F475723

General Info

Members Datasets Scaffolds Average Seq Length
694 254 1388 98

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10189478|Ga0111539_101894782
Length 114
Sequence LLIANFTINQQSAICIQQFPMFILDSLLIGSLRFVLDKVVQAAEAEMQDDSALRDQLLEAQMRLELGEITDDEFAETERDILAAIREIKRPQQGAISMSPTDKITGVDIDTFES

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
173 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
174 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
175 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
176 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
180 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
181 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
182 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
190 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
191 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
199 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
200 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
201 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
202 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
205 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
206 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
207 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
228 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
229 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
230 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
231 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
232 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
240 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
241 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
242 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
243 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
244 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
245 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
246 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
247 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
248 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
249 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
250 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
251 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
252 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 2.31
Rhizosphere 97.55
Stem 0
Stem Tuber 0
Unclassified 17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10189478 3300009094 Bacteria 2400
2 Ga0065712_10099405 3300005290 Bacteria 2067
3 Ga0065712_10280733 3300005290 Bacteria 896
4 Ga0065715_10166238 3300005293 Bacteria 1584
5 Ga0065715_10818428 3300005293 Unclassified 603
6 Ga0065707_10151415 3300005295 Bacteria 1654
7 Ga0070676_10128180 3300005328 Bacteria 1601
8 Ga0070676_10297606 3300005328 Bacteria 1093
9 Ga0070676_10653212 3300005328 Unclassified 764
10 Ga0070690_100185931 3300005330 Bacteria 1438
11 Ga0070690_100340064 3300005330 Unclassified 1086
12 Ga0070690_100610754 3300005330 Archaea 829
13 Ga0070690_100959205 3300005330 Bacteria 672
14 Ga0070670_100204597 3300005331 Bacteria 1715
15 Ga0070670_100615206 3300005331 Archaea 973
16 Ga0070670_100831526 3300005331 Unclassified 835
17 Ga0070677_10730027 3300005333 Bacteria 560
18 Ga0070677_10852617 3300005333 Archaea 524
19 Ga0068869_100124891 3300005334 Bacteria 1972
20 Ga0068869_100811097 3300005334 Bacteria 805
21 Ga0068869_100959319 3300005334 Unclassified 743
22 Ga0068869_101231260 3300005334 Bacteria 659
23 Ga0070666_10010955 3300005335 Bacteria 5682
24 Ga0070666_10473920 3300005335 Bacteria 906
25 Ga0070666_11153191 3300005335 Bacteria 577
26 Ga0070666_11189329 3300005335 Unclassified 568
27 Ga0070666_11352178 3300005335 Bacteria 532
28 Ga0070682_100421907 3300005337 Bacteria 1014
29 Ga0068868_100656317 3300005338 Bacteria 935
30 Ga0068868_100766866 3300005338 Bacteria 868
31 Ga0068868_100981334 3300005338 Bacteria 772
32 Ga0068868_101506987 3300005338 Archaea 630
33 Ga0068868_101676752 3300005338 Unclassified 599
34 Ga0070660_101797711 3300005339 Bacteria 522
35 Ga0070689_100063186 3300005340 Bacteria 2881
36 Ga0070689_100183015 3300005340 Bacteria 1703
37 Ga0070689_101359165 3300005340 Bacteria 641
38 Ga0070691_10048018 3300005341 Bacteria 2030
39 Ga0070691_10390558 3300005341 Bacteria 782
40 Ga0070687_100058087 3300005343 Unclassified 2031
41 Ga0070687_100616246 3300005343 Bacteria 748
42 Ga0070661_100542423 3300005344 Unclassified 935
43 Ga0070692_10367501 3300005345 Bacteria 899
44 Ga0070692_10719054 3300005345 Bacteria 674
45 Ga0070692_11019570 3300005345 Bacteria 580
46 Ga0070668_100053031 3300005347 Unclassified 3127
47 Ga0070669_100012638 3300005353 Bacteria 5992
48 Ga0070669_100035976 3300005353 Bacteria 3587
49 Ga0070669_100130152 3300005353 Bacteria 1930
50 Ga0070669_100193474 3300005353 Archaea 1597
51 Ga0070669_100283762 3300005353 Archaea 1327
52 Ga0070669_100976731 3300005353 Bacteria 726
53 Ga0070669_101496693 3300005353 Bacteria 587
54 Ga0070669_101496872 3300005353 Bacteria 587
55 Ga0070675_100103417 3300005354 Unclassified 2401
56 Ga0070675_100932578 3300005354 Bacteria 796
57 Ga0070675_101651763 3300005354 Unclassified 591
58 Ga0070671_100013155 3300005355 Bacteria 6667
59 Ga0070671_100278383 3300005355 Bacteria 1423
60 Ga0070671_101509848 3300005355 Bacteria 595
61 Ga0070674_100198969 3300005356 Bacteria 1546
62 Ga0070674_100669886 3300005356 Archaea 884
63 Ga0070674_101273094 3300005356 Bacteria 655
64 Ga0070674_101618125 3300005356 Archaea 584
65 Ga0070674_101844459 3300005356 Unclassified 549
66 Ga0070673_100132549 3300005364 Bacteria 2093
67 Ga0070673_100311843 3300005364 Bacteria 1388
68 Ga0070673_100682040 3300005364 Unclassified 942
69 Ga0070688_100020363 3300005365 Bacteria 3856
70 Ga0070688_100260597 3300005365 Bacteria 1238
71 Ga0070688_100521050 3300005365 Bacteria 900
72 Ga0070659_101760137 3300005366 Unclassified 555
73 Ga0070659_101772517 3300005366 Bacteria 553
74 Ga0070667_100043407 3300005367 Bacteria 3773
75 Ga0070667_100677530 3300005367 Bacteria 953
76 Ga0070667_101265908 3300005367 Bacteria 691
77 Ga0070703_10092727 3300005406 Bacteria 1050
78 Ga0070701_10167321 3300005438 Archaea 1278
79 Ga0070701_10836823 3300005438 Bacteria 630
80 Ga0070701_11397651 3300005438 Bacteria 503
81 Ga0070705_100080667 3300005440 Bacteria 1997
82 Ga0070700_100029372 3300005441 Bacteria 3277
83 Ga0070700_100070311 3300005441 Archaea 2231
84 Ga0070700_100266028 3300005441 Bacteria 1237
85 Ga0070700_101177841 3300005441 Unclassified 639
86 Ga0070694_100055381 3300005444 Bacteria 2689
87 Ga0070694_100514133 3300005444 Bacteria 954
88 Ga0070694_100521795 3300005444 Bacteria 948
89 Ga0070708_101149562 3300005445 Unclassified 727
90 Ga0070663_100714692 3300005455 Bacteria 853
91 Ga0070663_101722392 3300005455 Archaea 561
92 Ga0070678_100002975 3300005456 Bacteria 9387
93 Ga0070678_100268977 3300005456 Bacteria 1437
94 Ga0070662_100115090 3300005457 Bacteria 2054
95 Ga0070662_100557501 3300005457 Unclassified 961
96 Ga0070662_101880886 3300005457 Bacteria 517
97 Ga0070681_10020705 3300005458 Bacteria 6589
98 Ga0068867_100008447 3300005459 Bacteria 7263
99 Ga0068867_100568085 3300005459 Bacteria 985
100 Ga0068867_100699627 3300005459 Bacteria 894
101 Ga0068867_100854103 3300005459 Viruses 816
102 Ga0068867_101076614 3300005459 Bacteria 733
103 Ga0068867_101177237 3300005459 Archaea 703
104 Ga0068867_101729705 3300005459 Bacteria 587
105 Ga0068867_102188177 3300005459 Bacteria 525
106 Ga0070706_100376424 3300005467 Bacteria 1323
107 Ga0070706_101253387 3300005467 Bacteria 681
108 Ga0070707_100007948 3300005468 Bacteria 9848
109 Ga0070707_100035171 3300005468 Bacteria 4778
110 Ga0070707_101012646 3300005468 Bacteria 796
111 Ga0070698_100086555 3300005471 Bacteria 3120
112 Ga0070698_100199666 3300005471 Bacteria 1936
113 Ga0070698_101147873 3300005471 Unclassified 726
114 Ga0070698_101713106 3300005471 Unclassified 581
115 Ga0070698_101973079 3300005471 Unclassified 537
116 Ga0070699_100283610 3300005518 Bacteria 1484
117 Ga0070699_100447732 3300005518 Unclassified 1171
118 Ga0070679_100036059 3300005530 Bacteria 4907
119 Ga0070679_100748615 3300005530 Bacteria 920
120 Ga0070684_100550043 3300005535 Bacteria 1071
121 Ga0070697_100317788 3300005536 Bacteria 1340
122 Ga0070697_100344820 3300005536 Archaea 1286
123 Ga0070697_100776945 3300005536 Bacteria 847
124 Ga0068853_100439309 3300005539 Bacteria 1226
125 Ga0068853_101401521 3300005539 Bacteria 676
126 Ga0070672_100218332 3300005543 Unclassified 1599
127 Ga0070672_100267132 3300005543 Bacteria 1444
128 Ga0070672_100618195 3300005543 Bacteria 945
129 Ga0070686_100011506 3300005544 Bacteria 5019
130 Ga0070686_100218942 3300005544 Bacteria 1375
131 Ga0070686_100365673 3300005544 Bacteria 1088
132 Ga0070686_100535832 3300005544 Bacteria 914
133 Ga0070686_100580258 3300005544 Bacteria 881
134 Ga0070686_100881247 3300005544 Bacteria 727
135 Ga0070686_101949278 3300005544 Unclassified 502
136 Ga0070695_100070376 3300005545 Bacteria 2288
137 Ga0070695_100687972 3300005545 Bacteria 811
138 Ga0070695_100995215 3300005545 Archaea 682
139 Ga0070695_101588769 3300005545 Unclassified 546
140 Ga0070696_100037273 3300005546 Bacteria 3354
141 Ga0070696_100066986 3300005546 Bacteria 2519
142 Ga0070696_100092906 3300005546 Bacteria 2151
143 Ga0070696_100281014 3300005546 Unclassified 1269
144 Ga0070696_100787841 3300005546 Unclassified 782
145 Ga0070665_100003400 3300005548 Bacteria 17010
146 Ga0070665_100047433 3300005548 Bacteria 4311
147 Ga0070665_100232920 3300005548 Archaea 1842
148 Ga0070665_101372620 3300005548 Archaea 716
149 Ga0070704_100019913 3300005549 Bacteria 4318
150 Ga0070704_100115556 3300005549 Unclassified 2050
151 Ga0070704_100218685 3300005549 Unclassified 1548
152 Ga0068855_101265709 3300005563 Bacteria 765
153 Ga0070664_100334790 3300005564 Unclassified 1374
154 Ga0070664_100917018 3300005564 Bacteria 822
155 Ga0068857_100961881 3300005577 Bacteria 821
156 Ga0068854_100100390 3300005578 Bacteria 2169
157 Ga0068854_100111814 3300005578 Bacteria 2061
158 Ga0068854_100228766 3300005578 Bacteria 1475
159 Ga0070702_100013261 3300005615 Bacteria 4157
160 Ga0068852_100357853 3300005616 Bacteria 1427
161 Ga0068852_101116371 3300005616 Unclassified 809
162 Ga0068859_100145751 3300005617 Archaea 2443
163 Ga0068859_100271611 3300005617 Bacteria 1788
164 Ga0068859_100357736 3300005617 Unclassified 1555
165 Ga0068859_100768122 3300005617 Unclassified 1052
166 Ga0068859_100894364 3300005617 Unclassified 973
167 Ga0068859_102366047 3300005617 Bacteria 585
168 Ga0068859_102381651 3300005617 Unclassified 583
169 Ga0068864_100023489 3300005618 Bacteria 5178
170 Ga0068864_100090611 3300005618 Bacteria 2696
171 Ga0068864_100421016 3300005618 Bacteria 1273
172 Ga0068864_100535212 3300005618 Archaea 1131
173 Ga0068866_10246928 3300005718 Bacteria 1090
174 Ga0068866_10842006 3300005718 Bacteria 641
175 Ga0068866_11020500 3300005718 Unclassified 589
176 Ga0068861_100082599 3300005719 Bacteria 2518
177 Ga0068861_100104023 3300005719 Archaea 2264
178 Ga0068861_100378029 3300005719 Bacteria 1250
179 Ga0068861_100378647 3300005719 Bacteria 1250
180 Ga0068861_100637100 3300005719 Bacteria 983
181 Ga0068861_100794570 3300005719 Bacteria 888
182 Ga0068861_101017946 3300005719 Unclassified 792
183 Ga0068861_101683488 3300005719 Unclassified 627
184 Ga0068851_10430291 3300005834 Bacteria 781
185 Ga0068863_100003679 3300005841 Bacteria 15145
186 Ga0068863_100130130 3300005841 Bacteria 2403
187 Ga0068863_100210249 3300005841 Bacteria 1873
188 Ga0068863_101027205 3300005841 Bacteria 827
189 Ga0068858_100002279 3300005842 Bacteria 19420
190 Ga0068858_100160908 3300005842 Bacteria 2114
191 Ga0068858_100325479 3300005842 Unclassified 1469
192 Ga0068858_100355323 3300005842 Bacteria 1404
193 Ga0068858_100386345 3300005842 Bacteria 1343
194 Ga0068858_100583919 3300005842 Bacteria 1083
195 Ga0068858_100611405 3300005842 Archaea 1058
196 Ga0068858_100765994 3300005842 Unclassified 941
197 Ga0068858_100776886 3300005842 Archaea 934
198 Ga0068860_100109358 3300005843 Bacteria 2642
199 Ga0068860_100228898 3300005843 Bacteria 1806
200 Ga0068860_100338199 3300005843 Bacteria 1480
201 Ga0068860_100742523 3300005843 Unclassified 993
202 Ga0068860_101503839 3300005843 Bacteria 695
203 Ga0068860_101562131 3300005843 Bacteria 682
204 Ga0068860_102414599 3300005843 Bacteria 546
205 Ga0068862_100021982 3300005844 Bacteria 5335
206 Ga0068862_100046032 3300005844 Bacteria 3723
207 Ga0068862_100186467 3300005844 Bacteria 1864
208 Ga0068862_100247623 3300005844 Bacteria 1623
209 Ga0068862_100368341 3300005844 Archaea 1337
210 Ga0068862_100377225 3300005844 Unclassified 1322
211 Ga0068862_100401963 3300005844 Unclassified 1281
212 Ga0068862_102437167 3300005844 Bacteria 535
213 Ga0081455_10057716 3300005937 Bacteria 3289
214 Ga0081455_10462613 3300005937 Unclassified 863
215 Ga0075432_10532851 3300006058 Unclassified 528
216 Ga0070715_10723557 3300006163 Archaea 597
217 Ga0070716_100930704 3300006173 Archaea 683
218 Ga0097621_100036830 3300006237 Bacteria 3915
219 Ga0097621_100180733 3300006237 Bacteria 1823
220 Ga0097621_100342059 3300006237 Archaea 1329
221 Ga0097621_101162998 3300006237 Bacteria 726
222 Ga0068871_100002816 3300006358 Bacteria 11897
223 Ga0068871_100248224 3300006358 Bacteria 1549
224 Ga0068871_100707926 3300006358 Bacteria 923
225 Ga0068871_100956358 3300006358 Bacteria 796
226 Ga0075428_100978967 3300006844 Unclassified 896
227 Ga0075428_102722955 3300006844 Bacteria 504
228 Ga0075430_100393856 3300006846 Bacteria 1143
229 Ga0075430_100620502 3300006846 Bacteria 892
230 Ga0075431_100226709 3300006847 Unclassified 1905
231 Ga0075431_100608726 3300006847 Unclassified 1076
232 Ga0075433_10035341 3300006852 Bacteria 4296
233 Ga0075433_10657382 3300006852 Bacteria 919
234 Ga0075433_10745609 3300006852 Unclassified 857
235 Ga0075434_100112795 3300006871 Bacteria 2730
236 Ga0075434_101226862 3300006871 Unclassified 762
237 Ga0075434_101285477 3300006871 Bacteria 743
238 Ga0075434_101862800 3300006871 Bacteria 608
239 Ga0075434_102449536 3300006871 Bacteria 523
240 Ga0075429_100029031 3300006880 Bacteria 4803
241 Ga0075429_100565260 3300006880 Unclassified 997
242 Ga0075429_101134634 3300006880 Unclassified 683
243 Ga0068865_100014135 3300006881 Bacteria 5067
244 Ga0068865_101347331 3300006881 Bacteria 636
245 Ga0075436_100504170 3300006914 Bacteria 885
246 Ga0075436_100571974 3300006914 Archaea 831
247 Ga0075436_100575889 3300006914 Bacteria 828
248 Ga0097620_100145750 3300006931 Archaea 2443
249 Ga0097620_100271609 3300006931 Bacteria 1788
250 Ga0097620_100357753 3300006931 Unclassified 1555
251 Ga0097620_100768186 3300006931 Unclassified 1052
252 Ga0097620_100894369 3300006931 Unclassified 973
253 Ga0097620_102366055 3300006931 Bacteria 585
254 Ga0097620_102381588 3300006931 Unclassified 583
255 Ga0075435_100007103 3300007076 Bacteria 7952
256 Ga0075435_100032589 3300007076 Bacteria 4116
257 Ga0075435_100091823 3300007076 Bacteria 2506
258 Ga0075435_100178983 3300007076 Archaea 1792
259 Ga0075435_100397182 3300007076 Bacteria 1185
260 Ga0075435_100711831 3300007076 Bacteria 873
261 Ga0075435_100744620 3300007076 Bacteria 852
262 Ga0075435_101594856 3300007076 Bacteria 573
263 Ga0105251_10068938 3300009011 Bacteria 1650
264 Ga0105240_10230810 3300009093 Bacteria 2151
265 Ga0105240_10750903 3300009093 Unclassified 1061
266 Ga0105240_10983396 3300009093 Unclassified 903
267 Ga0111539_10076641 3300009094 Bacteria 3937
268 Ga0111539_10223956 3300009094 Bacteria 2191
269 Ga0111539_10501640 3300009094 Bacteria 1413
270 Ga0111539_10963437 3300009094 Bacteria 992
271 Ga0111539_11322872 3300009094 Bacteria 836
272 Ga0111539_12166153 3300009094 Archaea 645
273 Ga0111539_13325916 3300009094 Bacteria 517
274 Ga0105245_10374813 3300009098 Bacteria 1416
275 Ga0105245_10676438 3300009098 Bacteria 1064
276 Ga0105245_11481501 3300009098 Unclassified 729
277 Ga0105245_12298702 3300009098 Archaea 593
278 Ga0105245_12593794 3300009098 Bacteria 560
279 Ga0105247_10144751 3300009101 Bacteria 1561
280 Ga0105247_10700959 3300009101 Bacteria 762
281 Ga0114129_10000838 3300009147 Bacteria 39812
282 Ga0114129_10001577 3300009147 Bacteria 30953
283 Ga0114129_10004177 3300009147 Bacteria 20401
284 Ga0114129_10004637 3300009147 Bacteria 19399
285 Ga0114129_10138930 3300009147 Bacteria 3332
286 Ga0114129_10354451 3300009147 Bacteria 1943
287 Ga0114129_10687209 3300009147 Bacteria 1317
288 Ga0114129_11245838 3300009147 Bacteria 924
289 Ga0114129_12280052 3300009147 Bacteria 650
290 Ga0114129_13127192 3300009147 Archaea 540
291 Ga0105243_10020242 3300009148 Bacteria 5046
292 Ga0105243_11878765 3300009148 Bacteria 631
293 Ga0105241_10057534 3300009174 Bacteria 2983
294 Ga0105241_10229832 3300009174 Bacteria 1563
295 Ga0105242_10001523 3300009176 Bacteria 18223
296 Ga0105242_10005108 3300009176 Bacteria 10122
297 Ga0105242_11241356 3300009176 Bacteria 766
298 Ga0105242_11382200 3300009176 Bacteria 731
299 Ga0105242_11788430 3300009176 Unclassified 653
300 Ga0105248_10001706 3300009177 Bacteria 24451
301 Ga0105248_10067041 3300009177 Bacteria 4029
302 Ga0105248_10097629 3300009177 Bacteria 3310
303 Ga0105248_10140472 3300009177 Bacteria 2725
304 Ga0105248_10160532 3300009177 Bacteria 2536
305 Ga0105248_10652841 3300009177 Bacteria 1187
306 Ga0105248_10673652 3300009177 Bacteria 1167
307 Ga0105248_11677429 3300009177 Bacteria 720
308 Ga0105248_11881978 3300009177 Unclassified 679
309 Ga0105248_11896797 3300009177 Unclassified 676
310 Ga0105248_12308344 3300009177 Bacteria 612
311 Ga0105248_13284191 3300009177 Bacteria 514
312 Ga0105237_10934287 3300009545 Bacteria 874
313 Ga0105238_10060920 3300009551 Bacteria 3777
314 Ga0105238_10938619 3300009551 Bacteria 884
315 Ga0105238_11487409 3300009551 Unclassified 706
316 Ga0105249_10024006 3300009553 Bacteria 5476
317 Ga0105249_10161530 3300009553 Bacteria 2166
318 Ga0105249_10383040 3300009553 Bacteria 1433
319 Ga0105249_10495390 3300009553 Unclassified 1266
320 Ga0105249_11981975 3300009553 Unclassified 655
321 Ga0105249_12375774 3300009553 Unclassified 603
322 Ga0105249_12981959 3300009553 Bacteria 543
323 Ga0105246_10939249 3300011119 Unclassified 779
324 Ga0105246_11076156 3300011119 Bacteria 733
325 Ga0105246_12573797 3300011119 Viruses 502
326 Ga0157374_10021102 3300013296 Bacteria 5789
327 Ga0157374_11537839 3300013296 Bacteria 689
328 Ga0157378_10212704 3300013297 Bacteria 1834
329 Ga0157378_10409942 3300013297 Bacteria 1337
330 Ga0157378_11356340 3300013297 Bacteria 753
331 Ga0163162_10134588 3300013306 Unclassified 2582
332 Ga0163162_10344462 3300013306 Bacteria 1623
333 Ga0163162_10492848 3300013306 Bacteria 1356
334 Ga0157375_10529370 3300013308 Bacteria 1341
335 Ga0157375_11382704 3300013308 Bacteria 829
336 Ga0157375_12757710 3300013308 Unclassified 587
337 Ga0157375_12880148 3300013308 Bacteria 575
338 Ga0157375_13404656 3300013308 Archaea 530
339 Ga0163163_10019537 3300014325 Bacteria 6364
340 Ga0163163_10528318 3300014325 Archaea 1242
341 Ga0157380_10682478 3300014326 Bacteria 1029
342 Ga0157380_11092706 3300014326 Archaea 836
343 Ga0157380_11596730 3300014326 Bacteria 708
344 Ga0157380_12104872 3300014326 Unclassified 627
345 Ga0157377_10091484 3300014745 Bacteria 1797
346 Ga0157377_11285447 3300014745 Unclassified 571
347 Ga0157379_10010879 3300014968 Bacteria 7930
348 Ga0157379_10081805 3300014968 Bacteria 2893
349 Ga0157379_10291696 3300014968 Bacteria 1486
350 Ga0157379_10312953 3300014968 Archaea 1433
351 Ga0157379_10908679 3300014968 Bacteria 835
352 Ga0157379_11398491 3300014968 Unclassified 678
353 Ga0157376_10018012 3300014969 Bacteria 5403
354 Ga0157376_10024132 3300014969 Bacteria 4770
355 Ga0157376_10110081 3300014969 Bacteria 2423
356 Ga0157376_10438351 3300014969 Bacteria 1271
357 Ga0157376_11310854 3300014969 Bacteria 754
358 Ga0163161_10526330 3300017792 Bacteria 966
359 Ga0163161_10616164 3300017792 Bacteria 896
360 Ga0206354_10735054 3300020081 Bacteria 659
361 Ga0207697_10151405 3300025315 Unclassified 1009
362 Ga0207697_10307711 3300025315 Bacteria 703
363 Ga0207713_1096470 3300025735 Bacteria 1028
364 Ga0207653_10327770 3300025885 Bacteria 596
365 Ga0207682_10264646 3300025893 Bacteria 802
366 Ga0207682_10267267 3300025893 Bacteria 798
367 Ga0207692_10662178 3300025898 Bacteria 675
368 Ga0207642_10304025 3300025899 Bacteria 926
369 Ga0207642_10610006 3300025899 Archaea 680
370 Ga0207710_10132501 3300025900 Bacteria 1198
371 Ga0207688_10415935 3300025901 Bacteria 835
372 Ga0207688_10727114 3300025901 Bacteria 628
373 Ga0207680_10021562 3300025903 Bacteria 3488
374 Ga0207680_10814625 3300025903 Unclassified 669
375 Ga0207680_10967750 3300025903 Bacteria 610
376 Ga0207645_10002699 3300025907 Bacteria 13827
377 Ga0207645_10512813 3300025907 Unclassified 812
378 Ga0207643_10105926 3300025908 Unclassified 1652
379 Ga0207684_11031258 3300025910 Unclassified 687
380 Ga0207654_10047404 3300025911 Bacteria 2455
381 Ga0207707_10025126 3300025912 Bacteria 5210
382 Ga0207707_10900361 3300025912 Archaea 731
383 Ga0207695_10065699 3300025913 Bacteria 3729
384 Ga0207695_10172772 3300025913 Bacteria 2085
385 Ga0207671_10613069 3300025914 Bacteria 867
386 Ga0207662_10043867 3300025918 Bacteria 2639
387 Ga0207662_10614414 3300025918 Bacteria 757
388 Ga0207662_11210867 3300025918 Bacteria 537
389 Ga0207649_10485877 3300025920 Bacteria 937
390 Ga0207652_10027474 3300025921 Bacteria 4741
391 Ga0207652_10669033 3300025921 Bacteria 928
392 Ga0207646_10065947 3300025922 Bacteria 3232
393 Ga0207646_10117358 3300025922 Unclassified 2390
394 Ga0207646_10706294 3300025922 Bacteria 901
395 Ga0207681_10004545 3300025923 Bacteria 8545
396 Ga0207681_10095532 3300025923 Bacteria 2132
397 Ga0207681_10247031 3300025923 Archaea 1391
398 Ga0207681_11177181 3300025923 Unclassified 644
399 Ga0207681_11434409 3300025923 Bacteria 579
400 Ga0207694_10397489 3300025924 Bacteria 1146
401 Ga0207694_10706803 3300025924 Unclassified 850
402 Ga0207694_10827128 3300025924 Bacteria 782
403 Ga0207694_11006703 3300025924 Unclassified 705
404 Ga0207650_10262482 3300025925 Bacteria 1401
405 Ga0207650_10509457 3300025925 Archaea 1006
406 Ga0207650_10740189 3300025925 Bacteria 832
407 Ga0207650_10742257 3300025925 Unclassified 830
408 Ga0207650_11106874 3300025925 Unclassified 674
409 Ga0207650_11159312 3300025925 Viruses 658
410 Ga0207659_10135825 3300025926 Bacteria 1903
411 Ga0207659_10330567 3300025926 Bacteria 1260
412 Ga0207659_10602902 3300025926 Bacteria 936
413 Ga0207687_10021519 3300025927 Bacteria 4285
414 Ga0207687_10030764 3300025927 Bacteria 3622
415 Ga0207687_10356828 3300025927 Unclassified 1192
416 Ga0207687_10386845 3300025927 Bacteria 1147
417 Ga0207687_10695276 3300025927 Bacteria 863
418 Ga0207644_10141270 3300025931 Bacteria 1854
419 Ga0207644_10387568 3300025931 Bacteria 1140
420 Ga0207644_10656479 3300025931 Unclassified 873
421 Ga0207690_11329582 3300025932 Unclassified 601
422 Ga0207706_10016955 3300025933 Bacteria 6570
423 Ga0207706_10242040 3300025933 Bacteria 1577
424 Ga0207706_10440862 3300025933 Bacteria 1127
425 Ga0207706_10470776 3300025933 Archaea 1086
426 Ga0207706_10603286 3300025933 Bacteria 943
427 Ga0207706_11619776 3300025933 Unclassified 524
428 Ga0207686_10003296 3300025934 Bacteria 8681
429 Ga0207686_10006807 3300025934 Bacteria 6155
430 Ga0207686_10527045 3300025934 Bacteria 920
431 Ga0207686_10918235 3300025934 Bacteria 707
432 Ga0207709_10482784 3300025935 Bacteria 964
433 Ga0207709_10888150 3300025935 Archaea 724
434 Ga0207670_10109540 3300025936 Unclassified 1988
435 Ga0207669_10167972 3300025937 Bacteria 1558
436 Ga0207669_10857761 3300025937 Bacteria 756
437 Ga0207669_11804130 3300025937 Bacteria 523
438 Ga0207704_10014758 3300025938 Bacteria 3957
439 Ga0207704_10405209 3300025938 Unclassified 1077
440 Ga0207704_10838256 3300025938 Bacteria 770
441 Ga0207665_10626190 3300025939 Bacteria 842
442 Ga0207665_11162805 3300025939 Bacteria 615
443 Ga0207691_10006739 3300025940 Bacteria 11079
444 Ga0207691_10326821 3300025940 Bacteria 1314
445 Ga0207691_10365328 3300025940 Bacteria 1233
446 Ga0207691_10435255 3300025940 Bacteria 1117
447 Ga0207711_10058797 3300025941 Bacteria 3310
448 Ga0207711_10061107 3300025941 Bacteria 3248
449 Ga0207711_10204970 3300025941 Bacteria 1800
450 Ga0207711_10254075 3300025941 Bacteria 1614
451 Ga0207711_11659773 3300025941 Archaea 582
452 Ga0207711_11783372 3300025941 Bacteria 559
453 Ga0207679_10170918 3300025945 Bacteria 1789
454 Ga0207679_10481136 3300025945 Bacteria 1105
455 Ga0207679_12047027 3300025945 Bacteria 521
456 Ga0207651_10102070 3300025960 Bacteria 2131
457 Ga0207651_10329955 3300025960 Bacteria 1278
458 Ga0207651_10986443 3300025960 Unclassified 752
459 Ga0207651_11166865 3300025960 Bacteria 691
460 Ga0207712_10854370 3300025961 Bacteria 802
461 Ga0207712_12089552 3300025961 Bacteria 507
462 Ga0207668_10048499 3300025972 Bacteria 2915
463 Ga0207640_10001188 3300025981 Bacteria 14232
464 Ga0207640_10062617 3300025981 Bacteria 2469
465 Ga0207640_10186924 3300025981 Bacteria 1558
466 Ga0207640_10636153 3300025981 Unclassified 907
467 Ga0207658_10128020 3300025986 Bacteria 2035
468 Ga0207658_10864233 3300025986 Bacteria 823
469 Ga0207658_11916983 3300025986 Bacteria 540
470 Ga0207677_10064418 3300026023 Bacteria 2552
471 Ga0207677_10400882 3300026023 Bacteria 1163
472 Ga0207677_10639480 3300026023 Bacteria 938
473 Ga0207677_10856051 3300026023 Unclassified 817
474 Ga0207677_11590969 3300026023 Archaea 605
475 Ga0207703_10002624 3300026035 Bacteria 15514
476 Ga0207703_10026203 3300026035 Bacteria 4587
477 Ga0207703_10196218 3300026035 Bacteria 1791
478 Ga0207703_10279826 3300026035 Bacteria 1515
479 Ga0207703_10311542 3300026035 Unclassified 1439
480 Ga0207703_10596152 3300026035 Archaea 1045
481 Ga0207703_11665924 3300026035 Unclassified 613
482 Ga0207639_10954945 3300026041 Bacteria 802
483 Ga0207639_11265646 3300026041 Unclassified 692
484 Ga0207708_10002578 3300026075 Bacteria 13332
485 Ga0207708_10046123 3300026075 Archaea 3320
486 Ga0207708_10321701 3300026075 Archaea 1262
487 Ga0207708_10380110 3300026075 Bacteria 1164
488 Ga0207708_10475015 3300026075 Bacteria 1045
489 Ga0207641_10004435 3300026088 Bacteria 12160
490 Ga0207641_10025288 3300026088 Bacteria 4896
491 Ga0207641_10110474 3300026088 Bacteria 2436
492 Ga0207641_10135499 3300026088 Bacteria 2216
493 Ga0207641_11408106 3300026088 Bacteria 698
494 Ga0207641_12358226 3300026088 Bacteria 531
495 Ga0207648_10005685 3300026089 Bacteria 12505
496 Ga0207648_10122562 3300026089 Bacteria 2286
497 Ga0207648_10233710 3300026089 Unclassified 1636
498 Ga0207648_10429696 3300026089 Bacteria 1200
499 Ga0207648_10499133 3300026089 Bacteria 1113
500 Ga0207648_10549475 3300026089 Bacteria 1061
501 Ga0207648_11107449 3300026089 Bacteria 743
502 Ga0207676_10135496 3300026095 Bacteria 2100
503 Ga0207676_10315146 3300026095 Bacteria 1433
504 Ga0207676_10408785 3300026095 Bacteria 1270
505 Ga0207676_10949392 3300026095 Bacteria 845
506 Ga0207676_11552738 3300026095 Bacteria 659
507 Ga0207676_11563286 3300026095 Bacteria 657
508 Ga0207674_11241187 3300026116 Bacteria 715
509 Ga0207675_100000451 3300026118 Bacteria 39879
510 Ga0207675_100018594 3300026118 Archaea 6484
511 Ga0207675_100030279 3300026118 Bacteria 5041
512 Ga0207675_100272056 3300026118 Bacteria 1644
513 Ga0207675_100306196 3300026118 Bacteria 1548
514 Ga0207675_100544734 3300026118 Bacteria 1159
515 Ga0207675_100585521 3300026118 Bacteria 1117
516 Ga0207675_101234607 3300026118 Bacteria 768
517 Ga0207675_101809708 3300026118 Unclassified 630
518 Ga0207683_10001757 3300026121 Bacteria 19177
519 Ga0207683_10255769 3300026121 Bacteria 1599
520 Ga0207683_10329140 3300026121 Bacteria 1400
521 Ga0207683_10497705 3300026121 Bacteria 1125
522 Ga0207683_11591636 3300026121 Bacteria 602
523 Ga0207698_10108779 3300026142 Bacteria 2318
524 Ga0207698_10682244 3300026142 Bacteria 1021
525 Ga0207428_10028433 3300027907 Bacteria 4645
526 Ga0207428_10155556 3300027907 Bacteria 1739
527 Ga0207428_10925666 3300027907 Bacteria 615
528 Ga0268266_10077843 3300028379 Bacteria 2884
529 Ga0268266_10233258 3300028379 Bacteria 1696
530 Ga0268265_10012197 3300028380 Bacteria 5820
531 Ga0268265_10149407 3300028380 Bacteria 1968
532 Ga0268265_10163970 3300028380 Unclassified 1892
533 Ga0268265_10341587 3300028380 Bacteria 1363
534 Ga0268265_10501539 3300028380 Archaea 1144
535 Ga0268265_11703682 3300028380 Bacteria 636
536 Ga0268265_12021292 3300028380 Bacteria 583
537 Ga0268264_10086663 3300028381 Bacteria 2691
538 Ga0268264_10652364 3300028381 Unclassified 1042
539 Ga0268264_11034837 3300028381 Bacteria 828
540 Ga0268264_11347406 3300028381 Unclassified 724
541 Ga0268264_12399292 3300028381 Unclassified 533
542 Ga0268264_12704921 3300028381 Bacteria 500
543 Ga0265773_1028875 3300031018 Bacteria 586
544 Ga0307408_100014234 3300031548 Bacteria 5283
545 Ga0307406_10046116 3300031901 Bacteria 2741
546 Ga0307412_10270340 3300031911 Bacteria 1330
547 Ga0307416_100049803 3300032002 Bacteria 3334
548 Ga0307416_100056811 3300032002 Bacteria 3161
549 Ga0307411_11182674 3300032005 Bacteria 692
550 Ga0307415_100919263 3300032126 Bacteria 808
551 Ga0373929_0069335 3300035085 Bacteria 841
552 Ga0373949_0012221 3300035090 Bacteria 1897
553 Ga0373952_0059872 3300035092 Archaea 929
554 Ga0373939_0100605 3300035114 Bacteria 991
555 Ga0373941_0333452 3300035115 Bacteria 613
556 Ga0373943_0562471 3300035170 Viruses 670
557 Ga0373955_0450321 3300035172 Bacteria 784
558 Ga0373942_0053727 3300035207 Unclassified 1137
559 Ga0373961_0444105 3300035241 Unclassified 505
560 Ga0373962_0107645 3300035242 Bacteria 876
561 Ga0373924_0299198 3300035410 Bacteria 714
562 Ga0373931_0570625 3300035691 Bacteria 737
563 Ga0373935_0713707 3300035692 Bacteria 738
564 Ga0373947_0275291 3300035725 Bacteria 1118
565 Ga0373937_0288281 3300036401 Bacteria 1551
566 Ga0373937_1589918 3300036401 Bacteria 601
567 Ga0373925_0633000 3300037068 Bacteria 881
568 Ga0395900_1281147 3300037418 Archaea 647
569 Ga0439435_0002137 3300042436 Bacteria 3850
570 Ga0466963_0163565 3300044694 Archaea 1550
571 Ga0466963_0600142 3300044694 Bacteria 777
572 Ga0466960_0645975 3300044901 Bacteria 631
573 Ga0451576_2663822 3300045051 Unclassified 509
574 Ga0466967_0771505 3300045976 Bacteria 954
575 Ga0495603_0831583 3300046455 Unclassified 526
576 Ga0495653_0906237 3300046463 Bacteria 525
577 Ga0495582_0131829 3300046473 Bacteria 1412
578 Ga0495630_0271916 3300046517 Bacteria 1295
579 Ga0495642_0422957 3300046528 Unclassified 588
580 Ga0495642_0467812 3300046528 Bacteria 557
581 Ga0495586_0691908 3300046535 Viruses 589
582 Ga0495656_0765334 3300046615 Bacteria 521
583 Ga0495599_0180429 3300046678 Bacteria 1302
584 Ga0495647_0514669 3300046681 Bacteria 558
585 Ga0495658_0066166 3300046683 Bacteria 2087
586 Ga0495658_0311924 3300046683 Bacteria 996
587 Ga0495669_0254635 3300046684 Bacteria 843
588 Ga0495669_0504078 3300046684 Unclassified 589
589 Ga0495600_0474579 3300046809 Viruses 771
590 Ga0495581_0662948 3300047315 Unclassified 603
591 Ga0495679_213349 3300047446 Viruses 506
592 Ga0496102_0132113 3300048905 Bacteria 2338
593 Ga0496104_0007988 3300048907 Bacteria 9381
594 Ga0496105_0194848 3300048908 Bacteria 1656
595 Ga0496105_0621671 3300048908 Bacteria 836
596 Ga0496106_0157571 3300048909 Bacteria 1794
597 Ga0496107_1239187 3300048910 Bacteria 535
598 Ga0496108_0013885 3300048911 Bacteria 6569
599 Ga0496109_0204426 3300048912 Bacteria 1857
600 Ga0496109_0404649 3300048912 Bacteria 1289
601 Ga0496112_0157404 3300048915 Bacteria 2238
602 Ga0496112_0991080 3300048915 Bacteria 760
603 Ga0496113_0035656 3300048916 Bacteria 3639
604 Ga0496113_1045633 3300048916 Unclassified 642
605 Ga0496114_0147931 3300048917 Bacteria 2037
606 Ga0496114_0222952 3300048917 Bacteria 1655
607 Ga0496115_0030447 3300048918 Bacteria 4246
608 Ga0501034_0032446 3300049571 Bacteria 5304
609 Ga0501036_0400370 3300049572 Bacteria 1145
610 Ga0501038_0454649 3300049574 Bacteria 984
611 Ga0501039_0199873 3300049575 Bacteria 1572
612 Ga0501040_0068681 3300049576 Bacteria 2444
613 Ga0501041_0109649 3300049577 Bacteria 1712
614 Ga0501042_0343010 3300049578 Bacteria 1080
615 Ga0501042_0464443 3300049578 Bacteria 918
616 Ga0501047_0285293 3300049581 Bacteria 1495
617 Ga0501068_0511080 3300049584 Bacteria 780
618 Ga0501068_1147404 3300049584 Bacteria 514
619 Ga0501072_0130588 3300049588 Bacteria 2002
620 Ga0501073_0130963 3300049589 Bacteria 1739
621 Ga0501075_0432116 3300049591 Unclassified 1004
622 Ga0501075_1208095 3300049591 Bacteria 573
623 Ga0501076_0065086 3300049592 Bacteria 2906
624 Ga0501076_0432699 3300049592 Bacteria 1083
625 Ga0501077_0323065 3300049593 Bacteria 984
626 Ga0501079_0292886 3300049741 Bacteria 1273
627 Ga0501079_0402751 3300049741 Bacteria 1073
628 Ga0501080_0688302 3300049742 Bacteria 903
629 Ga0501081_0213994 3300049743 Bacteria 1400
630 Ga0501081_0553593 3300049743 Bacteria 859
631 Ga0501268_131327 3300049765 Bacteria 564
632 Ga0501035_1054809 3300049822 Bacteria 637
633 Ga0501044_0582068 3300049823 Bacteria 1014
634 Ga0501045_0066959 3300049824 Bacteria 2637
635 Ga0501045_0301821 3300049824 Bacteria 1192
636 nmdc:mga05p37_1043555_c1 3300050507 Bacteria 863
637 nmdc:mga05p37_1111128_c1 3300050507 Bacteria 827
638 nmdc:mga05p37_139483_c1 3300050507 Bacteria 2971
639 nmdc:mga05p37_1473_c1 3300050507 Bacteria 27340
640 nmdc:mga05p37_1551590_c1 3300050507 Bacteria 656
641 nmdc:mga05p37_18897_c1 3300050507 Bacteria 8332
642 nmdc:mga05p37_2268388_c1 3300050507 Bacteria 501
643 nmdc:mga05p37_42400_c1 3300050507 Bacteria 5591
644 nmdc:mga05p37_5255_c1 3300050507 Bacteria 15196
645 nmdc:mga09592_254817_c1 3300050508 Bacteria 1521
646 nmdc:mga09592_49495_c1 3300050508 Bacteria 3543
647 nmdc:mga09592_57314_c1 3300050508 Archaea 3292
648 nmdc:mga0qj67_1316202_c1 3300050509 Unclassified 559
649 nmdc:mga0qj67_530242_c1 3300050509 Bacteria 945
650 nmdc:mga06r32_123034_c1 3300050510 Bacteria 2560
651 nmdc:mga06r32_1901182_c1 3300050510 Bacteria 530
652 nmdc:mga06r32_870414_c1 3300050510 Unclassified 859
653 nmdc:mga08y16_153478_c1 3300050511 Bacteria 2393
654 nmdc:mga08y16_481319_c1 3300050511 Bacteria 1263
655 nmdc:mga08y16_551315_c1 3300050511 Bacteria 1167
656 nmdc:mga08y16_7975_c1 3300050511 Bacteria 11083
657 nmdc:mga08y16_81323_c1 3300050511 Bacteria 3378
658 nmdc:mga08y16_872653_c1 3300050511 Archaea 888
659 nmdc:mga08y16_96016_c1 3300050511 Bacteria 3087
660 nmdc:mga0n895_1052535_c1 3300050512 Bacteria 793
661 nmdc:mga0n895_1236131_c1 3300050512 Unclassified 720
662 nmdc:mga0n895_1336661_c1 3300050512 Bacteria 687
663 nmdc:mga0n895_1677915_c1 3300050512 Unclassified 598
664 nmdc:mga0n895_174990_c1 3300050512 Bacteria 2177
665 nmdc:mga0n895_182088_c1 3300050512 Bacteria 2133
666 nmdc:mga0n895_18942_c1 3300050512 Bacteria 6385
667 nmdc:mga0n895_263042_c1 3300050512 Bacteria 1750
668 nmdc:mga0n895_503239_c1 3300050512 Unclassified 1220
669 nmdc:mga0n895_82871_c1 3300050512 Bacteria 3197
670 nmdc:mga0n895_946381_c1 3300050512 Bacteria 845
671 nmdc:mga0rr50_144827_c1 3300050513 Bacteria 1914
672 nmdc:mga0rr50_335568_c1 3300050513 Bacteria 1270
673 nmdc:mga0rr50_37173_c1 3300050513 Bacteria 3512
674 nmdc:mga0rr50_381609_c1 3300050513 Archaea 1188
675 nmdc:mga0rr50_49793_c1 3300050513 Bacteria 3103
676 nmdc:mga0rr50_53903_c1 3300050513 Bacteria 2993
677 nmdc:mga0rr50_629804_c1 3300050513 Bacteria 915
678 nmdc:mga0rr50_629852_c1 3300050513 Bacteria 915
679 nmdc:mga08x19_112193_c1 3300050514 Bacteria 1819
680 nmdc:mga08x19_291805_c1 3300050514 Bacteria 1131
681 nmdc:mga08x19_536179_c1 3300050514 Bacteria 828
682 nmdc:mga08x19_891318_c1 3300050514 Archaea 632
683 nmdc:mga0a205_1481999_c1 3300050515 Unclassified 527
684 nmdc:mga0a205_324196_c1 3300050515 Unclassified 918
685 nmdc:mga0a205_348560_c1 3300050515 Bacteria 1348
686 nmdc:mga0a205_98087_c1 3300050515 Bacteria 2829
687 Ga0495601_0706070 3300053077 Bacteria 643
688 Ga0495655_0021567 3300053083 Bacteria 1460
689 Ga0495595_0438942 3300053084 Bacteria 663
690 Ga0500658_0026592 3300053134 Bacteria 2231
691 Ga0501084_0202832 3300054114 Bacteria 1673
692 Ga0501084_0260846 3300054114 Bacteria 1463
693 Ga0501082_0102172 3300060353 Bacteria 2480
694 Ga0501082_0630247 3300060353 Unclassified 938
695 Ga0111539_10189478
696 Ga0065712_10099405
697 Ga0065712_10280733
698 Ga0065715_10166238
699 Ga0065715_10818428
700 Ga0065707_10151415
701 Ga0070676_10128180
702 Ga0070676_10297606
703 Ga0070676_10653212
704 Ga0070690_100185931
705 Ga0070690_100340064
706 Ga0070690_100610754
707 Ga0070690_100959205
708 Ga0070670_100204597
709 Ga0070670_100615206
710 Ga0070670_100831526
711 Ga0070677_10730027
712 Ga0070677_10852617
713 Ga0068869_100124891
714 Ga0068869_100811097
715 Ga0068869_100959319
716 Ga0068869_101231260
717 Ga0070666_10010955
718 Ga0070666_10473920
719 Ga0070666_11153191
720 Ga0070666_11189329
721 Ga0070666_11352178
722 Ga0070682_100421907
723 Ga0068868_100656317
724 Ga0068868_100766866
725 Ga0068868_100981334
726 Ga0068868_101506987
727 Ga0068868_101676752
728 Ga0070660_101797711
729 Ga0070689_100063186
730 Ga0070689_100183015
731 Ga0070689_101359165
732 Ga0070691_10048018
733 Ga0070691_10390558
734 Ga0070687_100058087
735 Ga0070687_100616246
736 Ga0070661_100542423
737 Ga0070692_10367501
738 Ga0070692_10719054
739 Ga0070692_11019570
740 Ga0070668_100053031
741 Ga0070669_100012638
742 Ga0070669_100035976
743 Ga0070669_100130152
744 Ga0070669_100193474
745 Ga0070669_100283762
746 Ga0070669_100976731
747 Ga0070669_101496693
748 Ga0070669_101496872
749 Ga0070675_100103417
750 Ga0070675_100932578
751 Ga0070675_101651763
752 Ga0070671_100013155
753 Ga0070671_100278383
754 Ga0070671_101509848
755 Ga0070674_100198969
756 Ga0070674_100669886
757 Ga0070674_101273094
758 Ga0070674_101618125
759 Ga0070674_101844459
760 Ga0070673_100132549
761 Ga0070673_100311843
762 Ga0070673_100682040
763 Ga0070688_100020363
764 Ga0070688_100260597
765 Ga0070688_100521050
766 Ga0070659_101760137
767 Ga0070659_101772517
768 Ga0070667_100043407
769 Ga0070667_100677530
770 Ga0070667_101265908
771 Ga0070703_10092727
772 Ga0070701_10167321
773 Ga0070701_10836823
774 Ga0070701_11397651
775 Ga0070705_100080667
776 Ga0070700_100029372
777 Ga0070700_100070311
778 Ga0070700_100266028
779 Ga0070700_101177841
780 Ga0070694_100055381
781 Ga0070694_100514133
782 Ga0070694_100521795
783 Ga0070708_101149562
784 Ga0070663_100714692
785 Ga0070663_101722392
786 Ga0070678_100002975
787 Ga0070678_100268977
788 Ga0070662_100115090
789 Ga0070662_100557501
790 Ga0070662_101880886
791 Ga0070681_10020705
792 Ga0068867_100008447
793 Ga0068867_100568085
794 Ga0068867_100699627
795 Ga0068867_100854103
796 Ga0068867_101076614
797 Ga0068867_101177237
798 Ga0068867_101729705
799 Ga0068867_102188177
800 Ga0070706_100376424
801 Ga0070706_101253387
802 Ga0070707_100007948
803 Ga0070707_100035171
804 Ga0070707_101012646
805 Ga0070698_100086555
806 Ga0070698_100199666
807 Ga0070698_101147873
808 Ga0070698_101713106
809 Ga0070698_101973079
810 Ga0070699_100283610
811 Ga0070699_100447732
812 Ga0070679_100036059
813 Ga0070679_100748615
814 Ga0070684_100550043
815 Ga0070697_100317788
816 Ga0070697_100344820
817 Ga0070697_100776945
818 Ga0068853_100439309
819 Ga0068853_101401521
820 Ga0070672_100218332
821 Ga0070672_100267132
822 Ga0070672_100618195
823 Ga0070686_100011506
824 Ga0070686_100218942
825 Ga0070686_100365673
826 Ga0070686_100535832
827 Ga0070686_100580258
828 Ga0070686_100881247
829 Ga0070686_101949278
830 Ga0070695_100070376
831 Ga0070695_100687972
832 Ga0070695_100995215
833 Ga0070695_101588769
834 Ga0070696_100037273
835 Ga0070696_100066986
836 Ga0070696_100092906
837 Ga0070696_100281014
838 Ga0070696_100787841
839 Ga0070665_100003400
840 Ga0070665_100047433
841 Ga0070665_100232920
842 Ga0070665_101372620
843 Ga0070704_100019913
844 Ga0070704_100115556
845 Ga0070704_100218685
846 Ga0068855_101265709
847 Ga0070664_100334790
848 Ga0070664_100917018
849 Ga0068857_100961881
850 Ga0068854_100100390
851 Ga0068854_100111814
852 Ga0068854_100228766
853 Ga0070702_100013261
854 Ga0068852_100357853
855 Ga0068852_101116371
856 Ga0068859_100145751
857 Ga0068859_100271611
858 Ga0068859_100357736
859 Ga0068859_100768122
860 Ga0068859_100894364
861 Ga0068859_102366047
862 Ga0068859_102381651
863 Ga0068864_100023489
864 Ga0068864_100090611
865 Ga0068864_100421016
866 Ga0068864_100535212
867 Ga0068866_10246928
868 Ga0068866_10842006
869 Ga0068866_11020500
870 Ga0068861_100082599
871 Ga0068861_100104023
872 Ga0068861_100378029
873 Ga0068861_100378647
874 Ga0068861_100637100
875 Ga0068861_100794570
876 Ga0068861_101017946
877 Ga0068861_101683488
878 Ga0068851_10430291
879 Ga0068863_100003679
880 Ga0068863_100130130
881 Ga0068863_100210249
882 Ga0068863_101027205
883 Ga0068858_100002279
884 Ga0068858_100160908
885 Ga0068858_100325479
886 Ga0068858_100355323
887 Ga0068858_100386345
888 Ga0068858_100583919
889 Ga0068858_100611405
890 Ga0068858_100765994
891 Ga0068858_100776886
892 Ga0068860_100109358
893 Ga0068860_100228898
894 Ga0068860_100338199
895 Ga0068860_100742523
896 Ga0068860_101503839
897 Ga0068860_101562131
898 Ga0068860_102414599
899 Ga0068862_100021982
900 Ga0068862_100046032
901 Ga0068862_100186467
902 Ga0068862_100247623
903 Ga0068862_100368341
904 Ga0068862_100377225
905 Ga0068862_100401963
906 Ga0068862_102437167
907 Ga0081455_10057716
908 Ga0081455_10462613
909 Ga0075432_10532851
910 Ga0070715_10723557
911 Ga0070716_100930704
912 Ga0097621_100036830
913 Ga0097621_100180733
914 Ga0097621_100342059
915 Ga0097621_101162998
916 Ga0068871_100002816
917 Ga0068871_100248224
918 Ga0068871_100707926
919 Ga0068871_100956358
920 Ga0075428_100978967
921 Ga0075428_102722955
922 Ga0075430_100393856
923 Ga0075430_100620502
924 Ga0075431_100226709
925 Ga0075431_100608726
926 Ga0075433_10035341
927 Ga0075433_10657382
928 Ga0075433_10745609
929 Ga0075434_100112795
930 Ga0075434_101226862
931 Ga0075434_101285477
932 Ga0075434_101862800
933 Ga0075434_102449536
934 Ga0075429_100029031
935 Ga0075429_100565260
936 Ga0075429_101134634
937 Ga0068865_100014135
938 Ga0068865_101347331
939 Ga0075436_100504170
940 Ga0075436_100571974
941 Ga0075436_100575889
942 Ga0097620_100145750
943 Ga0097620_100271609
944 Ga0097620_100357753
945 Ga0097620_100768186
946 Ga0097620_100894369
947 Ga0097620_102366055
948 Ga0097620_102381588
949 Ga0075435_100007103
950 Ga0075435_100032589
951 Ga0075435_100091823
952 Ga0075435_100178983
953 Ga0075435_100397182
954 Ga0075435_100711831
955 Ga0075435_100744620
956 Ga0075435_101594856
957 Ga0105251_10068938
958 Ga0105240_10230810
959 Ga0105240_10750903
960 Ga0105240_10983396
961 Ga0111539_10076641
962 Ga0111539_10223956
963 Ga0111539_10501640
964 Ga0111539_10963437
965 Ga0111539_11322872
966 Ga0111539_12166153
967 Ga0111539_13325916
968 Ga0105245_10374813
969 Ga0105245_10676438
970 Ga0105245_11481501
971 Ga0105245_12298702
972 Ga0105245_12593794
973 Ga0105247_10144751
974 Ga0105247_10700959
975 Ga0114129_10000838
976 Ga0114129_10001577
977 Ga0114129_10004177
978 Ga0114129_10004637
979 Ga0114129_10138930
980 Ga0114129_10354451
981 Ga0114129_10687209
982 Ga0114129_11245838
983 Ga0114129_12280052
984 Ga0114129_13127192
985 Ga0105243_10020242
986 Ga0105243_11878765
987 Ga0105241_10057534
988 Ga0105241_10229832
989 Ga0105242_10001523
990 Ga0105242_10005108
991 Ga0105242_11241356
992 Ga0105242_11382200
993 Ga0105242_11788430
994 Ga0105248_10001706
995 Ga0105248_10067041
996 Ga0105248_10097629
997 Ga0105248_10140472
998 Ga0105248_10160532
999 Ga0105248_10652841
1000 Ga0105248_10673652
1001 Ga0105248_11677429
1002 Ga0105248_11881978
1003 Ga0105248_11896797
1004 Ga0105248_12308344
1005 Ga0105248_13284191
1006 Ga0105237_10934287
1007 Ga0105238_10060920
1008 Ga0105238_10938619
1009 Ga0105238_11487409
1010 Ga0105249_10024006
1011 Ga0105249_10161530
1012 Ga0105249_10383040
1013 Ga0105249_10495390
1014 Ga0105249_11981975
1015 Ga0105249_12375774
1016 Ga0105249_12981959
1017 Ga0105246_10939249
1018 Ga0105246_11076156
1019 Ga0105246_12573797
1020 Ga0157374_10021102
1021 Ga0157374_11537839
1022 Ga0157378_10212704
1023 Ga0157378_10409942
1024 Ga0157378_11356340
1025 Ga0163162_10134588
1026 Ga0163162_10344462
1027 Ga0163162_10492848
1028 Ga0157375_10529370
1029 Ga0157375_11382704
1030 Ga0157375_12757710
1031 Ga0157375_12880148
1032 Ga0157375_13404656
1033 Ga0163163_10019537
1034 Ga0163163_10528318
1035 Ga0157380_10682478
1036 Ga0157380_11092706
1037 Ga0157380_11596730
1038 Ga0157380_12104872
1039 Ga0157377_10091484
1040 Ga0157377_11285447
1041 Ga0157379_10010879
1042 Ga0157379_10081805
1043 Ga0157379_10291696
1044 Ga0157379_10312953
1045 Ga0157379_10908679
1046 Ga0157379_11398491
1047 Ga0157376_10018012
1048 Ga0157376_10024132
1049 Ga0157376_10110081
1050 Ga0157376_10438351
1051 Ga0157376_11310854
1052 Ga0163161_10526330
1053 Ga0163161_10616164
1054 Ga0206354_10735054
1055 Ga0207697_10151405
1056 Ga0207697_10307711
1057 Ga0207713_1096470
1058 Ga0207653_10327770
1059 Ga0207682_10264646
1060 Ga0207682_10267267
1061 Ga0207692_10662178
1062 Ga0207642_10304025
1063 Ga0207642_10610006
1064 Ga0207710_10132501
1065 Ga0207688_10415935
1066 Ga0207688_10727114
1067 Ga0207680_10021562
1068 Ga0207680_10814625
1069 Ga0207680_10967750
1070 Ga0207645_10002699
1071 Ga0207645_10512813
1072 Ga0207643_10105926
1073 Ga0207684_11031258
1074 Ga0207654_10047404
1075 Ga0207707_10025126
1076 Ga0207707_10900361
1077 Ga0207695_10065699
1078 Ga0207695_10172772
1079 Ga0207671_10613069
1080 Ga0207662_10043867
1081 Ga0207662_10614414
1082 Ga0207662_11210867
1083 Ga0207649_10485877
1084 Ga0207652_10027474
1085 Ga0207652_10669033
1086 Ga0207646_10065947
1087 Ga0207646_10117358
1088 Ga0207646_10706294
1089 Ga0207681_10004545
1090 Ga0207681_10095532
1091 Ga0207681_10247031
1092 Ga0207681_11177181
1093 Ga0207681_11434409
1094 Ga0207694_10397489
1095 Ga0207694_10706803
1096 Ga0207694_10827128
1097 Ga0207694_11006703
1098 Ga0207650_10262482
1099 Ga0207650_10509457
1100 Ga0207650_10740189
1101 Ga0207650_10742257
1102 Ga0207650_11106874
1103 Ga0207650_11159312
1104 Ga0207659_10135825
1105 Ga0207659_10330567
1106 Ga0207659_10602902
1107 Ga0207687_10021519
1108 Ga0207687_10030764
1109 Ga0207687_10356828
1110 Ga0207687_10386845
1111 Ga0207687_10695276
1112 Ga0207644_10141270
1113 Ga0207644_10387568
1114 Ga0207644_10656479
1115 Ga0207690_11329582
1116 Ga0207706_10016955
1117 Ga0207706_10242040
1118 Ga0207706_10440862
1119 Ga0207706_10470776
1120 Ga0207706_10603286
1121 Ga0207706_11619776
1122 Ga0207686_10003296
1123 Ga0207686_10006807
1124 Ga0207686_10527045
1125 Ga0207686_10918235
1126 Ga0207709_10482784
1127 Ga0207709_10888150
1128 Ga0207670_10109540
1129 Ga0207669_10167972
1130 Ga0207669_10857761
1131 Ga0207669_11804130
1132 Ga0207704_10014758
1133 Ga0207704_10405209
1134 Ga0207704_10838256
1135 Ga0207665_10626190
1136 Ga0207665_11162805
1137 Ga0207691_10006739
1138 Ga0207691_10326821
1139 Ga0207691_10365328
1140 Ga0207691_10435255
1141 Ga0207711_10058797
1142 Ga0207711_10061107
1143 Ga0207711_10204970
1144 Ga0207711_10254075
1145 Ga0207711_11659773
1146 Ga0207711_11783372
1147 Ga0207679_10170918
1148 Ga0207679_10481136
1149 Ga0207679_12047027
1150 Ga0207651_10102070
1151 Ga0207651_10329955
1152 Ga0207651_10986443
1153 Ga0207651_11166865
1154 Ga0207712_10854370
1155 Ga0207712_12089552
1156 Ga0207668_10048499
1157 Ga0207640_10001188
1158 Ga0207640_10062617
1159 Ga0207640_10186924
1160 Ga0207640_10636153
1161 Ga0207658_10128020
1162 Ga0207658_10864233
1163 Ga0207658_11916983
1164 Ga0207677_10064418
1165 Ga0207677_10400882
1166 Ga0207677_10639480
1167 Ga0207677_10856051
1168 Ga0207677_11590969
1169 Ga0207703_10002624
1170 Ga0207703_10026203
1171 Ga0207703_10196218
1172 Ga0207703_10279826
1173 Ga0207703_10311542
1174 Ga0207703_10596152
1175 Ga0207703_11665924
1176 Ga0207639_10954945
1177 Ga0207639_11265646
1178 Ga0207708_10002578
1179 Ga0207708_10046123
1180 Ga0207708_10321701
1181 Ga0207708_10380110
1182 Ga0207708_10475015
1183 Ga0207641_10004435
1184 Ga0207641_10025288
1185 Ga0207641_10110474
1186 Ga0207641_10135499
1187 Ga0207641_11408106
1188 Ga0207641_12358226
1189 Ga0207648_10005685
1190 Ga0207648_10122562
1191 Ga0207648_10233710
1192 Ga0207648_10429696
1193 Ga0207648_10499133
1194 Ga0207648_10549475
1195 Ga0207648_11107449
1196 Ga0207676_10135496
1197 Ga0207676_10315146
1198 Ga0207676_10408785
1199 Ga0207676_10949392
1200 Ga0207676_11552738
1201 Ga0207676_11563286
1202 Ga0207674_11241187
1203 Ga0207675_100000451
1204 Ga0207675_100018594
1205 Ga0207675_100030279
1206 Ga0207675_100272056
1207 Ga0207675_100306196
1208 Ga0207675_100544734
1209 Ga0207675_100585521
1210 Ga0207675_101234607
1211 Ga0207675_101809708
1212 Ga0207683_10001757
1213 Ga0207683_10255769
1214 Ga0207683_10329140
1215 Ga0207683_10497705
1216 Ga0207683_11591636
1217 Ga0207698_10108779
1218 Ga0207698_10682244
1219 Ga0207428_10028433
1220 Ga0207428_10155556
1221 Ga0207428_10925666
1222 Ga0268266_10077843
1223 Ga0268266_10233258
1224 Ga0268265_10012197
1225 Ga0268265_10149407
1226 Ga0268265_10163970
1227 Ga0268265_10341587
1228 Ga0268265_10501539
1229 Ga0268265_11703682
1230 Ga0268265_12021292
1231 Ga0268264_10086663
1232 Ga0268264_10652364
1233 Ga0268264_11034837
1234 Ga0268264_11347406
1235 Ga0268264_12399292
1236 Ga0268264_12704921
1237 Ga0265773_1028875
1238 Ga0307408_100014234
1239 Ga0307406_10046116
1240 Ga0307412_10270340
1241 Ga0307416_100049803
1242 Ga0307416_100056811
1243 Ga0307411_11182674
1244 Ga0307415_100919263
1245 Ga0373929_0069335
1246 Ga0373949_0012221
1247 Ga0373952_0059872
1248 Ga0373939_0100605
1249 Ga0373941_0333452
1250 Ga0373943_0562471
1251 Ga0373955_0450321
1252 Ga0373942_0053727
1253 Ga0373961_0444105
1254 Ga0373962_0107645
1255 Ga0373924_0299198
1256 Ga0373931_0570625
1257 Ga0373935_0713707
1258 Ga0373947_0275291
1259 Ga0373937_0288281
1260 Ga0373937_1589918
1261 Ga0373925_0633000
1262 Ga0395900_1281147
1263 Ga0439435_0002137
1264 Ga0466963_0163565
1265 Ga0466963_0600142
1266 Ga0466960_0645975
1267 Ga0451576_2663822
1268 Ga0466967_0771505
1269 Ga0495603_0831583
1270 Ga0495653_0906237
1271 Ga0495582_0131829
1272 Ga0495630_0271916
1273 Ga0495642_0422957
1274 Ga0495642_0467812
1275 Ga0495586_0691908
1276 Ga0495656_0765334
1277 Ga0495599_0180429
1278 Ga0495647_0514669
1279 Ga0495658_0066166
1280 Ga0495658_0311924
1281 Ga0495669_0254635
1282 Ga0495669_0504078
1283 Ga0495600_0474579
1284 Ga0495581_0662948
1285 Ga0495679_213349
1286 Ga0496102_0132113
1287 Ga0496104_0007988
1288 Ga0496105_0194848
1289 Ga0496105_0621671
1290 Ga0496106_0157571
1291 Ga0496107_1239187
1292 Ga0496108_0013885
1293 Ga0496109_0204426
1294 Ga0496109_0404649
1295 Ga0496112_0157404
1296 Ga0496112_0991080
1297 Ga0496113_0035656
1298 Ga0496113_1045633
1299 Ga0496114_0147931
1300 Ga0496114_0222952
1301 Ga0496115_0030447
1302 Ga0501034_0032446
1303 Ga0501036_0400370
1304 Ga0501038_0454649
1305 Ga0501039_0199873
1306 Ga0501040_0068681
1307 Ga0501041_0109649
1308 Ga0501042_0343010
1309 Ga0501042_0464443
1310 Ga0501047_0285293
1311 Ga0501068_0511080
1312 Ga0501068_1147404
1313 Ga0501072_0130588
1314 Ga0501073_0130963
1315 Ga0501075_0432116
1316 Ga0501075_1208095
1317 Ga0501076_0065086
1318 Ga0501076_0432699
1319 Ga0501077_0323065
1320 Ga0501079_0292886
1321 Ga0501079_0402751
1322 Ga0501080_0688302
1323 Ga0501081_0213994
1324 Ga0501081_0553593
1325 Ga0501268_131327
1326 Ga0501035_1054809
1327 Ga0501044_0582068
1328 Ga0501045_0066959
1329 Ga0501045_0301821
1330 nmdc:mga05p37_1043555_c1
1331 nmdc:mga05p37_1111128_c1
1332 nmdc:mga05p37_139483_c1
1333 nmdc:mga05p37_1473_c1
1334 nmdc:mga05p37_1551590_c1
1335 nmdc:mga05p37_18897_c1
1336 nmdc:mga05p37_2268388_c1
1337 nmdc:mga05p37_42400_c1
1338 nmdc:mga05p37_5255_c1
1339 nmdc:mga09592_254817_c1
1340 nmdc:mga09592_49495_c1
1341 nmdc:mga09592_57314_c1
1342 nmdc:mga0qj67_1316202_c1
1343 nmdc:mga0qj67_530242_c1
1344 nmdc:mga06r32_123034_c1
1345 nmdc:mga06r32_1901182_c1
1346 nmdc:mga06r32_870414_c1
1347 nmdc:mga08y16_153478_c1
1348 nmdc:mga08y16_481319_c1
1349 nmdc:mga08y16_551315_c1
1350 nmdc:mga08y16_7975_c1
1351 nmdc:mga08y16_81323_c1
1352 nmdc:mga08y16_872653_c1
1353 nmdc:mga08y16_96016_c1
1354 nmdc:mga0n895_1052535_c1
1355 nmdc:mga0n895_1236131_c1
1356 nmdc:mga0n895_1336661_c1
1357 nmdc:mga0n895_1677915_c1
1358 nmdc:mga0n895_174990_c1
1359 nmdc:mga0n895_182088_c1
1360 nmdc:mga0n895_18942_c1
1361 nmdc:mga0n895_263042_c1
1362 nmdc:mga0n895_503239_c1
1363 nmdc:mga0n895_82871_c1
1364 nmdc:mga0n895_946381_c1
1365 nmdc:mga0rr50_144827_c1
1366 nmdc:mga0rr50_335568_c1
1367 nmdc:mga0rr50_37173_c1
1368 nmdc:mga0rr50_381609_c1
1369 nmdc:mga0rr50_49793_c1
1370 nmdc:mga0rr50_53903_c1
1371 nmdc:mga0rr50_629804_c1
1372 nmdc:mga0rr50_629852_c1
1373 nmdc:mga08x19_112193_c1
1374 nmdc:mga08x19_291805_c1
1375 nmdc:mga08x19_536179_c1
1376 nmdc:mga08x19_891318_c1
1377 nmdc:mga0a205_1481999_c1
1378 nmdc:mga0a205_324196_c1
1379 nmdc:mga0a205_348560_c1
1380 nmdc:mga0a205_98087_c1
1381 Ga0495601_0706070
1382 Ga0495655_0021567
1383 Ga0495595_0438942
1384 Ga0500658_0026592
1385 Ga0501084_0202832
1386 Ga0501084_0260846
1387 Ga0501082_0102172
1388 Ga0501082_0630247

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05120

GvpG

Gas vesicle protein G

22

87

0.92

Map