Ga0070678_100062022 3300005456 Bacteria 2758
79 Ga0070662_100010729 3300005457 Bacteria 6032
80 Ga0070681_10000804 3300005458 Bacteria 26179
81 Ga0070681_10046056 3300005458 Unclassified 4361
82 Ga0070681_10387789 3300005458 Bacteria 1308
83 Ga0068867_100203700 3300005459 Unclassified 1585
84 Ga0068867_100525045 3300005459 Bacteria 1021
85 Ga0070685_11361589 3300005466 Unclassified 544
86 Ga0070679_100000226 3300005530 Bacteria 46282
87 Ga0070679_100044742 3300005530 Unclassified 4410
88 Ga0070679_100607471 3300005530 Unclassified 1037
89 Ga0070684_100025564 3300005535 Bacteria 4965
90 Ga0070684_100078675 3300005535 Unclassified 2914
91 Ga0070684_100111897 3300005535 Bacteria 2449
92 Ga0070684_100216012 3300005535 Bacteria 1749
93 Ga0070684_100347897 3300005535 Bacteria 1363
94 Ga0070684_100446949 3300005535 Bacteria 1194
95 Ga0070684_100502105 3300005535 Bacteria 1123
96 Ga0068853_100000914 3300005539 Bacteria 20625
97 Ga0068853_100034028 3300005539 Bacteria 4324
98 Ga0068853_100037459 3300005539 Viruses 4126
99 Ga0068853_100042984 3300005539 Bacteria 3865
100 Ga0070665_100024182 3300005548 Bacteria 6118
101 Ga0070665_100030820 3300005548 Bacteria 5398
102 Ga0070665_100069665 3300005548 Unclassified 3525
103 Ga0070665_100104651 3300005548 Unclassified 2832
104 Ga0070665_100169901 3300005548 Bacteria 2182
105 Ga0070665_100326624 3300005548 Bacteria 1538
106 Ga0068855_100003316 3300005563 Bacteria 19696
107 Ga0068855_100007673 3300005563 Bacteria 13036
108 Ga0068855_100015507 3300005563 Bacteria 9174
109 Ga0068855_100028667 3300005563 Bacteria 6661
110 Ga0068855_100032512 3300005563 Bacteria 6228
111 Ga0068855_100045317 3300005563 Bacteria 5201
112 Ga0068855_100074105 3300005563 Bacteria 3954
113 Ga0068855_100322461 3300005563 Unclassified 1707
114 Ga0068855_101603030 3300005563 Unclassified 666
115 Ga0070664_100171960 3300005564 Unclassified 1922
116 Ga0068857_100000181 3300005577 Bacteria 40250
117 Ga0068857_100000269 3300005577 Bacteria 35388
118 Ga0068857_100014310 3300005577 Bacteria 6914
119 Ga0068857_100054215 3300005577 Unclassified 3557
120 Ga0068857_100055906 3300005577 Bacteria 3502
121 Ga0068857_100833861 3300005577 Bacteria 882
122 Ga0068857_100972750 3300005577 Unclassified 816
123 Ga0068854_100003621 3300005578 Bacteria 9666
124 Ga0068854_100030603 3300005578 Unclassified 3734
125 Ga0068854_100596284 3300005578 Bacteria 943
126 Ga0068856_100000809 3300005614 Bacteria 33774
127 Ga0068856_100015932 3300005614 Bacteria 7268
128 Ga0068856_100017479 3300005614 Bacteria 6949
129 Ga0068856_100028898 3300005614 Bacteria 5417
130 Ga0068856_100076409 3300005614 Unclassified 3318
131 Ga0068856_100087860 3300005614 Unclassified 3091
132 Ga0068856_100129642 3300005614 Bacteria 2526
133 Ga0068856_100215543 3300005614 Bacteria 1935
134 Ga0068856_100241622 3300005614 Bacteria 1821
135 Ga0068856_100446206 3300005614 Bacteria 1314
136 Ga0068856_100481900 3300005614 Bacteria 1261
137 Ga0068856_100868069 3300005614 Bacteria 921
138 Ga0068856_101224217 3300005614 Bacteria 767
139 Ga0068856_101272533 3300005614 Unclassified 751
140 Ga0068856_101713317 3300005614 Unclassified 641
141 Ga0068852_100000199 3300005616 Bacteria 40929
142 Ga0068852_100000887 3300005616 Bacteria 19805
143 Ga0068852_100001654 3300005616 Bacteria 15203
144 Ga0068852_100027066 3300005616 Bacteria 4668
145 Ga0068852_100044386 3300005616 Bacteria 3775
146 Ga0068852_100097933 3300005616 Bacteria 2640
147 Ga0068852_100147539 3300005616 Unclassified 2184
148 Ga0068852_100203299 3300005616 Unclassified 1875
149 Ga0068852_100400092 3300005616 Bacteria 1351
150 Ga0068852_100419216 3300005616 Unclassified 1320
151 Ga0068852_100549498 3300005616 Bacteria 1155
152 Ga0068859_100002712 3300005617 Bacteria 17961
153 Ga0068859_100184430 3300005617 Bacteria 2170
154 Ga0068864_100003465 3300005618 Bacteria 13030
155 Ga0068864_100410702 3300005618 Bacteria 1288
156 Ga0068861_100428645 3300005719 Bacteria 1180
157 Ga0068851_10012603 3300005834 Bacteria 3989
158 Ga0068851_10026100 3300005834 Bacteria 2869
159 Ga0068851_10048580 3300005834 Unclassified 2150
160 Ga0068851_10149862 3300005834 Bacteria 1274
161 Ga0068863_100000273 3300005841 Bacteria 53827
162 Ga0068863_100019580 3300005841 Bacteria 6472
163 Ga0068858_100026536 3300005842 Bacteria 5381
164 Ga0068858_100058900 3300005842 Unclassified 3551
165 Ga0068858_100683606 3300005842 Unclassified 998
166 Ga0068858_101913027 3300005842 Bacteria 586
167 Ga0068860_100000031 3300005843 Bacteria 255068
168 Ga0068862_100112116 3300005844 Unclassified 2395
169 Ga0070717_10000898 3300006028 Bacteria 19756
170 Ga0070717_10576571 3300006028 Bacteria 1020
171 Ga0070717_10926923 3300006028 Bacteria 793
172 Ga0070717_11022179 3300006028 Bacteria 753
173 Ga0097621_100005630 3300006237 Bacteria 8835
174 Ga0097621_100007467 3300006237 Bacteria 7820
175 Ga0097621_101937389 3300006237 Unclassified 563
176 Ga0097621_101977481 3300006237 Unclassified 557
177 Ga0068871_100002198 3300006358 Bacteria 13257
178 Ga0068865_100044913 3300006881 Bacteria 3026
179 Ga0097620_100002712 3300006931 Bacteria 17961
180 Ga0097620_100184430 3300006931 Bacteria 2170
181 Ga0099794_10778805 3300007265 Unclassified 511
182 Ga0105240_10000451 3300009093 Bacteria 75544
183 Ga0105240_10001070 3300009093 Bacteria 48381
184 Ga0105240_10002552 3300009093 Bacteria 29190
185 Ga0105240_10002933 3300009093 Bacteria 26905
186 Ga0105240_10003422 3300009093 Bacteria 24653
187 Ga0105240_10068958 3300009093 Bacteria 4379
188 Ga0105240_10092329 3300009093 Bacteria 3697
189 Ga0105240_10956117 3300009093 Unclassified 918
190 Ga0105240_11043451 3300009093 Unclassified 872
191 Ga0105240_11097967 3300009093 Bacteria 847
192 Ga0105240_11610709 3300009093 Unclassified 679
193 Ga0105240_12317437 3300009093 Bacteria 556
194 Ga0105245_10003181 3300009098 Bacteria 14677
195 Ga0105245_10273907 3300009098 Unclassified 1647
196 Ga0105245_10318564 3300009098 Bacteria 1531
197 Ga0105247_10003136 3300009101 Bacteria 10892
198 Ga0105247_10037922 3300009101 Bacteria 2940
199 Ga0105247_10423707 3300009101 Unclassified 954
200 Ga0105247_10600420 3300009101 Bacteria 816
201 Ga0105247_11503282 3300009101 Unclassified 549
202 Ga0105241_10000123 3300009174 Bacteria 56005
203 Ga0105241_10019959 3300009174 Bacteria 4947
204 Ga0105241_10098299 3300009174 Bacteria 2322
205 Ga0105241_10274294 3300009174 Bacteria 1438
206 Ga0105241_10292523 3300009174 Bacteria 1395
207 Ga0105242_10795250 3300009176 Bacteria 936
208 Ga0105248_10000047 3300009177 Bacteria 163513
209 Ga0105248_10001233 3300009177 Bacteria 28557
210 Ga0105248_10187362 3300009177 Unclassified 2332
211 Ga0105237_10035217 3300009545 Bacteria 5066
212 Ga0105237_10048761 3300009545 Bacteria 4257
213 Ga0105237_10588877 3300009545 Bacteria 1119
214 Ga0105237_11062054 3300009545 Bacteria 817
215 Ga0105238_10000334 3300009551 Bacteria 51408
216 Ga0105238_10011830 3300009551 Bacteria 8791
217 Ga0105238_10021179 3300009551 Bacteria 6626
218 Ga0105238_10027432 3300009551 Bacteria 5803
219 Ga0105238_10041018 3300009551 Bacteria 4689
220 Ga0105238_10212015 3300009551 Bacteria 1913
221 Ga0105238_10532705 3300009551 Bacteria 1178
222 Ga0105238_11869161 3300009551 Bacteria 633
223 Ga0105238_12220059 3300009551 Unclassified 584
224 Ga0105249_10037654 3300009553 Bacteria 4389
225 Ga0105249_10397884 3300009553 Bacteria 1407
226 Ga0105249_11746262 3300009553 Unclassified 695
227 Ga0105239_10001864 3300010375 Bacteria 27591
228 Ga0105239_10014176 3300010375 Bacteria 8844
229 Ga0105239_10118191 3300010375 Unclassified 2942
230 Ga0105239_10163775 3300010375 Bacteria 2486
231 Ga0105239_10975988 3300010375 Bacteria 974
232 Ga0105239_11491450 3300010375 Bacteria 781
233 Ga0105239_11611946 3300010375 Bacteria 751
234 Ga0105239_11937895 3300010375 Bacteria 684
235 Ga0105246_10001815 3300011119 Bacteria 12795
236 Ga0157373_10547909 3300013100 Bacteria 839
237 Ga0157371_10215085 3300013102 Bacteria 1380
238 Ga0157371_10226122 3300013102 Bacteria 1344
239 Ga0157371_10643964 3300013102 Bacteria 791
240 Ga0157371_11537311 3300013102 Unclassified 520
241 Ga0157370_10000542 3300013104 Bacteria 47157
242 Ga0157370_10010623 3300013104 Bacteria 9691
243 Ga0157370_10020842 3300013104 Bacteria 6541
244 Ga0157370_10035992 3300013104 Bacteria 4807
245 Ga0157370_10041906 3300013104 Bacteria 4414
246 Ga0157370_10077967 3300013104 Bacteria 3120
247 Ga0157370_10211653 3300013104 Bacteria 1797
248 Ga0157369_10001280 3300013105 Bacteria 31263
249 Ga0157369_10002372 3300013105 Bacteria 22630
250 Ga0157369_10002679 3300013105 Bacteria 21243
251 Ga0157369_10032494 3300013105 Bacteria 5738
252 Ga0157369_10046264 3300013105 Bacteria 4729
253 Ga0157369_10054341 3300013105 Bacteria 4325
254 Ga0157369_10055887 3300013105 Unclassified 4260
255 Ga0157369_10077934 3300013105 Bacteria 3551
256 Ga0157369_10081995 3300013105 Bacteria 3451
257 Ga0157369_10171211 3300013105 Bacteria 2288
258 Ga0157369_10213948 3300013105 Bacteria 2020
259 Ga0157369_10364961 3300013105 Unclassified 1499
260 Ga0157369_10419336 3300013105 Unclassified 1388
261 Ga0157369_10459021 3300013105 Bacteria 1319
262 Ga0157374_10002229 3300013296 Bacteria 16328
263 Ga0157374_10014906 3300013296 Bacteria 6812
264 Ga0157374_10145427 3300013296 Bacteria 2302
265 Ga0157374_10790048 3300013296 Bacteria 965
266 Ga0157374_10806501 3300013296 Bacteria 955
267 Ga0157374_10917756 3300013296 Bacteria 894
268 Ga0157374_10929026 3300013296 Unclassified 888
269 Ga0157374_11198623 3300013296 Unclassified 781
270 Ga0157374_11430260 3300013296 Unclassified 714
271 Ga0157374_12483266 3300013296 Unclassified 546
272 Ga0157378_10007247 3300013297 Bacteria 9682
273 Ga0157378_10013136 3300013297 Bacteria 7247
274 Ga0157378_10647715 3300013297 Bacteria 1072
275 Ga0163162_10077817 3300013306 Bacteria 3381
276 Ga0163162_10231752 3300013306 Bacteria 1977
277 Ga0163162_10733848 3300013306 Unclassified 1108
278 Ga0163162_10931717 3300013306 Unclassified 980
279 Ga0157372_10000408 3300013307 Bacteria 47157
280 Ga0157372_10002226 3300013307 Bacteria 21043
281 Ga0157372_10003039 3300013307 Bacteria 18084
282 Ga0157372_10003426 3300013307 Bacteria 17114
283 Ga0157372_10021880 3300013307 Bacteria 6912
284 Ga0157372_10025053 3300013307 Bacteria 6483
285 Ga0157372_10041630 3300013307 Bacteria 5080
286 Ga0157372_10047498 3300013307 Bacteria 4771
287 Ga0157372_10100329 3300013307 Bacteria 3304
288 Ga0157372_10102167 3300013307 Bacteria 3274
289 Ga0157372_10386506 3300013307 Bacteria 1630
290 Ga0157372_10393699 3300013307 Bacteria 1614
291 Ga0157372_10485241 3300013307 Bacteria 1441
292 Ga0157372_10704794 3300013307 Bacteria 1175
293 Ga0157372_10914201 3300013307 Bacteria 1018
294 Ga0157372_12904786 3300013307 Unclassified 549
295 Ga0157375_10006678 3300013308 Bacteria 10046
296 Ga0157375_11553062 3300013308 Unclassified 782
297 Ga0163163_10000237 3300014325 Bacteria 56191
298 Ga0163163_10759977 3300014325 Unclassified 1033
299 Ga0163163_10905378 3300014325 Unclassified 945
300 Ga0163163_11874661 3300014325 Unclassified 660
301 Ga0157377_10140699 3300014745 Bacteria 1483
302 Ga0157377_10368702 3300014745 Unclassified 969
303 Ga0157379_10015308 3300014968 Bacteria 6727
304 Ga0157379_10052254 3300014968 Bacteria 3650
305 Ga0157379_10062672 3300014968 Bacteria 3325
306 Ga0157379_10351789 3300014968 Unclassified 1349
307 Ga0157379_10407930 3300014968 Bacteria 1250
308 Ga0157379_10869796 3300014968 Bacteria 854
309 Ga0157376_10000386 3300014969 Bacteria 28694
310 Ga0157376_10062577 3300014969 Bacteria 3132
311 Ga0157376_10231004 3300014969 Unclassified 1718
312 Ga0157376_10320068 3300014969 Unclassified 1474
313 Ga0157376_10908825 3300014969 Unclassified 899
314 Ga0163161_10128650 3300017792 Bacteria 1908
315 Ga0206352_10596306 3300020078 Unclassified 990
316 Ga0206350_11537616 3300020080 Bacteria 680
317 Ga0206353_10193638 3300020082 Bacteria 1161
318 Ga0154015_1519660 3300020610 Unclassified 743
319 Ga0213875_10199458 3300021388 Bacteria 941
320 Ga0213875_10230869 3300021388 Bacteria 872
321 Ga0228598_1109088 3300024227 Unclassified 560
322 Ga0207656_10003780 3300025321 Bacteria 5243
323 Ga0207656_10004677 3300025321 Bacteria 4797
324 Ga0207710_10001408 3300025900 Bacteria 12030
325 Ga0207680_10051850 3300025903 Bacteria 2455
326 Ga0207680_10072280 3300025903 Bacteria 2141
327 Ga0207647_10020414 3300025904 Unclassified 4443
328 Ga0207647_10487376 3300025904 Unclassified 688
329 Ga0207699_10421939 3300025906 Bacteria 953
330 Ga0207645_10057989 3300025907 Bacteria 2472
331 Ga0207705_10000020 3300025909 Bacteria 311745
332 Ga0207705_10005946 3300025909 Bacteria 9077
333 Ga0207705_10008749 3300025909 Bacteria 7376
334 Ga0207705_10048665 3300025909 Bacteria 3050
335 Ga0207705_10050352 3300025909 Bacteria 2998
336 Ga0207705_10110854 3300025909 Unclassified 2027
337 Ga0207654_10000078 3300025911 Bacteria 63974
338 Ga0207654_10000095 3300025911 Bacteria 59415
339 Ga0207654_10000236 3300025911 Bacteria 33775
340 Ga0207654_10021215 3300025911 Bacteria 3452
341 Ga0207654_10060307 3300025911 Bacteria 2216
342 Ga0207654_10698751 3300025911 Bacteria 728
343 Ga0207707_10020940 3300025912 Bacteria 5713
344 Ga0207707_10143838 3300025912 Bacteria 2084
345 Ga0207707_10662634 3300025912 Bacteria 879
346 Ga0207707_11539939 3300025912 Unclassified 525
347 Ga0207695_10000075 3300025913 Bacteria 308496
348 Ga0207695_10000145 3300025913 Bacteria 209555
349 Ga0207695_10000787 3300025913 Bacteria 59756
350 Ga0207695_10001098 3300025913 Bacteria 47165
351 Ga0207695_10001570 3300025913 Bacteria 37221
352 Ga0207695_10005982 3300025913 Bacteria 15912
353 Ga0207695_10020928 3300025913 Bacteria 7476
354 Ga0207695_10081808 3300025913 Bacteria 3267
355 Ga0207695_10120524 3300025913 Bacteria 2592
356 Ga0207695_10124594 3300025913 Bacteria 2541
357 Ga0207671_10000032 3300025914 Bacteria 245878
358 Ga0207671_10000324 3300025914 Bacteria 70145
359 Ga0207671_10114340 3300025914 Bacteria 2057
360 Ga0207671_10151264 3300025914 Bacteria 1793
361 Ga0207671_10487113 3300025914 Unclassified 983
362 Ga0207693_11146856 3300025915 Bacteria 588
363 Ga0207663_10770651 3300025916 Unclassified 765
364 Ga0207660_10061047 3300025917 Bacteria 2712
365 Ga0207657_10001924 3300025919 Bacteria 22428
366 Ga0207657_10366494 3300025919 Unclassified 1135
367 Ga0207657_10841480 3300025919 Unclassified 708
368 Ga0207649_10007760 3300025920 Bacteria 5836
369 Ga0207649_10044728 3300025920 Bacteria 2712
370 Ga0207649_10136784 3300025920 Unclassified 1671
371 Ga0207649_10245554 3300025920 Unclassified 1287
372 Ga0207649_10423824 3300025920 Bacteria 1000
373 Ga0207649_10741705 3300025920 Unclassified 764
374 Ga0207652_10029748 3300025921 Bacteria 4570
375 Ga0207652_10498832 3300025921 Unclassified 1096
376 Ga0207652_10882957 3300025921 Unclassified 790
377 Ga0207694_10000024 3300025924 Bacteria 259443
378 Ga0207694_10000259 3300025924 Bacteria 50419
379 Ga0207694_10004199 3300025924 Bacteria 11285
380 Ga0207694_10005121 3300025924 Bacteria 10118
381 Ga0207694_10038917 3300025924 Bacteria 3657
382 Ga0207694_10152373 3300025924 Bacteria 1863
383 Ga0207694_10538152 3300025924 Unclassified 980
384 Ga0207694_10592570 3300025924 Bacteria 932
385 Ga0207650_10002268 3300025925 Bacteria 13423
386 Ga0207650_10253359 3300025925 Bacteria 1426
387 Ga0207659_10060389 3300025926 Bacteria 2728
388 Ga0207687_10000208 3300025927 Bacteria 39686
389 Ga0207687_10015318 3300025927 Bacteria 5024
390 Ga0207687_10083925 3300025927 Bacteria 2308
391 Ga0207687_10113093 3300025927 Bacteria 2019
392 Ga0207700_10065471 3300025928 Bacteria 2773
393 Ga0207700_10089799 3300025928 Bacteria 2423
394 Ga0207700_10133289 3300025928 Bacteria 2032
395 Ga0207700_10319184 3300025928 Unclassified 1346
396 Ga0207700_10673156 3300025928 Unclassified 923
397 Ga0207700_10775773 3300025928 Bacteria 857
398 Ga0207700_11643728 3300025928 Bacteria 568
399 Ga0207664_10149234 3300025929 Bacteria 1985
400 Ga0207664_10215984 3300025929 Bacteria 1661
401 Ga0207664_10328096 3300025929 Bacteria 1351
402 Ga0207664_10385618 3300025929 Unclassified 1244
403 Ga0207644_10041760 3300025931 Bacteria 3247
404 Ga0207690_10072881 3300025932 Unclassified 2373
405 Ga0207690_10141739 3300025932 Bacteria 1772
406 Ga0207706_10002070 3300025933 Bacteria 19666
407 Ga0207686_11116609 3300025934 Unclassified 643
408 Ga0207704_10021101 3300025938 Bacteria 3461
409 Ga0207665_10421223 3300025939 Unclassified 1020
410 Ga0207711_10000040 3300025941 Bacteria 162754
411 Ga0207711_10007378 3300025941 Bacteria 9203
412 Ga0207711_10143846 3300025941 Bacteria 2147
413 Ga0207711_10175034 3300025941 Unclassified 1949
414 Ga0207689_10000487 3300025942 Bacteria 37505
415 Ga0207689_10171493 3300025942 Bacteria 1788
416 Ga0207661_10000123 3300025944 Bacteria 49544
417 Ga0207661_10016981 3300025944 Bacteria 5376
418 Ga0207661_10117736 3300025944 Bacteria 2257
419 Ga0207661_10134026 3300025944 Unclassified 2126
420 Ga0207661_10232131 3300025944 Bacteria 1634
421 Ga0207661_10240726 3300025944 Unclassified 1605
422 Ga0207661_10610603 3300025944 Bacteria 1001
423 Ga0207661_10905406 3300025944 Bacteria 812
424 Ga0207679_10799658 3300025945 Bacteria 860
425 Ga0207667_10000188 3300025949 Bacteria 90598
426 Ga0207667_10000659 3300025949 Bacteria 44741
427 Ga0207667_10009596 3300025949 Bacteria 11389
428 Ga0207667_10015503 3300025949 Bacteria 8650
429 Ga0207667_10022471 3300025949 Bacteria 6967
430 Ga0207667_10051723 3300025949 Bacteria 4329
431 Ga0207667_10070194 3300025949 Bacteria 3646
432 Ga0207667_10258308 3300025949 Bacteria 1782
433 Ga0207667_10261180 3300025949 Bacteria 1771
434 Ga0207667_10402885 3300025949 Bacteria 1393
435 Ga0207667_11107841 3300025949 Unclassified 775
436 Ga0207651_10042316 3300025960 Bacteria 3031
437 Ga0207712_10144166 3300025961 Unclassified 1831
438 Ga0207712_10605126 3300025961 Unclassified 948
439 Ga0207712_10844064 3300025961 Unclassified 807
440 Ga0207668_10050977 3300025972 Bacteria 2856
441 Ga0207640_10012003 3300025981 Bacteria 4923
442 Ga0207640_10297816 3300025981 Bacteria 1275
443 Ga0207658_10000135 3300025986 Bacteria 77651
444 Ga0207658_10013447 3300025986 Bacteria 5590
445 Ga0207677_10000034 3300026023 Bacteria 117922
446 Ga0207677_10090329 3300026023 Bacteria 2225
447 Ga0207703_10023052 3300026035 Unclassified 4888
448 Ga0207703_10181957 3300026035 Bacteria 1855
449 Ga0207703_10607108 3300026035 Unclassified 1035
450 Ga0207639_10000050 3300026041 Bacteria 121432
451 Ga0207639_10009673 3300026041 Bacteria 6660
452 Ga0207639_10061719 3300026041 Bacteria 2896
453 Ga0207639_10271473 3300026041 Unclassified 1488
454 Ga0207639_10344726 3300026041 Bacteria 1329
455 Ga0207678_10001214 3300026067 Bacteria 23694
456 Ga0207678_10051293 3300026067 Bacteria 3562
457 Ga0207678_10462456 3300026067 Bacteria 1104
458 Ga0207678_10550219 3300026067 Unclassified 1009
459 Ga0207702_10000109 3300026078 Bacteria 95381
460 Ga0207702_10003095 3300026078 Bacteria 15424
461 Ga0207702_10186276 3300026078 Bacteria 1914
462 Ga0207702_10215466 3300026078 Bacteria 1787
463 Ga0207702_10319703 3300026078 Bacteria 1478
464 Ga0207702_10320706 3300026078 Bacteria 1475
465 Ga0207702_10383608 3300026078 Unclassified 1352
466 Ga0207702_10413592 3300026078 Bacteria 1303
467 Ga0207702_10509872 3300026078 Bacteria 1173
468 Ga0207702_10885189 3300026078 Unclassified 884
469 Ga0207702_12041854 3300026078 Unclassified 563
470 Ga0207641_10004397 3300026088 Bacteria 12208
471 Ga0207641_10091516 3300026088 Bacteria 2662
472 Ga0207648_10205244 3300026089 Bacteria 1749
473 Ga0207676_10000316 3300026095 Bacteria 41392
474 Ga0207674_10000815 3300026116 Bacteria 40507
475 Ga0207674_10000968 3300026116 Bacteria 37588
476 Ga0207674_10082621 3300026116 Bacteria 3213
477 Ga0207674_10165399 3300026116 Unclassified 2166
478 Ga0207683_10042955 3300026121 Bacteria 3948
479 Ga0207698_10000129 3300026142 Bacteria 47118
480 Ga0207698_10000393 3300026142 Bacteria 25270
481 Ga0207698_10019288 3300026142 Unclassified 4666
482 Ga0207698_10023255 3300026142 Bacteria 4326
483 Ga0207698_10023960 3300026142 Bacteria 4274
484 Ga0207698_10063497 3300026142 Bacteria 2890
485 Ga0207698_10189601 3300026142 Unclassified 1830
486 Ga0207698_10335910 3300026142 Bacteria 1421
487 Ga0207698_11338344 3300026142 Unclassified 731
488 Ga0207698_11440199 3300026142 Unclassified 704
489 Ga0265354_1006393 3300028016 Bacteria 1171
490 Ga0268266_10001402 3300028379 Bacteria 28793
491 Ga0268266_10002790 3300028379 Bacteria 18209
492 Ga0268266_10015978 3300028379 Bacteria 6420
493 Ga0268266_10126035 3300028379 Bacteria 2285
494 Ga0268266_10259411 3300028379 Bacteria 1610
495 Ga0268266_10383842 3300028379 Bacteria 1325
496 Ga0268266_11088112 3300028379 Bacteria 773
497 Ga0268265_10087580 3300028380 Unclassified 2478
498 Ga0268264_10000540 3300028381 Bacteria 47743
499 Ga0268264_10038935 3300028381 Bacteria 3926
500 Ga0265318_10005203 3300028577 Bacteria 6140
501 Ga0265318_10028158 3300028577 Unclassified 2200
502 Ga0265323_10045661 3300028653 Bacteria 1573
503 Ga0265336_10000499 3300028666 Bacteria 22942
504 Ga0265336_10008807 3300028666 Bacteria 3519
505 Ga0265338_10000529 3300028800 Bacteria 67074
506 Ga0265338_10011218 3300028800 Bacteria 10384
507 Ga0265338_10039724 3300028800 Unclassified 4434
508 Ga0265338_10084444 3300028800 Bacteria 2651
509 Ga0265338_10102619 3300028800 Bacteria 2325
510 Ga0265338_10108441 3300028800 Bacteria 2243
511 Ga0265338_10121178 3300028800 Unclassified 2085
512 Ga0265338_10253757 3300028800 Bacteria 1296
513 Ga0265338_10306454 3300028800 Unclassified 1153
514 Ga0265338_10317333 3300028800 Unclassified 1129
515 Ga0265338_10525947 3300028800 Bacteria 830
516 Ga0265338_10679159 3300028800 Unclassified 712
517 Ga0265338_10727030 3300028800 Bacteria 684
518 Ga0265324_10048953 3300029957 Bacteria 1453
519 Ga0265770_1041445 3300030878 Unclassified 807
520 Ga0265760_10038134 3300031090 Bacteria 1428
521 Ga0265330_10000726 3300031235 Bacteria 20709
522 Ga0265330_10001029 3300031235 Bacteria 16863
523 Ga0265330_10006052 3300031235 Bacteria 5991
524 Ga0265330_10057097 3300031235 Bacteria 1703
525 Ga0265330_10079413 3300031235 Bacteria 1415
526 Ga0265330_10091461 3300031235 Unclassified 1306
527 Ga0265330_10182470 3300031235 Bacteria 889
528 Ga0265328_10003631 3300031239 Bacteria 6808
529 Ga0265328_10007337 3300031239 Bacteria 4602
530 Ga0265328_10101610 3300031239 Unclassified 1065
531 Ga0265328_10280140 3300031239 Unclassified 641
532 Ga0265325_10000249 3300031241 Bacteria 38332
533 Ga0265325_10000335 3300031241 Bacteria 33298
534 Ga0265325_10037046 3300031241 Bacteria 2580
535 Ga0265325_10136484 3300031241 Bacteria 1170
536 Ga0265325_10139868 3300031241 Bacteria 1152
537 Ga0265325_10262046 3300031241 Unclassified 780
538 Ga0265329_10022784 3300031242 Bacteria 2091
539 Ga0265329_10029539 3300031242 Bacteria 1790
540 Ga0265329_10294832 3300031242 Unclassified 547
541 Ga0265340_10009847 3300031247 Bacteria 5122
542 Ga0265340_10017776 3300031247 Bacteria 3678
543 Ga0265340_10137139 3300031247 Unclassified 1120
544 Ga0265340_10301751 3300031247 Unclassified 710
545 Ga0265339_10000183 3300031249 Bacteria 53140
546 Ga0265339_10003154 3300031249 Bacteria 11607
547 Ga0265339_10003965 3300031249 Bacteria 10229
548 Ga0265339_10004030 3300031249 Bacteria 10148
549 Ga0265339_10019838 3300031249 Unclassified 3937
550 Ga0265339_10020874 3300031249 Unclassified 3821
551 Ga0265339_10030191 3300031249 Bacteria 3071
552 Ga0265339_10093982 3300031249 Bacteria 1568
553 Ga0265339_10242787 3300031249 Unclassified 874
554 Ga0265327_10200930 3300031251 Unclassified 903
555 Ga0265327_10318951 3300031251 Bacteria 682
556 Ga0265316_10001212 3300031344 Bacteria 27775
557 Ga0265316_10001361 3300031344 Bacteria 26314
558 Ga0265316_10007811 3300031344 Bacteria 10013
559 Ga0265316_10011127 3300031344 Bacteria 8143
560 Ga0265316_10012098 3300031344 Bacteria 7750
561 Ga0265316_10035952 3300031344 Bacteria 4008
562 Ga0265316_10043045 3300031344 Bacteria 3604
563 Ga0265316_10062172 3300031344 Bacteria 2898
564 Ga0265316_10117671 3300031344 Bacteria 2009
565 Ga0265316_10129118 3300031344 Bacteria 1905
566 Ga0265316_10288897 3300031344 Bacteria 1197
567 Ga0265316_10398234 3300031344 Bacteria 992
568 Ga0265316_10689119 3300031344 Unclassified 721
569 Ga0265313_10007115 3300031595 Bacteria 7714
570 Ga0265313_10007256 3300031595 Bacteria 7614
571 Ga0265313_10036859 3300031595 Unclassified 2452
572 Ga0265313_10040410 3300031595 Bacteria 2306
573 Ga0265313_10087658 3300031595 Unclassified 1402
574 Ga0265314_10000239 3300031711 Bacteria 80839
575 Ga0265314_10005184 3300031711 Bacteria 11831
576 Ga0265314_10031922 3300031711 Bacteria 3881
577 Ga0265314_10198084 3300031711 Bacteria 1190
578 Ga0265342_10001134 3300031712 Bacteria 25443
579 Ga0265342_10001693 3300031712 Bacteria 20222
580 Ga0265342_10002138 3300031712 Bacteria 17433
581 Ga0265342_10006731 3300031712 Bacteria 8516
582 Ga0265342_10010813 3300031712 Bacteria 6288
583 Ga0265342_10085101 3300031712 Bacteria 1820
584 Ga0265342_10124818 3300031712 Bacteria 1446
585 Ga0265342_10220666 3300031712 Bacteria 1021
586 Ga0373954_0116407 3300035118 Bacteria 1295
587 Ga0373956_0063787 3300035119 Bacteria 1672
588 Ga0373955_0028996 3300035172 Bacteria 2875
589 Ga0373955_0228085 3300035172 Bacteria 1114
590 Ga0373955_0727978 3300035172 Unclassified 609
591 Ga0373924_0508109 3300035410 Bacteria 542
592 Ga0373935_0389820 3300035692 Bacteria 999
593 Ga0373933_0035547 3300035724 Bacteria 2910
594 Ga0373937_0043808 3300036401 Bacteria 4087
595 Ga0373937_0520558 3300036401 Unclassified 1130
596 Ga0373937_1256123 3300036401 Bacteria 689
597 Ga0373925_0767781 3300037068 Unclassified 795
598 Ga0436364_0135193 3300037853 Bacteria 6544
599 Ga0436364_0336794 3300037853 Bacteria 981
600 Ga0436360_1290831 3300039438 Unclassified 697
601 Ga0436362_1195660 3300039453 Unclassified 581
602 Ga0466969_0121069 3300044656 Bacteria 1218
603 Ga0466969_0181573 3300044656 Unclassified 963
604 Ga0466961_0044708 3300044693 Bacteria 2834
605 Ga0466961_0059942 3300044693 Bacteria 2420
606 Ga0466961_0182123 3300044693 Bacteria 1304
607 Ga0466963_0499998 3300044694 Unclassified 858
608 Ga0466971_0135604 3300044719 Bacteria 1145
609 Ga0466959_0238849 3300045049 Bacteria 1256
610 Ga0466967_0023757 3300045976 Bacteria 5029
611 Ga0466967_0770059 3300045976 Bacteria 955
612 Ga0466967_1133987 3300045976 Bacteria 779
613 Ga0495629_0033730 3300046459 Unclassified 3620
614 Ga0495629_0041392 3300046459 Unclassified 3242
615 Ga0495629_0251369 3300046459 Unclassified 1216
616 Ga0495651_0729820 3300046462 Unclassified 616
617 Ga0495650_0001877 3300046471 Bacteria 18730
618 Ga0495580_0032557 3300046472 Unclassified 3762
619 Ga0495580_0732900 3300046472 Bacteria 645
620 Ga0495582_0609372 3300046473 Bacteria 632
621 Ga0495639_0571303 3300046475 Unclassified 580
622 Ga0495664_0016591 3300046477 Bacteria 4198
623 Ga0495628_0166508 3300046516 Bacteria 1673
624 Ga0495652_0017267 3300046529 Bacteria 6443
625 Ga0495665_0094382 3300046531 Bacteria 1571
626 Ga0495665_0148265 3300046531 Unclassified 1225
627 Ga0495587_0249133 3300046536 Unclassified 999
628 Ga0495587_0329117 3300046536 Unclassified 853
629 Ga0495645_0000851 3300046543 Bacteria 20792
630 Ga0495645_0004067 3300046543 Bacteria 9990
631 Ga0495645_0233260 3300046543 Bacteria 1232
632 Ga0495634_0793123 3300046642 Unclassified 540
633 Ga0495625_0000377 3300046660 Bacteria 68156
634 Ga0495635_0937244 3300046663 Unclassified 553
635 Ga0495657_0437144 3300046675 Bacteria 767
636 Ga0495623_0114051 3300046679 Bacteria 1634
637 Ga0495646_0087380 3300046680 Unclassified 1807
638 Ga0495613_0053082 3300046689 Bacteria 2984
639 Ga0495613_0104672 3300046689 Bacteria 2043
640 Ga0495613_0120640 3300046689 Bacteria 1883
641 Ga0495613_0170750 3300046689 Unclassified 1543
642 Ga0495613_0348711 3300046689 Bacteria 1017
643 Ga0495649_0285420 3300046694 Unclassified 843
644 Ga0495600_0035008 3300046809 Unclassified 3261
645 Ga0495604_0023379 3300047317 Bacteria 4931
646 Ga0495604_0425424 3300047317 Unclassified 871
647 Ga0495674_0646254 3300047319 Unclassified 834
648 Ga0495674_1091190 3300047319 Unclassified 608
649 Ga0495672_0002094 3300047320 Bacteria 18701
650 Ga0495684_0086302 3300047471 Bacteria 2379
651 Ga0495684_0325763 3300047471 Unclassified 1097
652 Ga0495602_0112543 3300048088 Unclassified 2209
653 Ga0495602_0153560 3300048088 Unclassified 1806
654 Ga0495602_0263342 3300048088 Bacteria 1278
655 Ga0496100_0006877 3300048903 Bacteria 6230
656 Ga0496100_0252700 3300048903 Bacteria 1304
657 Ga0496100_1219329 3300048903 Bacteria 594
658 Ga0496101_0040914 3300048904 Bacteria 3302
659 Ga0496101_1273749 3300048904 Unclassified 575
660 Ga0496102_0976511 3300048905 Unclassified 768
661 Ga0496104_0023520 3300048907 Bacteria 5665
662 Ga0496104_0800032 3300048907 Unclassified 849
663 Ga0496105_0024502 3300048908 Unclassified 4903
664 Ga0496105_0033315 3300048908 Bacteria 4229
665 Ga0496105_0313877 3300048908 Bacteria 1258
666 Ga0496107_0015330 3300048910 Bacteria 5370
667 Ga0496107_0055383 3300048910 Unclassified 2864
668 Ga0496110_0234798 3300048913 Bacteria 1668
669 Ga0496114_0052128 3300048917 Bacteria 3408
670 Ga0496114_0296303 3300048917 Bacteria 1428
671 Ga0496115_0040424 3300048918 Unclassified 3707
672 Ga0496115_0154171 3300048918 Unclassified 1897
673 Ga0496115_0269720 3300048918 Bacteria 1398
674 Ga0496115_0355317 3300048918 Unclassified 1195
675 Ga0496115_0553145 3300048918 Unclassified 919
676 Ga0496126_0000010 3300048929 Bacteria 744888
677 Ga0496126_0340037 3300048929 Bacteria 1230
678 Ga0495682_0263267 3300049460 Unclassified 609
679 Ga0495601_0253612 3300053077 Unclassified 1149
680 Ga0500644_0030343 3300053088 Bacteria 1709
681 Ga0500554_284451 3300053102 Unclassified 538
682 Ga0500595_032198 3300053119 Bacteria 1752
683 Ga0500661_000441 3300055283 Bacteria 7693
684 Ga0587084_028037 3300059477 Unclassified 889
685 Ga0587077_108308 3300059493 Unclassified 677
686 Ga0587086_040316 3300059507 Unclassified 721
687 Ga0587088_049105 3300059508 Unclassified 821
688 Ga0587090_123390 3300059510 Unclassified 564
689 Ga0587092_014861 3300059512 Bacteria 1133
690 Ga0587101_019722 3300059623 Unclassified 958
691 Ga0587109_033136 3300059624 Unclassified 991
692 Ga0587117_017967 3300059627 Unclassified 957
693 Ga0587127_005862 3300059629 Bacteria 855
694 Ga0587068_024958 3300059641 Unclassified 1004
695 Ga0587069_032617 3300059642 Unclassified 850
696 Ga0587072_185709 3300059643 Unclassified 521
697 Ga0587075_044164 3300059644 Unclassified 757
698 Ga0587119_020379 3300059658 Bacteria 842
699 Ga0587124_018382 3300059660 Unclassified 696
700 Ga0587111_0069032 3300060346 Unclassified 821
701 Ga0070661_101424695
702 rootH2_10042999
703 rootH2_10066083
704 rootH2_10066096
705 rootH1_10187309
706 Ga0065715_10375777
707 Ga0070658_10000142
708 Ga0070658_10005408
709 Ga0070658_10006481
710 Ga0070658_10010431
711 Ga0070658_10011101
712 Ga0070658_10273427
713 Ga0070658_11239601
714 Ga0070676_10013742
715 Ga0070683_100001294
716 Ga0070683_100026956
717 Ga0070683_100150487
718 Ga0070683_100214984
719 Ga0070683_100581527
720 Ga0070683_100658668
721 Ga0070690_100277073
722 Ga0070670_100002947
723 Ga0070670_100063184
724 Ga0068869_100001913
725 Ga0068869_100281621
726 Ga0070666_10062598
727 Ga0070666_10306518
728 Ga0070680_100081136
729 Ga0070680_100162693
730 Ga0070680_100620016
731 Ga0068868_100000009
732 Ga0068868_100015740
733 Ga0068868_100022926
734 Ga0070660_100000311
735 Ga0070660_100067433
736 Ga0070660_100135327
737 Ga0070660_100409213
738 Ga0070660_101435628
739 Ga0070661_100021911
740 Ga0070661_100136155
741 Ga0070661_100165020
742 Ga0070661_100274925
743 Ga0070661_100490448
744 Ga0070692_10543707
745 Ga0070668_100084709
746 Ga0070675_100034487
747 Ga0070671_100022721
748 Ga0070671_100154151
749 Ga0070671_100887489
750 Ga0070673_100010611
751 Ga0070659_100172730
752 Ga0070659_100181963
753 Ga0070667_100001882
754 Ga0070667_100012140
755 Ga0070709_10858029
756 Ga0070709_11236034
757 Ga0070714_100017303
758 Ga0070714_100168901
759 Ga0070714_100209289
760 Ga0070714_101293480
761 Ga0070714_102487064
762 Ga0070713_100003713
763 Ga0070713_100108311
764 Ga0070713_100190228
765 Ga0070713_100235136
766 Ga0070713_100256280
767 Ga0070713_100332734
768 Ga0070713_100978151
769 Ga0070713_101211836
770 Ga0070711_100221272
771 Ga0070711_100947947
772 Ga0070711_100979344
773 Ga0070663_100056019
774 Ga0070663_100188084
775 Ga0070663_100382837
776 Ga0070663_100489032
777 Ga0070663_100494166
778 Ga0070678_100062022
779 Ga0070662_100010729
780 Ga0070681_10000804
781 Ga0070681_10046056
782 Ga0070681_10387789
783 Ga0068867_100203700
784 Ga0068867_100525045
785 Ga0070685_11361589
786 Ga0070679_100000226
787 Ga0070679_100044742
788 Ga0070679_100607471
789 Ga0070684_100025564
790 Ga0070684_100078675
791 Ga0070684_100111897
792 Ga0070684_100216012
793 Ga0070684_100347897
794 Ga0070684_100446949
795 Ga0070684_100502105
796 Ga0068853_100000914
797 Ga0068853_100034028
798 Ga0068853_100037459
799 Ga0068853_100042984
800 Ga0070665_100024182
801 Ga0070665_100030820
802 Ga0070665_100069665
803 Ga0070665_100104651
804 Ga0070665_100169901
805 Ga0070665_100326624
806 Ga0068855_100003316
807 Ga0068855_100007673
808 Ga0068855_100015507
809 Ga0068855_100028667
810 Ga0068855_100032512
811 Ga0068855_100045317
812 Ga0068855_100074105
813 Ga0068855_100322461
814 Ga0068855_101603030
815 Ga0070664_100171960
816 Ga0068857_100000181
817 Ga0068857_100000269
818 Ga0068857_100014310
819 Ga0068857_100054215
820 Ga0068857_100055906
821 Ga0068857_100833861
822 Ga0068857_100972750
823 Ga0068854_100003621
824 Ga0068854_100030603
825 Ga0068854_100596284
826 Ga0068856_100000809
827 Ga0068856_100015932
828 Ga0068856_100017479
829 Ga0068856_100028898
830 Ga0068856_100076409
831 Ga0068856_100087860
832 Ga0068856_100129642
833 Ga0068856_100215543
834 Ga0068856_100241622
835 Ga0068856_100446206
836 Ga0068856_100481900
837 Ga0068856_100868069
838 Ga0068856_101224217
839 Ga0068856_101272533
840 Ga0068856_101713317
841 Ga0068852_100000199
842 Ga0068852_100000887
843 Ga0068852_100001654
844 Ga0068852_100027066
845 Ga0068852_100044386
846 Ga0068852_100097933
847 Ga0068852_100147539
848 Ga0068852_100203299
849 Ga0068852_100400092
850 Ga0068852_100419216
851 Ga0068852_100549498
852 Ga0068859_100002712
853 Ga0068859_100184430
854 Ga0068864_100003465
855 Ga0068864_100410702
856 Ga0068861_100428645
857 Ga0068851_10012603
858 Ga0068851_10026100
859 Ga0068851_10048580
860 Ga0068851_10149862
861 Ga0068863_100000273
862 Ga0068863_100019580
863 Ga0068858_100026536
864 Ga0068858_100058900
865 Ga0068858_100683606
866 Ga0068858_101913027
867 Ga0068860_100000031
868 Ga0068862_100112116
869 Ga0070717_10000898
870 Ga0070717_10576571
871 Ga0070717_10926923
872 Ga0070717_11022179
873 Ga0097621_100005630
874 Ga0097621_100007467
875 Ga0097621_101937389
876 Ga0097621_101977481
877 Ga0068871_100002198
878 Ga0068865_100044913
879 Ga0097620_100002712
880 Ga0097620_100184430
881 Ga0099794_10778805
882 Ga0105240_10000451
883 Ga0105240_10001070
884 Ga0105240_10002552
885 Ga0105240_10002933
886 Ga0105240_10003422
887 Ga0105240_10068958
888 Ga0105240_10092329
889 Ga0105240_10956117
890 Ga0105240_11043451
891 Ga0105240_11097967
892 Ga0105240_11610709
893 Ga0105240_12317437
894 Ga0105245_10003181
895 Ga0105245_10273907
896 Ga0105245_10318564
897 Ga0105247_10003136
898 Ga0105247_10037922
899 Ga0105247_10423707
900 Ga0105247_10600420
901 Ga0105247_11503282
902 Ga0105241_10000123
903 Ga0105241_10019959
904 Ga0105241_10098299
905 Ga0105241_10274294
906 Ga0105241_10292523
907 Ga0105242_10795250
908 Ga0105248_10000047
909 Ga0105248_10001233
910 Ga0105248_10187362
911 Ga0105237_10035217
912 Ga0105237_10048761
913 Ga0105237_10588877
914 Ga0105237_11062054
915 Ga0105238_10000334
916 Ga0105238_10011830
917 Ga0105238_10021179
918 Ga0105238_10027432
919 Ga0105238_10041018
920 Ga0105238_10212015
921 Ga0105238_10532705
922 Ga0105238_11869161
923 Ga0105238_12220059
924 Ga0105249_10037654
925 Ga0105249_10397884
926 Ga0105249_11746262
927 Ga0105239_10001864
928 Ga0105239_10014176
929 Ga0105239_10118191
930 Ga0105239_10163775
931 Ga0105239_10975988
932 Ga0105239_11491450
933 Ga0105239_11611946
934 Ga0105239_11937895
935 Ga0105246_10001815
936 Ga0157373_10547909
937 Ga0157371_10215085
938 Ga0157371_10226122
939 Ga0157371_10643964
940 Ga0157371_11537311
941 Ga0157370_10000542
942 Ga0157370_10010623
943 Ga0157370_10020842
944 Ga0157370_10035992
945 Ga0157370_10041906
946 Ga0157370_10077967
947 Ga0157370_10211653
948 Ga0157369_10001280
949 Ga0157369_10002372
950 Ga0157369_10002679
951 Ga0157369_10032494
952 Ga0157369_10046264
953 Ga0157369_10054341
954 Ga0157369_10055887
955 Ga0157369_10077934
956 Ga0157369_10081995
957 Ga0157369_10171211
958 Ga0157369_10213948
959 Ga0157369_10364961
960 Ga0157369_10419336
961 Ga0157369_10459021
962 Ga0157374_10002229
963 Ga0157374_10014906
964 Ga0157374_10145427
965 Ga0157374_10790048
966 Ga0157374_10806501
967 Ga0157374_10917756
968 Ga0157374_10929026
969 Ga0157374_11198623
970 Ga0157374_11430260
971 Ga0157374_12483266
972 Ga0157378_10007247
973 Ga0157378_10013136
974 Ga0157378_10647715
975 Ga0163162_10077817
976 Ga0163162_10231752
977 Ga0163162_10733848
978 Ga0163162_10931717
979 Ga0157372_10000408
980 Ga0157372_10002226
981 Ga0157372_10003039
982 Ga0157372_10003426
983 Ga0157372_10021880
984 Ga0157372_10025053
985 Ga0157372_10041630
986 Ga0157372_10047498
987 Ga0157372_10100329
988 Ga0157372_10102167
989 Ga0157372_10386506
990 Ga0157372_10393699
991 Ga0157372_10485241
992 Ga0157372_10704794
993 Ga0157372_10914201
994 Ga0157372_12904786
995 Ga0157375_10006678
996 Ga0157375_11553062
997 Ga0163163_10000237
998 Ga0163163_10759977
999 Ga0163163_10905378
1000 Ga0163163_11874661
1001 Ga0157377_10140699
1002 Ga0157377_10368702
1003 Ga0157379_10015308
1004 Ga0157379_10052254
1005 Ga0157379_10062672
1006 Ga0157379_10351789
1007 Ga0157379_10407930
1008 Ga0157379_10869796
1009 Ga0157376_10000386
1010 Ga0157376_10062577
1011 Ga0157376_10231004
1012 Ga0157376_10320068
1013 Ga0157376_10908825
1014 Ga0163161_10128650
1015 Ga0206352_10596306
1016 Ga0206350_11537616
1017 Ga0206353_10193638
1018 Ga0154015_1519660
1019 Ga0213875_10199458
1020 Ga0213875_10230869
1021 Ga0228598_1109088
1022 Ga0207656_10003780
1023 Ga0207656_10004677
1024 Ga0207710_10001408
1025 Ga0207680_10051850
1026 Ga0207680_10072280
1027 Ga0207647_10020414
1028 Ga0207647_10487376
1029 Ga0207699_10421939
1030 Ga0207645_10057989
1031 Ga0207705_10000020
1032 Ga0207705_10005946
1033 Ga0207705_10008749
1034 Ga0207705_10048665
1035 Ga0207705_10050352
1036 Ga0207705_10110854
1037 Ga0207654_10000078
1038 Ga0207654_10000095
1039 Ga0207654_10000236
1040 Ga0207654_10021215
1041 Ga0207654_10060307
1042 Ga0207654_10698751
1043 Ga0207707_10020940
1044 Ga0207707_10143838
1045 Ga0207707_10662634
1046 Ga0207707_11539939
1047 Ga0207695_10000075
1048 Ga0207695_10000145
1049 Ga0207695_10000787
1050 Ga0207695_10001098
1051 Ga0207695_10001570
1052 Ga0207695_10005982
1053 Ga0207695_10020928
1054 Ga0207695_10081808
1055 Ga0207695_10120524
1056 Ga0207695_10124594
1057 Ga0207671_10000032
1058 Ga0207671_10000324
1059 Ga0207671_10114340
1060 Ga0207671_10151264
1061 Ga0207671_10487113
1062 Ga0207693_11146856
1063 Ga0207663_10770651
1064 Ga0207660_10061047
1065 Ga0207657_10001924
1066 Ga0207657_10366494
1067 Ga0207657_10841480
1068 Ga0207649_10007760
1069 Ga0207649_10044728
1070 Ga0207649_10136784
1071 Ga0207649_10245554
1072 Ga0207649_10423824
1073 Ga0207649_10741705
1074 Ga0207652_10029748
1075 Ga0207652_10498832
1076 Ga0207652_10882957
1077 Ga0207694_10000024
1078 Ga0207694_10000259
1079 Ga0207694_10004199
1080 Ga0207694_10005121
1081 Ga0207694_10038917
1082 Ga0207694_10152373
1083 Ga0207694_10538152
1084 Ga0207694_10592570
1085 Ga0207650_10002268
1086 Ga0207650_10253359
1087 Ga0207659_10060389
1088 Ga0207687_10000208
1089 Ga0207687_10015318
1090 Ga0207687_10083925
1091 Ga0207687_10113093
1092 Ga0207700_10065471
1093 Ga0207700_10089799
1094 Ga0207700_10133289
1095 Ga0207700_10319184
1096 Ga0207700_10673156
1097 Ga0207700_10775773
1098 Ga0207700_11643728
1099 Ga0207664_10149234
1100 Ga0207664_10215984
1101 Ga0207664_10328096
1102 Ga0207664_10385618
1103 Ga0207644_10041760
1104 Ga0207690_10072881
1105 Ga0207690_10141739
1106 Ga0207706_10002070
1107 Ga0207686_11116609
1108 Ga0207704_10021101
1109 Ga0207665_10421223
1110 Ga0207711_10000040
1111 Ga0207711_10007378
1112 Ga0207711_10143846
1113 Ga0207711_10175034
1114 Ga0207689_10000487
1115 Ga0207689_10171493
1116 Ga0207661_10000123
1117 Ga0207661_10016981
1118 Ga0207661_10117736
1119 Ga0207661_10134026
1120 Ga0207661_10232131
1121 Ga0207661_10240726
1122 Ga0207661_10610603
1123 Ga0207661_10905406
1124 Ga0207679_10799658
1125 Ga0207667_10000188
1126 Ga0207667_10000659
1127 Ga0207667_10009596
1128 Ga0207667_10015503
1129 Ga0207667_10022471
1130 Ga0207667_10051723
1131 Ga0207667_10070194
1132 Ga0207667_10258308
1133 Ga0207667_10261180
1134 Ga0207667_10402885
1135 Ga0207667_11107841
1136 Ga0207651_10042316
1137 Ga0207712_10144166
1138 Ga0207712_10605126
1139 Ga0207712_10844064
1140 Ga0207668_10050977
1141 Ga0207640_10012003
1142 Ga0207640_10297816
1143 Ga0207658_10000135
1144 Ga0207658_10013447
1145 Ga0207677_10000034
1146 Ga0207677_10090329
1147 Ga0207703_10023052
1148 Ga0207703_10181957
1149 Ga0207703_10607108
1150 Ga0207639_10000050
1151 Ga0207639_10009673
1152 Ga0207639_10061719
1153 Ga0207639_10271473
1154 Ga0207639_10344726
1155 Ga0207678_10001214
1156 Ga0207678_10051293
1157 Ga0207678_10462456
1158 Ga0207678_10550219
1159 Ga0207702_10000109
1160 Ga0207702_10003095
1161 Ga0207702_10186276
1162 Ga0207702_10215466
1163 Ga0207702_10319703
1164 Ga0207702_10320706
1165 Ga0207702_10383608
1166 Ga0207702_10413592
1167 Ga0207702_10509872
1168 Ga0207702_10885189
1169 Ga0207702_12041854
1170 Ga0207641_10004397
1171 Ga0207641_10091516
1172 Ga0207648_10205244
1173 Ga0207676_10000316
1174 Ga0207674_10000815
1175 Ga0207674_10000968
1176 Ga0207674_10082621
1177 Ga0207674_10165399
1178 Ga0207683_10042955
1179 Ga0207698_10000129
1180 Ga0207698_10000393
1181 Ga0207698_10019288
1182 Ga0207698_10023255
1183 Ga0207698_10023960
1184 Ga0207698_10063497
1185 Ga0207698_10189601
1186 Ga0207698_10335910
1187 Ga0207698_11338344
1188 Ga0207698_11440199
1189 Ga0265354_1006393
1190 Ga0268266_10001402
1191 Ga0268266_10002790
1192 Ga0268266_10015978
1193 Ga0268266_10126035
1194 Ga0268266_10259411
1195 Ga0268266_10383842
1196 Ga0268266_11088112
1197 Ga0268265_10087580
1198 Ga0268264_10000540
1199 Ga0268264_10038935
1200 Ga0265318_10005203
1201 Ga0265318_10028158
1202 Ga0265323_10045661
1203 Ga0265336_10000499
1204 Ga0265336_10008807
1205 Ga0265338_10000529
1206 Ga0265338_10011218
1207 Ga0265338_10039724
1208 Ga0265338_10084444
1209 Ga0265338_10102619
1210 Ga0265338_10108441
1211 Ga0265338_10121178
1212 Ga0265338_10253757
1213 Ga0265338_10306454
1214 Ga0265338_10317333
1215 Ga0265338_10525947
1216 Ga0265338_10679159
1217 Ga0265338_10727030
1218 Ga0265324_10048953
1219 Ga0265770_1041445
1220 Ga0265760_10038134
1221 Ga0265330_10000726
1222 Ga0265330_10001029
1223 Ga0265330_10006052
1224 Ga0265330_10057097
1225 Ga0265330_10079413
1226 Ga0265330_10091461
1227 Ga0265330_10182470
1228 Ga0265328_10003631
1229 Ga0265328_10007337
1230 Ga0265328_10101610
1231 Ga0265328_10280140
1232 Ga0265325_10000249
1233 Ga0265325_10000335
1234 Ga0265325_10037046
1235 Ga0265325_10136484
1236 Ga0265325_10139868
1237 Ga0265325_10262046
1238 Ga0265329_10022784
1239 Ga0265329_10029539
1240 Ga0265329_10294832
1241 Ga0265340_10009847
1242 Ga0265340_10017776
1243 Ga0265340_10137139
1244 Ga0265340_10301751
1245 Ga0265339_10000183
1246 Ga0265339_10003154
1247 Ga0265339_10003965
1248 Ga0265339_10004030
1249 Ga0265339_10019838
1250 Ga0265339_10020874
1251 Ga0265339_10030191
1252 Ga0265339_10093982
1253 Ga0265339_10242787
1254 Ga0265327_10200930
1255 Ga0265327_10318951
1256 Ga0265316_10001212
1257 Ga0265316_10001361
1258 Ga0265316_10007811
1259 Ga0265316_10011127
1260 Ga0265316_10012098
1261 Ga0265316_10035952
1262 Ga0265316_10043045
1263 Ga0265316_10062172
1264 Ga0265316_10117671
1265 Ga0265316_10129118
1266 Ga0265316_10288897
1267 Ga0265316_10398234
1268 Ga0265316_10689119
1269 Ga0265313_10007115
1270 Ga0265313_10007256
1271 Ga0265313_10036859
1272 Ga0265313_10040410
1273 Ga0265313_10087658
1274 Ga0265314_10000239
1275 Ga0265314_10005184
1276 Ga0265314_10031922
1277 Ga0265314_10198084
1278 Ga0265342_10001134
1279 Ga0265342_10001693
1280 Ga0265342_10002138
1281 Ga0265342_10006731
1282 Ga0265342_10010813
1283 Ga0265342_10085101
1284 Ga0265342_10124818
1285 Ga0265342_10220666
1286 Ga0373954_0116407
1287 Ga0373956_0063787
1288 Ga0373955_0028996
1289 Ga0373955_0228085
1290 Ga0373955_0727978
1291 Ga0373924_0508109
1292 Ga0373935_0389820
1293 Ga0373933_0035547
1294 Ga0373937_0043808
1295 Ga0373937_0520558
1296 Ga0373937_1256123
1297 Ga0373925_0767781
1298 Ga0436364_0135193
1299 Ga0436364_0336794
1300 Ga0436360_1290831
1301 Ga0436362_1195660
1302 Ga0466969_0121069
1303 Ga0466969_0181573
1304 Ga0466961_0044708
1305 Ga0466961_0059942
1306 Ga0466961_0182123
1307 Ga0466963_0499998
1308 Ga0466971_0135604
1309 Ga0466959_0238849
1310 Ga0466967_0023757
1311 Ga0466967_0770059
1312 Ga0466967_1133987
1313 Ga0495629_0033730
1314 Ga0495629_0041392
1315 Ga0495629_0251369
1316 Ga0495651_0729820
1317 Ga0495650_0001877
1318 Ga0495580_0032557
1319 Ga0495580_0732900
1320 Ga0495582_0609372
1321 Ga0495639_0571303
1322 Ga0495664_0016591
1323 Ga0495628_0166508
1324 Ga0495652_0017267
1325 Ga0495665_0094382
1326 Ga0495665_0148265
1327 Ga0495587_0249133
1328 Ga0495587_0329117
1329 Ga0495645_0000851
1330 Ga0495645_0004067
1331 Ga0495645_0233260
1332 Ga0495634_0793123
1333 Ga0495625_0000377
1334 Ga0495635_0937244
1335 Ga0495657_0437144
1336 Ga0495623_0114051
1337 Ga0495646_0087380
1338 Ga0495613_0053082
1339 Ga0495613_0104672
1340 Ga0495613_0120640
1341 Ga0495613_0170750
1342 Ga0495613_0348711
1343 Ga0495649_0285420
1344 Ga0495600_0035008
1345 Ga0495604_0023379
1346 Ga0495604_0425424
1347 Ga0495674_0646254
1348 Ga0495674_1091190
1349 Ga0495672_0002094
1350 Ga0495684_0086302
1351 Ga0495684_0325763
1352 Ga0495602_0112543
1353 Ga0495602_0153560
1354 Ga0495602_0263342
1355 Ga0496100_0006877
1356 Ga0496100_0252700
1357 Ga0496100_1219329
1358 Ga0496101_0040914
1359 Ga0496101_1273749
1360 Ga0496102_0976511
1361 Ga0496104_0023520
1362 Ga0496104_0800032
1363 Ga0496105_0024502
1364 Ga0496105_0033315
1365 Ga0496105_0313877
1366 Ga0496107_0015330
1367 Ga0496107_0055383
1368 Ga0496110_0234798
1369 Ga0496114_0052128
1370 Ga0496114_0296303
1371 Ga0496115_0040424
1372 Ga0496115_0154171
1373 Ga0496115_0269720
1374 Ga0496115_0355317
1375 Ga0496115_0553145
1376 Ga0496126_0000010
1377 Ga0496126_0340037
1378 Ga0495682_0263267
1379 Ga0495601_0253612
1380 Ga0500644_0030343
1381 Ga0500554_284451
1382 Ga0500595_032198
1383 Ga0500661_000441
1384 Ga0587084_028037
1385 Ga0587077_108308
1386 Ga0587086_040316
1387 Ga0587088_049105
1388 Ga0587090_123390
1389 Ga0587092_014861
1390 Ga0587101_019722
1391 Ga0587109_033136
1392 Ga0587117_017967
1393 Ga0587127_005862
1394 Ga0587068_024958
1395 Ga0587069_032617
1396 Ga0587072_185709
1397 Ga0587075_044164
1398 Ga0587119_020379
1399 Ga0587124_018382
1400 Ga0587111_0069032

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13466

STAS_2

STAS domain

23

102

0.86

PF01740

STAS

STAS domain

11

114

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3if5-assembly1.cif.gz_A-2 crystal structure analysis of mglu 0.9377 20 86
3iha-assembly1.cif.gz_A-2 crystal structure analysis of mglu in its glutamate form 0.9306 20 86
3ih8-assembly1.cif.gz_A-2 crystal structure analysis of mglu in its native form 0.9242 20 86
3ihb-assembly1.cif.gz_A crystal structure analysis of mglu in its tris and glutamate form 0.9206 20 86
3ih8-assembly2.cif.gz_B-2 crystal structure analysis of mglu in its native form 0.9177 20 86
ID Description Score Start End Superfamily
3if5A02 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9377 20 86 3.30.750.24
3ihaA02 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9306 20 86 3.30.750.24
3ih8B02 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9177 20 86 3.30.750.24
af_A0A1D8PRZ2_628_764_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.872 22 118 3.30.750.24
af_Q09764_608_740_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.868 22 118 3.30.750.24
ID Description Score Start End GO Terms
AF-A0A5M8SBS2-F1-model_v4 STAS domain-containing protein 0.9953 1 119 GO:0043856
AF-A0A2D6NA53-F1-model_v4 Anti-anti-sigma factor 0.964 20 118 GO:0043856
AF-A0A3M1LFU2-F1-model_v4 Anti-sigma factor antagonist 0.9578 1 118 GO:0043856
AF-A0A359EIQ4-F1-model_v4 Anti-sigma factor antagonist 0.957 22 117 GO:0016020
GO:0043856
AF-A0A6A7LNS7-F1-model_v4 Anti-sigma factor antagonist 0.9459 4 118 GO:0043856

Map