F475633

General Info

Members Datasets Scaffolds Average Seq Length
693 243 693 353

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100165697|Ga0070706_1001656971
Length 370
Sequence LTILDSRTSRVLFTALLFAVGLGFLYAARRTLILFLFAIFFAYLINPAVARLEKLVRSRVWAITIIYLLLLVGLGLFGFLVGPRIARQSARLGASLPELMDKASTGQLSGQITQLTARIGSQHGWSAPTQERIKGFLMSRRGDLSHLAERIGFRAAEAAQQVWLLFLVPILAIFFLRDGGSFHEVLLALVQSRTQREFLQDVFQDLNQMLAQFIRAQLTLAALSLVAYTAFLGAMRVPYALMLGTAGGALEFIPLVGPLLAGAAMMIVAVLAGYQHWPFLLLFLLVWRMVQDYVISPRIMGVSVELHPLAALFGILAGGEIAGVLGVYLSIPVMASLRIVWRRWRIYAEKRKFGPLNEYSFPQELERGRS

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
90 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
120 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
121 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
122 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
186 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
190 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
191 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
192 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
193 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
194 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
195 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
196 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
197 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
199 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
200 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
201 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
202 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
205 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
210 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
211 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
212 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
218 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
219 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
222 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
223 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
224 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
225 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 1.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.33
Rhizosphere 95.24
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_7742423 2162886012 Bacteria 2456
2 LJNas_1002028 3300000546 Bacteria 2587
3 JGI24752J21851_1000806 3300001976 Unclassified 4225
4 JGI24747J21853_1000176 3300001978 Bacteria 3269
5 JGI24737J22298_10026519 3300001990 Bacteria 1829
6 JGI24743J22301_10007840 3300001991 Bacteria 1861
7 JGI24751J29686_10000991 3300002459 Bacteria 6239
8 Ga0065712_10028940 3300005290 Bacteria 1505
9 Ga0065715_10004417 3300005293 Bacteria 6690
10 Ga0070676_10015163 3300005328 Bacteria 4249
11 Ga0070683_100001564 3300005329 Bacteria 17682
12 Ga0070683_100030114 3300005329 Unclassified 4922
13 Ga0070683_100059326 3300005329 Unclassified 3555
14 Ga0070683_100460306 3300005329 Bacteria 1214
15 Ga0070690_100014844 3300005330 Unclassified 4631
16 Ga0070670_100030748 3300005331 Unclassified 4624
17 Ga0070670_100208869 3300005331 Bacteria 1697
18 Ga0070670_100229248 3300005331 Bacteria 1616
19 Ga0070677_10042392 3300005333 Bacteria 1802
20 Ga0068869_100005664 3300005334 Bacteria 7874
21 Ga0068869_100006028 3300005334 Bacteria 7667
22 Ga0068869_100052771 3300005334 Bacteria 2953
23 Ga0070666_10046129 3300005335 Bacteria 2922
24 Ga0070666_10057046 3300005335 Bacteria 2638
25 Ga0070680_100051175 3300005336 Unclassified 3370
26 Ga0070682_100015308 3300005337 Unclassified 4442
27 Ga0070682_100019066 3300005337 Unclassified 4019
28 Ga0070682_100304707 3300005337 Unclassified 1170
29 Ga0068868_100006287 3300005338 Bacteria 8395
30 Ga0068868_100008758 3300005338 Bacteria 7247
31 Ga0068868_100011959 3300005338 Bacteria 6333
32 Ga0068868_100012075 3300005338 Bacteria 6307
33 Ga0068868_100049467 3300005338 Bacteria 3299
34 Ga0070660_100064849 3300005339 Bacteria 2842
35 Ga0070660_100089814 3300005339 Bacteria 2421
36 Ga0070689_100004902 3300005340 Bacteria 9078
37 Ga0070661_100000794 3300005344 Bacteria 22679
38 Ga0070661_100019296 3300005344 Unclassified 4860
39 Ga0070661_100049237 3300005344 Bacteria 3084
40 Ga0070692_10038522 3300005345 Bacteria 2437
41 Ga0070668_100005232 3300005347 Bacteria 9626
42 Ga0070668_100037218 3300005347 Unclassified 3715
43 Ga0070669_100008095 3300005353 Bacteria 7513
44 Ga0070675_100004164 3300005354 Bacteria 10982
45 Ga0070671_100085747 3300005355 Bacteria 2635
46 Ga0070671_100102360 3300005355 Bacteria 2403
47 Ga0070671_100259487 3300005355 Bacteria 1477
48 Ga0070674_100026924 3300005356 Bacteria 3762
49 Ga0070673_100015803 3300005364 Bacteria 5316
50 Ga0070688_100000826 3300005365 Bacteria 15332
51 Ga0070659_100007081 3300005366 Bacteria 8130
52 Ga0070659_100271012 3300005366 Unclassified 1410
53 Ga0070667_100075732 3300005367 Bacteria 2873
54 Ga0070709_10000586 3300005434 Bacteria 21315
55 Ga0070709_10011222 3300005434 Bacteria 4984
56 Ga0070709_10014481 3300005434 Bacteria 4462
57 Ga0070709_10022862 3300005434 Bacteria 3664
58 Ga0070709_10022924 3300005434 Unclassified 3659
59 Ga0070709_10100539 3300005434 Bacteria 1926
60 Ga0070709_10189669 3300005434 Unclassified 1449
61 Ga0070709_10262048 3300005434 Unclassified 1249
62 Ga0070714_100001396 3300005435 Bacteria 17508
63 Ga0070714_100004544 3300005435 Bacteria 10458
64 Ga0070714_100046920 3300005435 Unclassified 3667
65 Ga0070714_100108677 3300005435 Unclassified 2452
66 Ga0070714_100329993 3300005435 Bacteria 1428
67 Ga0070713_100000352 3300005436 Bacteria 29758
68 Ga0070713_100000531 3300005436 Bacteria 24184
69 Ga0070713_100002892 3300005436 Bacteria 11231
70 Ga0070713_100007494 3300005436 Bacteria 7664
71 Ga0070713_100028366 3300005436 Bacteria 4420
72 Ga0070713_100035251 3300005436 Unclassified 4027
73 Ga0070713_100069617 3300005436 Bacteria 2967
74 Ga0070713_100181808 3300005436 Bacteria 1890
75 Ga0070710_10000959 3300005437 Bacteria 13672
76 Ga0070710_10008425 3300005437 Bacteria 5019
77 Ga0070710_10031128 3300005437 Bacteria 2877
78 Ga0070710_10084190 3300005437 Bacteria 1863
79 Ga0070710_10089487 3300005437 Bacteria 1813
80 Ga0070701_10032127 3300005438 Bacteria 2611
81 Ga0070711_100001578 3300005439 Bacteria 12540
82 Ga0070711_100003134 3300005439 Bacteria 9586
83 Ga0070711_100020066 3300005439 Unclassified 4300
84 Ga0070711_100216215 3300005439 Bacteria 1487
85 Ga0070711_100239112 3300005439 Unclassified 1419
86 Ga0070705_100211739 3300005440 Bacteria 1336
87 Ga0070708_100000729 3300005445 Bacteria 24960
88 Ga0070708_100008418 3300005445 Bacteria 8279
89 Ga0070708_100011801 3300005445 Bacteria 7109
90 Ga0070708_100016177 3300005445 Bacteria 6183
91 Ga0070708_100017546 3300005445 Bacteria 5976
92 Ga0070708_100026175 3300005445 Bacteria 4991
93 Ga0070708_100053262 3300005445 Bacteria 3590
94 Ga0070708_100086097 3300005445 Unclassified 2853
95 Ga0070708_100089236 3300005445 Bacteria 2805
96 Ga0070708_100097238 3300005445 Unclassified 2691
97 Ga0070708_100193558 3300005445 Bacteria 1902
98 Ga0070663_100019711 3300005455 Bacteria 4453
99 Ga0070663_100065023 3300005455 Unclassified 2638
100 Ga0070663_100100666 3300005455 Bacteria 2156
101 Ga0070678_100037932 3300005456 Bacteria 3388
102 Ga0070662_100009829 3300005457 Bacteria 6268
103 Ga0070662_100029331 3300005457 Bacteria 3839
104 Ga0070662_100112456 3300005457 Bacteria 2076
105 Ga0070662_100141573 3300005457 Bacteria 1864
106 Ga0070681_10000195 3300005458 Bacteria 47245
107 Ga0070681_10044424 3300005458 Bacteria 4448
108 Ga0068867_100007106 3300005459 Bacteria 7912
109 Ga0068867_100076307 3300005459 Bacteria 2516
110 Ga0070685_10001068 3300005466 Bacteria 14697
111 Ga0070706_100000499 3300005467 Bacteria 45986
112 Ga0070706_100096200 3300005467 Unclassified 2749
113 Ga0070706_100129708 3300005467 Unclassified 2352
114 Ga0070706_100161115 3300005467 Bacteria 2095
115 Ga0070706_100165697 3300005467 Bacteria 2064
116 Ga0070706_100207265 3300005467 Unclassified 1830
117 Ga0070707_100002005 3300005468 Bacteria 19504
118 Ga0070707_100005851 3300005468 Bacteria 11464
119 Ga0070707_100023721 3300005468 Bacteria 5803
120 Ga0070707_100040755 3300005468 Unclassified 4443
121 Ga0070707_100082477 3300005468 Bacteria 3105
122 Ga0070707_100087248 3300005468 Bacteria 3018
123 Ga0070707_100106843 3300005468 Unclassified 2714
124 Ga0070707_100470646 3300005468 Unclassified 1218
125 Ga0070698_100000795 3300005471 Bacteria 34332
126 Ga0070698_100001258 3300005471 Bacteria 28295
127 Ga0070699_100000621 3300005518 Bacteria 33511
128 Ga0070699_100001944 3300005518 Bacteria 18671
129 Ga0070699_100027994 3300005518 Bacteria 4860
130 Ga0070699_100039804 3300005518 Bacteria 4070
131 Ga0070699_100090972 3300005518 Bacteria 2668
132 Ga0070679_100006160 3300005530 Bacteria 11162
133 Ga0070679_100073747 3300005530 Bacteria 3404
134 Ga0070679_100181924 3300005530 Bacteria 2074
135 Ga0070684_100000661 3300005535 Bacteria 23781
136 Ga0070684_100009183 3300005535 Bacteria 7777
137 Ga0070684_100060589 3300005535 Unclassified 3311
138 Ga0070684_100084970 3300005535 Bacteria 2806
139 Ga0070684_100120526 3300005535 Unclassified 2360
140 Ga0070697_100000258 3300005536 Bacteria 42993
141 Ga0070697_100000397 3300005536 Bacteria 33764
142 Ga0070697_100015413 3300005536 Bacteria 6001
143 Ga0070697_100027550 3300005536 Bacteria 4547
144 Ga0070697_100074258 3300005536 Unclassified 2793
145 Ga0070697_100350441 3300005536 Bacteria 1275
146 Ga0068853_100002656 3300005539 Bacteria 13478
147 Ga0068853_100178841 3300005539 Bacteria 1923
148 Ga0068853_100407017 3300005539 Unclassified 1274
149 Ga0070672_100006357 3300005543 Bacteria 7934
150 Ga0070686_100006812 3300005544 Bacteria 6362
151 Ga0070695_100014489 3300005545 Bacteria 4752
152 Ga0070693_100050882 3300005547 Unclassified 2370
153 Ga0070665_100014107 3300005548 Bacteria 8032
154 Ga0068855_100000978 3300005563 Bacteria 35574
155 Ga0068855_100005912 3300005563 Bacteria 14919
156 Ga0068855_100063262 3300005563 Unclassified 4318
157 Ga0068855_100080883 3300005563 Unclassified 3767
158 Ga0068855_100292483 3300005563 Bacteria 1805
159 Ga0070664_100001252 3300005564 Bacteria 20328
160 Ga0070664_100055990 3300005564 Bacteria 3350
161 Ga0070664_100174052 3300005564 Unclassified 1910
162 Ga0068857_100002090 3300005577 Bacteria 16230
163 Ga0068857_100007487 3300005577 Bacteria 9399
164 Ga0068854_100034529 3300005578 Unclassified 3534
165 Ga0068854_100039175 3300005578 Unclassified 3337
166 Ga0068854_100073447 3300005578 Bacteria 2507
167 Ga0068856_100000107 3300005614 Bacteria 81707
168 Ga0068856_100000483 3300005614 Bacteria 44122
169 Ga0068856_100002086 3300005614 Bacteria 20738
170 Ga0068856_100009826 3300005614 Bacteria 9292
171 Ga0068856_100028664 3300005614 Bacteria 5439
172 Ga0068856_100038299 3300005614 Unclassified 4706
173 Ga0068856_100047585 3300005614 Bacteria 4225
174 Ga0068856_100171050 3300005614 Unclassified 2185
175 Ga0068856_100172329 3300005614 Bacteria 2176
176 Ga0070702_100002782 3300005615 Bacteria 7670
177 Ga0068852_100003925 3300005616 Bacteria 10448
178 Ga0068852_100078917 3300005616 Unclassified 2914
179 Ga0068859_100000951 3300005617 Bacteria 29624
180 Ga0068859_100009582 3300005617 Bacteria 9780
181 Ga0068859_100066899 3300005617 Bacteria 3628
182 Ga0068864_100007554 3300005618 Bacteria 8957
183 Ga0068864_100011018 3300005618 Bacteria 7474
184 Ga0068864_100027359 3300005618 Unclassified 4816
185 Ga0068864_100121664 3300005618 Bacteria 2334
186 Ga0068866_10001489 3300005718 Bacteria 9977
187 Ga0068866_10005505 3300005718 Bacteria 5230
188 Ga0068861_100080384 3300005719 Bacteria 2550
189 Ga0068851_10022211 3300005834 Unclassified 3087
190 Ga0068851_10048345 3300005834 Bacteria 2156
191 Ga0068870_10000594 3300005840 Bacteria 13777
192 Ga0068863_100008718 3300005841 Bacteria 9909
193 Ga0068863_100012494 3300005841 Bacteria 8196
194 Ga0068863_100032516 3300005841 Bacteria 4973
195 Ga0068863_100036172 3300005841 Bacteria 4703
196 Ga0068863_100074999 3300005841 Unclassified 3200
197 Ga0068863_100075760 3300005841 Bacteria 3183
198 Ga0068863_100112107 3300005841 Unclassified 2598
199 Ga0068863_100119952 3300005841 Bacteria 2507
200 Ga0068858_100002793 3300005842 Bacteria 17549
201 Ga0068858_100004335 3300005842 Bacteria 13924
202 Ga0068860_100004530 3300005843 Bacteria 14182
203 Ga0068860_100021853 3300005843 Bacteria 6190
204 Ga0068860_100078870 3300005843 Bacteria 3131
205 Ga0068860_100182026 3300005843 Bacteria 2031
206 Ga0068860_100347819 3300005843 Bacteria 1458
207 Ga0068862_100010269 3300005844 Bacteria 7725
208 Ga0068862_100123345 3300005844 Bacteria 2285
209 Ga0070717_10000383 3300006028 Bacteria 28372
210 Ga0070717_10002932 3300006028 Bacteria 12112
211 Ga0070717_10012853 3300006028 Bacteria 6393
212 Ga0070717_10013844 3300006028 Bacteria 6194
213 Ga0070717_10029577 3300006028 Unclassified 4395
214 Ga0070717_10042437 3300006028 Unclassified 3710
215 Ga0070717_10060214 3300006028 Bacteria 3144
216 Ga0070717_10151883 3300006028 Bacteria 2004
217 Ga0070717_10180131 3300006028 Unclassified 1841
218 Ga0070717_10252387 3300006028 Unclassified 1559
219 Ga0070715_10010820 3300006163 Bacteria 3263
220 Ga0070715_10043444 3300006163 Bacteria 1895
221 Ga0070716_100000278 3300006173 Bacteria 20754
222 Ga0070716_100003557 3300006173 Bacteria 7353
223 Ga0070716_100003816 3300006173 Bacteria 7150
224 Ga0070716_100010295 3300006173 Unclassified 4684
225 Ga0070716_100017624 3300006173 Bacteria 3706
226 Ga0070716_100053474 3300006173 Bacteria 2303
227 Ga0070716_100124327 3300006173 Unclassified 1620
228 Ga0070712_100000193 3300006175 Bacteria 33852
229 Ga0070712_100000658 3300006175 Bacteria 20372
230 Ga0070712_100001245 3300006175 Bacteria 15390
231 Ga0070712_100001997 3300006175 Bacteria 12488
232 Ga0070712_100002784 3300006175 Bacteria 10800
233 Ga0070712_100047276 3300006175 Unclassified 2978
234 Ga0070712_100073329 3300006175 Unclassified 2455
235 Ga0070712_100109397 3300006175 Bacteria 2060
236 Ga0070712_100136165 3300006175 Unclassified 1868
237 Ga0097621_100000223 3300006237 Bacteria 37820
238 Ga0097621_100002728 3300006237 Bacteria 12086
239 Ga0097621_100003550 3300006237 Bacteria 10770
240 Ga0097621_100003554 3300006237 Bacteria 10768
241 Ga0097621_100006566 3300006237 Bacteria 8261
242 Ga0097621_100023835 3300006237 Unclassified 4770
243 Ga0068871_100000410 3300006358 Bacteria 29656
244 Ga0068871_100004799 3300006358 Bacteria 9452
245 Ga0068871_100013866 3300006358 Bacteria 5993
246 Ga0068871_100024200 3300006358 Unclassified 4706
247 Ga0068871_100029703 3300006358 Unclassified 4296
248 Ga0068871_100034934 3300006358 Unclassified 3992
249 Ga0068871_100098226 3300006358 Bacteria 2449
250 Ga0068871_100152279 3300006358 Bacteria 1973
251 Ga0075433_10000971 3300006852 Bacteria 20352
252 Ga0075434_100009879 3300006871 Bacteria 8926
253 Ga0075434_100163176 3300006871 Bacteria 2248
254 Ga0068865_100005068 3300006881 Bacteria 7972
255 Ga0068865_100019589 3300006881 Unclassified 4380
256 Ga0068865_100036197 3300006881 Bacteria 3326
257 Ga0075436_100000709 3300006914 Bacteria 22091
258 Ga0097620_100000951 3300006931 Bacteria 29624
259 Ga0097620_100009582 3300006931 Bacteria 9780
260 Ga0097620_100066896 3300006931 Bacteria 3628
261 Ga0075435_100000841 3300007076 Bacteria 19159
262 Ga0075435_100016153 3300007076 Bacteria 5624
263 Ga0075435_100092912 3300007076 Unclassified 2492
264 Ga0099795_10031611 3300007788 Bacteria 1824
265 Ga0105251_10110807 3300009011 Bacteria 1250
266 Ga0105240_10002618 3300009093 Bacteria 28698
267 Ga0105240_10008167 3300009093 Bacteria 15008
268 Ga0105240_10018860 3300009093 Bacteria 9237
269 Ga0105240_10044008 3300009093 Bacteria 5676
270 Ga0105240_10153216 3300009093 Unclassified 2744
271 Ga0105240_10154251 3300009093 Unclassified 2733
272 Ga0105240_10159996 3300009093 Bacteria 2676
273 Ga0105240_10205581 3300009093 Bacteria 2305
274 Ga0105245_10002658 3300009098 Bacteria 16090
275 Ga0105245_10004111 3300009098 Bacteria 12920
276 Ga0105245_10078506 3300009098 Unclassified 3012
277 Ga0105245_10096856 3300009098 Unclassified 2723
278 Ga0105247_10017515 3300009101 Unclassified 4297
279 Ga0105247_10020936 3300009101 Unclassified 3935
280 Ga0105247_10057598 3300009101 Bacteria 2403
281 Ga0105243_10055743 3300009148 Unclassified 3141
282 Ga0105241_10001486 3300009174 Bacteria 17962
283 Ga0105241_10003005 3300009174 Bacteria 12604
284 Ga0105241_10021699 3300009174 Unclassified 4750
285 Ga0105241_10055135 3300009174 Unclassified 3045
286 Ga0105242_10006300 3300009176 Bacteria 9141
287 Ga0105242_10025528 3300009176 Unclassified 4677
288 Ga0105242_10191638 3300009176 Unclassified 1810
289 Ga0105248_10003183 3300009177 Bacteria 18192
290 Ga0105248_10016820 3300009177 Bacteria 8050
291 Ga0105248_10034297 3300009177 Bacteria 5673
292 Ga0105248_10054223 3300009177 Unclassified 4496
293 Ga0105248_10107376 3300009177 Bacteria 3148
294 Ga0105248_10238249 3300009177 Unclassified 2048
295 Ga0105237_10019545 3300009545 Bacteria 6997
296 Ga0105237_10021096 3300009545 Bacteria 6701
297 Ga0105237_10029870 3300009545 Bacteria 5536
298 Ga0105237_10050389 3300009545 Unclassified 4183
299 Ga0105237_10232874 3300009545 Bacteria 1843
300 Ga0105238_10000090 3300009551 Bacteria 102374
301 Ga0105238_10017430 3300009551 Bacteria 7299
302 Ga0105238_10103373 3300009551 Bacteria 2830
303 Ga0105249_10015904 3300009553 Bacteria 6668
304 Ga0105249_10376572 3300009553 Unclassified 1444
305 Ga0099796_10024290 3300010159 Unclassified 1902
306 Ga0105239_10015829 3300010375 Bacteria 8347
307 Ga0105239_10025239 3300010375 Bacteria 6545
308 Ga0105239_10069680 3300010375 Bacteria 3863
309 Ga0105239_10094539 3300010375 Unclassified 3301
310 Ga0105239_10137393 3300010375 Bacteria 2721
311 Ga0105246_10000592 3300011119 Bacteria 20112
312 Ga0105246_10094579 3300011119 Unclassified 2162
313 Ga0105246_10174545 3300011119 Bacteria 1649
314 Ga0157373_10005921 3300013100 Bacteria 9148
315 Ga0157373_10006042 3300013100 Bacteria 9051
316 Ga0157373_10079568 3300013100 Archaea 2312
317 Ga0157373_10123591 3300013100 Bacteria 1820
318 Ga0157371_10017563 3300013102 Bacteria 5312
319 Ga0157371_10053241 3300013102 Bacteria 2874
320 Ga0157371_10070345 3300013102 Bacteria 2477
321 Ga0157371_10110626 3300013102 Unclassified 1950
322 Ga0157370_10053518 3300013104 Bacteria 3849
323 Ga0157370_10062916 3300013104 Unclassified 3517
324 Ga0157370_10196902 3300013104 Bacteria 1870
325 Ga0157369_10005632 3300013105 Bacteria 14551
326 Ga0157369_10013615 3300013105 Bacteria 9201
327 Ga0157369_10015793 3300013105 Bacteria 8506
328 Ga0157369_10025206 3300013105 Bacteria 6603
329 Ga0157369_10027601 3300013105 Bacteria 6290
330 Ga0157369_10046582 3300013105 Bacteria 4712
331 Ga0157369_10060435 3300013105 Unclassified 4086
332 Ga0157369_10108666 3300013105 Bacteria 2950
333 Ga0157369_10113854 3300013105 Bacteria 2873
334 Ga0157369_10138228 3300013105 Unclassified 2579
335 Ga0157374_10000097 3300013296 Bacteria 81947
336 Ga0157374_10000305 3300013296 Bacteria 45523
337 Ga0157374_10000997 3300013296 Bacteria 24569
338 Ga0157374_10014051 3300013296 Bacteria 7000
339 Ga0157374_10021413 3300013296 Bacteria 5752
340 Ga0157374_10022194 3300013296 Bacteria 5660
341 Ga0157374_10068555 3300013296 Bacteria 3338
342 Ga0157374_10186858 3300013296 Bacteria 2026
343 Ga0157378_10000265 3300013297 Bacteria 50886
344 Ga0157378_10001362 3300013297 Bacteria 21956
345 Ga0157378_10008887 3300013297 Bacteria 8743
346 Ga0157378_10010398 3300013297 Bacteria 8126
347 Ga0157378_10045833 3300013297 Bacteria 3886
348 Ga0157378_10066055 3300013297 Bacteria 3239
349 Ga0163162_10006230 3300013306 Bacteria 11564
350 Ga0163162_10017904 3300013306 Bacteria 6931
351 Ga0163162_10020438 3300013306 Bacteria 6507
352 Ga0163162_10078740 3300013306 Unclassified 3361
353 Ga0163162_10091176 3300013306 Bacteria 3130
354 Ga0163162_10091738 3300013306 Unclassified 3121
355 Ga0157372_10000766 3300013307 Bacteria 34848
356 Ga0157372_10001033 3300013307 Bacteria 30439
357 Ga0157372_10001204 3300013307 Bacteria 27976
358 Ga0157372_10007745 3300013307 Bacteria 11410
359 Ga0157372_10007887 3300013307 Bacteria 11315
360 Ga0157372_10008029 3300013307 Bacteria 11224
361 Ga0157372_10008514 3300013307 Bacteria 10891
362 Ga0157372_10010175 3300013307 Bacteria 9987
363 Ga0157372_10011993 3300013307 Bacteria 9230
364 Ga0157372_10070516 3300013307 Bacteria 3932
365 Ga0157372_10335318 3300013307 Unclassified 1761
366 Ga0157375_10027623 3300013308 Bacteria 5307
367 Ga0157375_10076539 3300013308 Bacteria 3373
368 Ga0157375_10135089 3300013308 Bacteria 2589
369 Ga0157375_10231066 3300013308 Bacteria 2009
370 Ga0163163_10001245 3300014325 Bacteria 21449
371 Ga0163163_10104250 3300014325 Bacteria 2861
372 Ga0163163_10152526 3300014325 Bacteria 2354
373 Ga0157380_10133793 3300014326 Bacteria 2119
374 Ga0182008_10001046 3300014497 Bacteria 19199
375 Ga0182008_10029047 3300014497 Bacteria 2795
376 Ga0157377_10000498 3300014745 Bacteria 16694
377 Ga0157379_10005139 3300014968 Bacteria 11230
378 Ga0157379_10011871 3300014968 Bacteria 7611
379 Ga0157379_10039232 3300014968 Unclassified 4225
380 Ga0157379_10055758 3300014968 Bacteria 3531
381 Ga0157376_10025960 3300014969 Bacteria 4622
382 Ga0157376_10050739 3300014969 Bacteria 3443
383 Ga0157376_10087801 3300014969 Bacteria 2684
384 Ga0157376_10099202 3300014969 Bacteria 2541
385 Ga0157376_10119192 3300014969 Bacteria 2336
386 Ga0182006_1010221 3300015261 Bacteria 4180
387 Ga0182006_1016692 3300015261 Bacteria 3129
388 Ga0224570_100347 3300022730 Bacteria 3585
389 Ga0224569_100721 3300022732 Unclassified 2831
390 Ga0228598_1000128 3300024227 Bacteria 12910
391 Ga0228598_1005539 3300024227 Unclassified 2635
392 Ga0207656_10005808 3300025321 Unclassified 4393
393 Ga0207692_10004844 3300025898 Archaea 5356
394 Ga0207692_10006406 3300025898 Unclassified 4771
395 Ga0207692_10014652 3300025898 Bacteria 3430
396 Ga0207692_10015012 3300025898 Unclassified 3398
397 Ga0207692_10015804 3300025898 Unclassified 3329
398 Ga0207642_10004132 3300025899 Bacteria 4657
399 Ga0207642_10016373 3300025899 Bacteria 2791
400 Ga0207710_10015754 3300025900 Bacteria 3196
401 Ga0207710_10016177 3300025900 Bacteria 3155
402 Ga0207688_10006592 3300025901 Bacteria 6316
403 Ga0207680_10006132 3300025903 Bacteria 5796
404 Ga0207680_10139441 3300025903 Bacteria 1606
405 Ga0207647_10000432 3300025904 Bacteria 34328
406 Ga0207647_10025669 3300025904 Unclassified 3867
407 Ga0207647_10117169 3300025904 Unclassified 1572
408 Ga0207685_10019631 3300025905 Bacteria 2231
409 Ga0207685_10038700 3300025905 Bacteria 1765
410 Ga0207699_10001214 3300025906 Bacteria 12229
411 Ga0207699_10035512 3300025906 Bacteria 2837
412 Ga0207699_10035935 3300025906 Bacteria 2822
413 Ga0207699_10070157 3300025906 Bacteria 2139
414 Ga0207699_10145188 3300025906 Bacteria 1563
415 Ga0207699_10183293 3300025906 Unclassified 1409
416 Ga0207645_10001148 3300025907 Bacteria 21863
417 Ga0207643_10000501 3300025908 Bacteria 25007
418 Ga0207684_10000132 3300025910 Bacteria 134931
419 Ga0207684_10001821 3300025910 Bacteria 22266
420 Ga0207684_10004860 3300025910 Bacteria 12570
421 Ga0207684_10069000 3300025910 Unclassified 3005
422 Ga0207684_10303297 3300025910 Unclassified 1377
423 Ga0207654_10001671 3300025911 Bacteria 11597
424 Ga0207654_10004523 3300025911 Bacteria 7024
425 Ga0207654_10026179 3300025911 Unclassified 3156
426 Ga0207707_10001239 3300025912 Bacteria 23957
427 Ga0207707_10004957 3300025912 Bacteria 11702
428 Ga0207695_10013360 3300025913 Bacteria 9798
429 Ga0207695_10021666 3300025913 Bacteria 7326
430 Ga0207695_10028837 3300025913 Bacteria 6144
431 Ga0207695_10035284 3300025913 Bacteria 5427
432 Ga0207695_10043703 3300025913 Unclassified 4774
433 Ga0207695_10255534 3300025913 Bacteria 1651
434 Ga0207695_10321256 3300025913 Bacteria 1437
435 Ga0207695_10357000 3300025913 Bacteria 1348
436 Ga0207671_10020714 3300025914 Bacteria 5002
437 Ga0207693_10000140 3300025915 Bacteria 65993
438 Ga0207693_10000350 3300025915 Bacteria 42606
439 Ga0207693_10000632 3300025915 Bacteria 31463
440 Ga0207693_10002744 3300025915 Bacteria 15250
441 Ga0207693_10003987 3300025915 Bacteria 12544
442 Ga0207693_10021582 3300025915 Bacteria 5117
443 Ga0207693_10129903 3300025915 Unclassified 1980
444 Ga0207663_10000470 3300025916 Bacteria 17512
445 Ga0207663_10005352 3300025916 Bacteria 6459
446 Ga0207663_10006194 3300025916 Bacteria 6097
447 Ga0207663_10138961 3300025916 Bacteria 1689
448 Ga0207663_10273423 3300025916 Unclassified 1252
449 Ga0207657_10001169 3300025919 Bacteria 27831
450 Ga0207657_10001964 3300025919 Bacteria 22198
451 Ga0207657_10002323 3300025919 Bacteria 20608
452 Ga0207649_10000374 3300025920 Bacteria 33445
453 Ga0207649_10012634 3300025920 Unclassified 4690
454 Ga0207649_10035274 3300025920 Unclassified 3005
455 Ga0207652_10006549 3300025921 Bacteria 9386
456 Ga0207652_10104864 3300025921 Bacteria 2501
457 Ga0207652_10295355 3300025921 Unclassified 1462
458 Ga0207646_10000301 3300025922 Bacteria 67088
459 Ga0207646_10001216 3300025922 Bacteria 32388
460 Ga0207646_10221718 3300025922 Bacteria 1708
461 Ga0207646_10326707 3300025922 Bacteria 1386
462 Ga0207681_10080422 3300025923 Bacteria 2298
463 Ga0207694_10035217 3300025924 Unclassified 3840
464 Ga0207694_10057257 3300025924 Unclassified 3030
465 Ga0207694_10109623 3300025924 Bacteria 2195
466 Ga0207650_10000045 3300025925 Bacteria 181507
467 Ga0207687_10005572 3300025927 Bacteria 8318
468 Ga0207687_10005776 3300025927 Bacteria 8188
469 Ga0207687_10032039 3300025927 Bacteria 3557
470 Ga0207687_10146463 3300025927 Unclassified 1797
471 Ga0207700_10000708 3300025928 Bacteria 19279
472 Ga0207700_10004605 3300025928 Bacteria 8163
473 Ga0207700_10015826 3300025928 Unclassified 4990
474 Ga0207700_10046447 3300025928 Bacteria 3211
475 Ga0207700_10076706 3300025928 Bacteria 2594
476 Ga0207700_10125460 3300025928 Unclassified 2088
477 Ga0207700_10135212 3300025928 Bacteria 2018
478 Ga0207664_10000037 3300025929 Bacteria 171467
479 Ga0207664_10180546 3300025929 Bacteria 1811
480 Ga0207664_10344274 3300025929 Unclassified 1318
481 Ga0207644_10011926 3300025931 Bacteria 5761
482 Ga0207644_10258840 3300025931 Bacteria 1391
483 Ga0207644_10261101 3300025931 Bacteria 1385
484 Ga0207690_10059893 3300025932 Bacteria 2581
485 Ga0207706_10000414 3300025933 Bacteria 45687
486 Ga0207706_10000432 3300025933 Bacteria 44915
487 Ga0207706_10014037 3300025933 Bacteria 7264
488 Ga0207709_10009090 3300025935 Bacteria 5479
489 Ga0207670_10002157 3300025936 Bacteria 10296
490 Ga0207669_10019116 3300025937 Bacteria 3559
491 Ga0207704_10006107 3300025938 Bacteria 5587
492 Ga0207704_10027858 3300025938 Unclassified 3125
493 Ga0207665_10000046 3300025939 Bacteria 78992
494 Ga0207665_10002386 3300025939 Bacteria 12686
495 Ga0207665_10003706 3300025939 Bacteria 10203
496 Ga0207665_10013388 3300025939 Bacteria 5393
497 Ga0207665_10022159 3300025939 Unclassified 4177
498 Ga0207665_10022639 3300025939 Bacteria 4135
499 Ga0207665_10136687 3300025939 Unclassified 1744
500 Ga0207691_10000151 3300025940 Bacteria 64391
501 Ga0207691_10126085 3300025940 Bacteria 2265
502 Ga0207711_10013585 3300025941 Bacteria 6763
503 Ga0207711_10125359 3300025941 Unclassified 2297
504 Ga0207689_10000129 3300025942 Bacteria 63859
505 Ga0207689_10001515 3300025942 Bacteria 22101
506 Ga0207689_10011670 3300025942 Bacteria 7531
507 Ga0207689_10097811 3300025942 Bacteria 2411
508 Ga0207661_10000099 3300025944 Bacteria 54986
509 Ga0207679_10000096 3300025945 Bacteria 76971
510 Ga0207679_10030308 3300025945 Bacteria 3776
511 Ga0207679_10195538 3300025945 Unclassified 1685
512 Ga0207667_10001904 3300025949 Bacteria 26195
513 Ga0207667_10007050 3300025949 Bacteria 13581
514 Ga0207667_10008001 3300025949 Bacteria 12613
515 Ga0207667_10064454 3300025949 Bacteria 3826
516 Ga0207667_10152045 3300025949 Bacteria 2382
517 Ga0207667_10162474 3300025949 Unclassified 2297
518 Ga0207651_10022946 3300025960 Bacteria 3828
519 Ga0207651_10265108 3300025960 Bacteria 1412
520 Ga0207668_10057817 3300025972 Bacteria 2707
521 Ga0207640_10025561 3300025981 Bacteria 3576
522 Ga0207640_10049622 3300025981 Bacteria 2718
523 Ga0207658_10009251 3300025986 Bacteria 6682
524 Ga0207658_10087814 3300025986 Bacteria 2402
525 Ga0207677_10007414 3300026023 Bacteria 6065
526 Ga0207677_10007513 3300026023 Bacteria 6038
527 Ga0207677_10008014 3300026023 Bacteria 5879
528 Ga0207677_10034353 3300026023 Bacteria 3283
529 Ga0207677_10060379 3300026023 Bacteria 2620
530 Ga0207703_10004042 3300026035 Bacteria 12120
531 Ga0207703_10011851 3300026035 Bacteria 6789
532 Ga0207703_10033153 3300026035 Unclassified 4091
533 Ga0207639_10046651 3300026041 Bacteria 3270
534 Ga0207639_10216598 3300026041 Unclassified 1651
535 Ga0207678_10000026 3300026067 Bacteria 116850
536 Ga0207678_10000722 3300026067 Bacteria 30161
537 Ga0207678_10104787 3300026067 Bacteria 2413
538 Ga0207702_10000103 3300026078 Bacteria 99037
539 Ga0207702_10000396 3300026078 Bacteria 49721
540 Ga0207702_10006399 3300026078 Bacteria 10160
541 Ga0207702_10037198 3300026078 Bacteria 4073
542 Ga0207702_10043743 3300026078 Bacteria 3762
543 Ga0207702_10059342 3300026078 Bacteria 3259
544 Ga0207702_10132350 3300026078 Unclassified 2246
545 Ga0207702_10226089 3300026078 Unclassified 1746
546 Ga0207641_10000075 3300026088 Bacteria 145149
547 Ga0207641_10011551 3300026088 Bacteria 7248
548 Ga0207641_10031544 3300026088 Unclassified 4396
549 Ga0207641_10034491 3300026088 Bacteria 4210
550 Ga0207641_10062642 3300026088 Bacteria 3175
551 Ga0207641_10109405 3300026088 Bacteria 2448
552 Ga0207648_10002645 3300026089 Bacteria 19126
553 Ga0207676_10000096 3300026095 Bacteria 80353
554 Ga0207676_10001149 3300026095 Bacteria 19942
555 Ga0207676_10158383 3300026095 Unclassified 1959
556 Ga0207674_10000246 3300026116 Bacteria 67486
557 Ga0207674_10004470 3300026116 Bacteria 16812
558 Ga0207674_10017682 3300026116 Bacteria 7771
559 Ga0207675_100009570 3300026118 Bacteria 9064
560 Ga0207675_100068955 3300026118 Bacteria 3305
561 Ga0207675_100105294 3300026118 Bacteria 2659
562 Ga0207683_10000259 3300026121 Bacteria 47186
563 Ga0207698_10039929 3300026142 Bacteria 3481
564 Ga0207698_10097903 3300026142 Unclassified 2422
565 Ga0207698_10134253 3300026142 Bacteria 2120
566 Ga0265356_1002258 3300028017 Bacteria 2618
567 Ga0268266_10001241 3300028379 Bacteria 31189
568 Ga0268265_10008564 3300028380 Bacteria 6915
569 Ga0268264_10013181 3300028381 Bacteria 6801
570 Ga0268264_10044707 3300028381 Bacteria 3674
571 Ga0268264_10206309 3300028381 Unclassified 1801
572 Ga0265338_10008367 3300028800 Bacteria 12569
573 Ga0265338_10048335 3300028800 Bacteria 3871
574 Ga0265338_10060100 3300028800 Unclassified 3342
575 Ga0265338_10076355 3300028800 Unclassified 2838
576 Ga0265762_1000418 3300030760 Bacteria 7364
577 Ga0265762_1000484 3300030760 Bacteria 6897
578 Ga0265762_1002175 3300030760 Unclassified 3550
579 Ga0265770_1004394 3300030878 Bacteria 1925
580 Ga0265760_10000243 3300031090 Bacteria 14905
581 Ga0265760_10000412 3300031090 Bacteria 12017
582 Ga0265760_10001955 3300031090 Bacteria 6048
583 Ga0265760_10022476 3300031090 Unclassified 1828
584 Ga0265330_10006625 3300031235 Bacteria 5714
585 Ga0265325_10026488 3300031241 Unclassified 3140
586 Ga0265340_10048949 3300031247 Unclassified 2054
587 Ga0265339_10006959 3300031249 Bacteria 7356
588 Ga0265316_10012016 3300031344 Bacteria 7782
589 Ga0265316_10018493 3300031344 Bacteria 5986
590 Ga0265314_10021165 3300031711 Bacteria 5008
591 Ga0265314_10032533 3300031711 Unclassified 3835
592 Ga0265314_10128577 3300031711 Bacteria 1583
593 Ga0316212_1004220 3300033547 Bacteria 2083
594 Ga0373948_0002807 3300034817 Bacteria 2614
595 Ga0373936_0003220 3300035113 Bacteria 6123
596 Ga0373936_0003250 3300035113 Bacteria 6093
597 Ga0373945_0024387 3300035116 Bacteria 2096
598 Ga0373945_0029295 3300035116 Bacteria 1933
599 Ga0373953_0028325 3300035117 Unclassified 2159
600 Ga0373957_0002067 3300035120 Bacteria 5628
601 Ga0373943_0000148 3300035170 Bacteria 27189
602 Ga0373946_0056736 3300035171 Bacteria 1655
603 Ga0373935_0013255 3300035692 Bacteria 4972
604 Ga0373935_0050159 3300035692 Unclassified 2648
605 Ga0373935_0063007 3300035692 Bacteria 2376
606 Ga0373927_0001079 3300035695 Bacteria 20827
607 Ga0373927_0010643 3300035695 Bacteria 6128
608 Ga0373927_0042120 3300035695 Bacteria 2960
609 Ga0373927_0065169 3300035695 Bacteria 2357
610 Ga0373927_0077709 3300035695 Bacteria 2150
611 Ga0373933_0055565 3300035724 Unclassified 2375
612 Ga0373947_0001340 3300035725 Bacteria 15143
613 Ga0373947_0070320 3300035725 Bacteria 2144
614 Ga0373947_0070393 3300035725 Bacteria 2143
615 Ga0373947_0113613 3300035725 Unclassified 1714
616 Ga0373937_0104456 3300036401 Unclassified 2632
617 Ga0373937_0196963 3300036401 Unclassified 1893
618 Ga0373925_0003241 3300037068 Bacteria 12703
619 Ga0373925_0012705 3300037068 Bacteria 6099
620 Ga0373925_0207539 3300037068 Bacteria 1560
621 Ga0436364_1358914 3300037853 Bacteria 3510
622 Ga0436363_1412803 3300039450 Bacteria 3616
623 Ga0436362_0466832 3300039453 Bacteria 4358
624 Ga0451576_0297943 3300045051 Unclassified 1686
625 Ga0466967_0012847 3300045976 Bacteria 6436
626 Ga0466967_0057364 3300045976 Bacteria 3437
627 Ga0466967_0171562 3300045976 Unclassified 2041
628 Ga0466967_0735688 3300045976 Unclassified 978
629 Ga0495629_0087997 3300046459 Bacteria 2167
630 Ga0495653_0014292 3300046463 Bacteria 6474
631 Ga0495580_0001097 3300046472 Bacteria 23738
632 Ga0495580_0001908 3300046472 Bacteria 18328
633 Ga0495580_0003312 3300046472 Bacteria 13776
634 Ga0495580_0004680 3300046472 Bacteria 11475
635 Ga0495580_0005828 3300046472 Bacteria 10106
636 Ga0495580_0007428 3300046472 Bacteria 8810
637 Ga0495580_0010830 3300046472 Bacteria 7077
638 Ga0495580_0025265 3300046472 Bacteria 4343
639 Ga0495580_0053703 3300046472 Unclassified 2843
640 Ga0495580_0071255 3300046472 Unclassified 2428
641 Ga0495580_0090174 3300046472 Bacteria 2134
642 Ga0495580_0090847 3300046472 Unclassified 2125
643 Ga0495582_0000452 3300046473 Bacteria 22463
644 Ga0495582_0001438 3300046473 Archaea 13432
645 Ga0495582_0038428 3300046473 Unclassified 2634
646 Ga0495639_0140951 3300046475 Bacteria 1159
647 Ga0495664_0034553 3300046477 Bacteria 2974
648 Ga0495594_0018601 3300046499 Bacteria 3682
649 Ga0495630_0049006 3300046517 Unclassified 3162
650 Ga0495665_0067813 3300046531 Bacteria 1881
651 Ga0495624_0125426 3300046690 Unclassified 1576
652 Ga0495674_0063268 3300047319 Bacteria 3219
653 Ga0495674_0088526 3300047319 Unclassified 2648
654 Ga0495684_0072295 3300047471 Unclassified 2621
655 Ga0495602_0036805 3300048088 Bacteria 4550
656 Ga0496100_0116410 3300048903 Bacteria 1865
657 Ga0496101_0023892 3300048904 Unclassified 4226
658 Ga0496102_0069961 3300048905 Bacteria 3222
659 Ga0496102_0090484 3300048905 Unclassified 2832
660 Ga0496102_0109263 3300048905 Unclassified 2577
661 Ga0496102_0196386 3300048905 Bacteria 1901
662 Ga0496103_0138242 3300048906 Bacteria 1557
663 Ga0496104_0089467 3300048907 Unclassified 2941
664 Ga0496104_0115822 3300048907 Unclassified 2572
665 Ga0496104_0147552 3300048907 Bacteria 2259
666 Ga0496104_0148459 3300048907 Bacteria 2251
667 Ga0496104_0181991 3300048907 Bacteria 2012
668 Ga0496104_0310269 3300048907 Bacteria 1490
669 Ga0496106_0045751 3300048909 Unclassified 3288
670 Ga0496106_0131711 3300048909 Bacteria 1962
671 Ga0496108_0000943 3300048911 Bacteria 22691
672 Ga0496109_0000132 3300048912 Bacteria 76436
673 Ga0496110_0031229 3300048913 Bacteria 4595
674 Ga0496111_0016861 3300048914 Bacteria 5041
675 Ga0496112_0000448 3300048915 Bacteria 27454
676 Ga0496112_0018280 3300048915 Bacteria 6598
677 Ga0496112_0020878 3300048915 Bacteria 6216
678 Ga0496112_0031902 3300048915 Bacteria 5113
679 Ga0496112_0043755 3300048915 Unclassified 4385
680 Ga0496112_0143659 3300048915 Bacteria 2355
681 Ga0496112_0214754 3300048915 Bacteria 1880
682 Ga0496113_0004662 3300048916 Bacteria 8456
683 Ga0496115_0009072 3300048918 Bacteria 7379
684 Ga0496115_0057219 3300048918 Unclassified 3136
685 Ga0496115_0100932 3300048918 Unclassified 2365
686 nmdc:mga0n895_20822_c1 3300050512 Bacteria 6125
687 nmdc:mga0n895_7414_c1 3300050512 Bacteria 9413
688 nmdc:mga0rr50_2153_c1 3300050513 Bacteria 11011
689 nmdc:mga0rr50_46417_c1 3300050513 Unclassified 3198
690 nmdc:mga0rr50_4659_c1 3300050513 Bacteria 8083
691 nmdc:mga08x19_12305_c1 3300050514 Bacteria 5151
692 nmdc:mga08x19_8404_c1 3300050514 Bacteria 6151
693 nmdc:mga0a205_2659_c1 3300050515 Bacteria 15797

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006028 Ga0070717_10042437 Ga0070717_100424373 283
2 3300013104 Ga0157370_10196902 Ga0157370_101969022 288
3 3300048907 Ga0496104_0181991 Ga0496104_0181991_14_892 292
4 3300045976 Ga0466967_0735688 Ga0466967_0735688_13_957 300
5 3300030760 Ga0265762_1000418 Ga0265762_10004184 302
6 3300028800 Ga0265338_10048335 Ga0265338_100483353 304
7 3300005445 Ga0070708_100016177 Ga0070708_1000161773 309
8 3300005467 Ga0070706_100129708 Ga0070706_1001297082 309
9 3300005468 Ga0070707_100040755 Ga0070707_1000407552 309
10 3300025910 Ga0207684_10069000 Ga0207684_100690002 309
11 3300028800 Ga0265338_10076355 Ga0265338_100763552 311
12 3300035695 Ga0373927_0065169 Ga0373927_0065169_35_970 311
13 3300005445 Ga0070708_100089236 Ga0070708_1000892362 312
14 3300005467 Ga0070706_100096200 Ga0070706_1000962002 312
15 3300022730 Ga0224570_100347 Ga0224570_1003472 312
16 3300024227 Ga0228598_1005539 Ga0228598_10055392 312
17 3300031711 Ga0265314_10128577 Ga0265314_101285771 313
18 3300005518 Ga0070699_100090972 Ga0070699_1000909722 315
19 3300005468 Ga0070707_100023721 Ga0070707_1000237215 316
20 3300005518 Ga0070699_100039804 Ga0070699_1000398041 316
21 3300005536 Ga0070697_100350441 Ga0070697_1003504411 316
22 3300005434 Ga0070709_10022862 Ga0070709_100228623 317
23 3300005436 Ga0070713_100000531 Ga0070713_1000005313 317
24 3300005437 Ga0070710_10008425 Ga0070710_100084255 317
25 3300005439 Ga0070711_100001578 Ga0070711_1000015788 317
26 3300006028 Ga0070717_10002932 Ga0070717_100029327 317
27 3300006163 Ga0070715_10010820 Ga0070715_100108203 317
28 3300006173 Ga0070716_100003816 Ga0070716_1000038167 317
29 3300006175 Ga0070712_100001245 Ga0070712_10000124512 317
30 3300025898 Ga0207692_10006406 Ga0207692_100064062 317
31 3300025905 Ga0207685_10019631 Ga0207685_100196312 317
32 3300025906 Ga0207699_10035935 Ga0207699_100359352 317
33 3300025915 Ga0207693_10000140 Ga0207693_1000014046 317
34 3300025916 Ga0207663_10000470 Ga0207663_100004702 317
35 3300025928 Ga0207700_10000708 Ga0207700_1000070810 317
36 3300025939 Ga0207665_10002386 Ga0207665_100023862 317
37 3300035695 Ga0373927_0077709 Ga0373927_0077709_166_1254 317
38 3300035725 Ga0373947_0070393 Ga0373947_0070393_61_1149 317
39 3300046459 Ga0495629_0087997 Ga0495629_0087997_508_1596 317
40 3300046472 Ga0495580_0001908 Ga0495580_0001908_10529_11617 317
41 3300046473 Ga0495582_0001438 Ga0495582_0001438_5747_6835 317
42 3300048918 Ga0496115_0009072 Ga0496115_0009072_1860_2948 317
43 3300001978 JGI24747J21853_1000176 JGI24747J21853_10001762 318
44 3300001990 JGI24737J22298_10026519 JGI24737J22298_100265192 318
45 3300005334 Ga0068869_100052771 Ga0068869_1000527713 318
46 3300005335 Ga0070666_10057046 Ga0070666_100570462 318
47 3300005337 Ga0070682_100015308 Ga0070682_1000153082 318
48 3300005345 Ga0070692_10038522 Ga0070692_100385222 318
49 3300005355 Ga0070671_100102360 Ga0070671_1001023602 318
50 3300005456 Ga0070678_100037932 Ga0070678_1000379323 318
51 3300035113 Ga0373936_0003250 Ga0373936_0003250_2509_3597 318
52 3300035116 Ga0373945_0024387 Ga0373945_0024387_941_2029 318
53 3300035692 Ga0373935_0050159 Ga0373935_0050159_277_1365 318
54 3300047319 Ga0495674_0063268 Ga0495674_0063268_1906_2994 318
55 3300028017 Ga0265356_1002258 Ga0265356_10022582 323
56 3300030760 Ga0265762_1000484 Ga0265762_10004846 323
57 3300031241 Ga0265325_10026488 Ga0265325_100264882 324
58 3300031247 Ga0265340_10048949 Ga0265340_100489492 324
59 3300031711 Ga0265314_10032533 Ga0265314_100325334 324
60 3300005445 Ga0070708_100008418 Ga0070708_1000084184 327
61 3300005468 Ga0070707_100087248 Ga0070707_1000872481 327
62 3300025922 Ga0207646_10326707 Ga0207646_103267072 327
63 3300025910 Ga0207684_10303297 Ga0207684_103032971 328
64 3300031344 Ga0265316_10012016 Ga0265316_100120164 328
65 3300031711 Ga0265314_10021165 Ga0265314_100211651 328
66 3300046472 Ga0495580_0025265 Ga0495580_0025265_2948_4039 328
67 3300039453 Ga0436362_0466832 Ga0436362_0466832_2884_3966 329
68 3300014497 Ga0182008_10001046 Ga0182008_1000104610 330
69 3300015261 Ga0182006_1010221 Ga0182006_10102214 330
70 3300022732 Ga0224569_100721 Ga0224569_1007213 330
71 3300005434 Ga0070709_10000586 Ga0070709_1000058620 331
72 3300005436 Ga0070713_100000352 Ga0070713_1000003528 331
73 3300005437 Ga0070710_10031128 Ga0070710_100311283 331
74 3300006173 Ga0070716_100003557 Ga0070716_1000035576 331
75 3300006175 Ga0070712_100000658 Ga0070712_10000065811 331
76 3300025898 Ga0207692_10014652 Ga0207692_100146521 331
77 3300025906 Ga0207699_10001214 Ga0207699_1000121410 331
78 3300025915 Ga0207693_10000350 Ga0207693_100003505 331
79 3300025928 Ga0207700_10004605 Ga0207700_100046053 331
80 3300025939 Ga0207665_10013388 Ga0207665_100133884 331
81 3300005445 Ga0070708_100026175 Ga0070708_1000261752 332
82 3300005468 Ga0070707_100106843 Ga0070707_1001068433 332
83 3300005530 Ga0070679_100073747 Ga0070679_1000737473 332
84 3300009174 Ga0105241_10001486 Ga0105241_1000148616 332
85 3300009545 Ga0105237_10029870 Ga0105237_100298704 332
86 3300013100 Ga0157373_10006042 Ga0157373_100060428 332
87 3300013104 Ga0157370_10053518 Ga0157370_100535183 332
88 3300013105 Ga0157369_10025206 Ga0157369_100252067 332
89 3300013296 Ga0157374_10068555 Ga0157374_100685552 332
90 3300013307 Ga0157372_10011993 Ga0157372_100119933 332
91 3300025910 Ga0207684_10004860 Ga0207684_100048606 332
92 3300025911 Ga0207654_10001671 Ga0207654_100016719 332
93 3300025921 Ga0207652_10104864 Ga0207652_101048642 332
94 3300025922 Ga0207646_10221718 Ga0207646_102217182 332
95 3300025945 Ga0207679_10195538 Ga0207679_101955382 332
96 3300025949 Ga0207667_10152045 Ga0207667_101520453 332
97 3300026078 Ga0207702_10000396 Ga0207702_1000039613 332
98 3300026078 Ga0207702_10037198 Ga0207702_100371985 332
99 3300037068 Ga0373925_0012705 Ga0373925_0012705_1677_2768 332
100 3300048915 Ga0496112_0020878 Ga0496112_0020878_4929_6020 332
101 3300005536 Ga0070697_100000397 Ga0070697_10000039718 333
102 3300005841 Ga0068863_100119952 Ga0068863_1001199522 333
103 3300026088 Ga0207641_10109405 Ga0207641_101094051 333
104 3300028800 Ga0265338_10060100 Ga0265338_100601003 333
105 3300031249 Ga0265339_10006959 Ga0265339_100069594 333
106 3300031344 Ga0265316_10018493 Ga0265316_100184935 333
107 3300035695 Ga0373927_0042120 Ga0373927_0042120_1504_2616 333
108 3300046472 Ga0495580_0010830 Ga0495580_0010830_4349_5461 333
109 3300005290 Ga0065712_10028940 Ga0065712_100289401 334
110 3300005329 Ga0070683_100460306 Ga0070683_1004603061 334
111 3300005331 Ga0070670_100208869 Ga0070670_1002088692 334
112 3300005337 Ga0070682_100019066 Ga0070682_1000190664 334
113 3300005339 Ga0070660_100064849 Ga0070660_1000648493 334
114 3300005344 Ga0070661_100049237 Ga0070661_1000492373 334
115 3300005355 Ga0070671_100259487 Ga0070671_1002594871 334
116 3300005455 Ga0070663_100100666 Ga0070663_1001006662 334
117 3300005457 Ga0070662_100141573 Ga0070662_1001415732 334
118 3300005468 Ga0070707_100470646 Ga0070707_1004706461 334
119 3300005564 Ga0070664_100055990 Ga0070664_1000559904 334
120 3300005614 Ga0068856_100028664 Ga0068856_1000286647 334
121 3300005618 Ga0068864_100121664 Ga0068864_1001216643 334
122 3300005834 Ga0068851_10048345 Ga0068851_100483452 334
123 3300006871 Ga0075434_100163176 Ga0075434_1001631762 334
124 3300009093 Ga0105240_10008167 Ga0105240_100081672 334
125 3300009545 Ga0105237_10050389 Ga0105237_100503893 334
126 3300010375 Ga0105239_10137393 Ga0105239_101373933 334
127 3300013105 Ga0157369_10113854 Ga0157369_101138543 334
128 3300013297 Ga0157378_10066055 Ga0157378_100660554 334
129 3300014497 Ga0182008_10029047 Ga0182008_100290472 334
130 3300015261 Ga0182006_1016692 Ga0182006_10166923 334
131 3300025904 Ga0207647_10117169 Ga0207647_101171692 334
132 3300025913 Ga0207695_10255534 Ga0207695_102555342 334
133 3300025919 Ga0207657_10001169 Ga0207657_1000116911 334
134 3300025920 Ga0207649_10035274 Ga0207649_100352743 334
135 3300025931 Ga0207644_10258840 Ga0207644_102588401 334
136 3300025933 Ga0207706_10014037 Ga0207706_100140371 334
137 3300026041 Ga0207639_10046651 Ga0207639_100466512 334
138 3300026067 Ga0207678_10104787 Ga0207678_101047873 334
139 3300048905 Ga0496102_0196386 Ga0496102_0196386_456_1547 334
140 3300048906 Ga0496103_0138242 Ga0496103_0138242_218_1309 334
141 3300048907 Ga0496104_0310269 Ga0496104_0310269_343_1434 334
142 3300005338 Ga0068868_100011959 Ga0068868_1000119593 336
143 3300005437 Ga0070710_10089487 Ga0070710_100894872 336
144 3300005578 Ga0068854_100039175 Ga0068854_1000391752 336
145 3300005841 Ga0068863_100112107 Ga0068863_1001121072 336
146 3300006028 Ga0070717_10012853 Ga0070717_100128536 336
147 3300006237 Ga0097621_100002728 Ga0097621_1000027287 336
148 3300006358 Ga0068871_100034934 Ga0068871_1000349343 336
149 3300009098 Ga0105245_10004111 Ga0105245_100041118 336
150 3300009176 Ga0105242_10006300 Ga0105242_100063009 336
151 3300009177 Ga0105248_10034297 Ga0105248_100342973 336
152 3300013297 Ga0157378_10008887 Ga0157378_100088872 336
153 3300013306 Ga0163162_10078740 Ga0163162_100787403 336
154 3300013306 Ga0163162_10091738 Ga0163162_100917384 336
155 3300014325 Ga0163163_10104250 Ga0163163_101042502 336
156 3300014969 Ga0157376_10099202 Ga0157376_100992022 336
157 3300025903 Ga0207680_10139441 Ga0207680_101394412 336
158 3300025927 Ga0207687_10005776 Ga0207687_100057767 336
159 3300026023 Ga0207677_10007513 Ga0207677_100075133 336
160 3300028800 Ga0265338_10008367 Ga0265338_100083672 336
161 3300048905 Ga0496102_0069961 Ga0496102_0069961_544_1653 336
162 3300048905 Ga0496102_0109263 Ga0496102_0109263_143_1231 336
163 3300005329 Ga0070683_100030114 Ga0070683_1000301144 337
164 3300005335 Ga0070666_10046129 Ga0070666_100461292 337
165 3300005336 Ga0070680_100051175 Ga0070680_1000511752 337
166 3300005337 Ga0070682_100304707 Ga0070682_1003047071 337
167 3300005347 Ga0070668_100037218 Ga0070668_1000372182 337
168 3300005366 Ga0070659_100271012 Ga0070659_1002710121 337
169 3300005434 Ga0070709_10262048 Ga0070709_102620481 337
170 3300005436 Ga0070713_100181808 Ga0070713_1001818082 337
171 3300005445 Ga0070708_100193558 Ga0070708_1001935582 337
172 3300005455 Ga0070663_100065023 Ga0070663_1000650232 337
173 3300005457 Ga0070662_100029331 Ga0070662_1000293314 337
174 3300005459 Ga0068867_100076307 Ga0068867_1000763072 337
175 3300005518 Ga0070699_100027994 Ga0070699_1000279942 337
176 3300005535 Ga0070684_100009183 Ga0070684_1000091832 337
177 3300005536 Ga0070697_100027550 Ga0070697_1000275503 337
178 3300005545 Ga0070695_100014489 Ga0070695_1000144894 337
179 3300005547 Ga0070693_100050882 Ga0070693_1000508823 337
180 3300005548 Ga0070665_100014107 Ga0070665_1000141075 337
181 3300005563 Ga0068855_100292483 Ga0068855_1002924832 337
182 3300005616 Ga0068852_100078917 Ga0068852_1000789172 337
183 3300005617 Ga0068859_100066899 Ga0068859_1000668993 337
184 3300005834 Ga0068851_10022211 Ga0068851_100222114 337
185 3300005843 Ga0068860_100078870 Ga0068860_1000788703 337
186 3300006931 Ga0097620_100066896 Ga0097620_1000668963 337
187 3300009101 Ga0105247_10020936 Ga0105247_100209362 337
188 3300009148 Ga0105243_10055743 Ga0105243_100557434 337
189 3300009177 Ga0105248_10054223 Ga0105248_100542233 337
190 3300009553 Ga0105249_10376572 Ga0105249_103765721 337
191 3300013102 Ga0157371_10017563 Ga0157371_100175635 337
192 3300013105 Ga0157369_10060435 Ga0157369_100604352 337
193 3300013296 Ga0157374_10014051 Ga0157374_100140514 337
194 3300013306 Ga0163162_10006230 Ga0163162_100062308 337
195 3300014968 Ga0157379_10039232 Ga0157379_100392323 337
196 3300014969 Ga0157376_10087801 Ga0157376_100878012 337
197 3300025900 Ga0207710_10015754 Ga0207710_100157542 337
198 3300025906 Ga0207699_10183293 Ga0207699_101832931 337
199 3300025911 Ga0207654_10004523 Ga0207654_100045233 337
200 3300025919 Ga0207657_10001964 Ga0207657_1000196413 337
201 3300025927 Ga0207687_10005572 Ga0207687_100055722 337
202 3300025929 Ga0207664_10000037 Ga0207664_1000003753 337
203 3300025933 Ga0207706_10000432 Ga0207706_1000043220 337
204 3300025935 Ga0207709_10009090 Ga0207709_100090904 337
205 3300025942 Ga0207689_10097811 Ga0207689_100978112 337
206 3300025949 Ga0207667_10007050 Ga0207667_100070508 337
207 3300026041 Ga0207639_10216598 Ga0207639_102165982 337
208 3300026067 Ga0207678_10000722 Ga0207678_1000072212 337
209 3300026095 Ga0207676_10158383 Ga0207676_101583832 337
210 3300026116 Ga0207674_10017682 Ga0207674_100176829 337
211 3300026118 Ga0207675_100105294 Ga0207675_1001052942 337
212 3300026142 Ga0207698_10134253 Ga0207698_101342532 337
213 3300028381 Ga0268264_10206309 Ga0268264_102063092 337
214 3300034817 Ga0373948_0002807 Ga0373948_0002807_647_1735 337
215 3300035113 Ga0373936_0003220 Ga0373936_0003220_3884_4975 337
216 3300035116 Ga0373945_0029295 Ga0373945_0029295_152_1213 337
217 3300035117 Ga0373953_0028325 Ga0373953_0028325_294_1385 337
218 3300035120 Ga0373957_0002067 Ga0373957_0002067_1640_2731 337
219 3300035170 Ga0373943_0000148 Ga0373943_0000148_9114_10175 337
220 3300035692 Ga0373935_0013255 Ga0373935_0013255_2515_3576 337
221 3300035695 Ga0373927_0001079 Ga0373927_0001079_11287_12348 337
222 3300035724 Ga0373933_0055565 Ga0373933_0055565_566_1627 337
223 3300035725 Ga0373947_0001340 Ga0373947_0001340_11473_12534 337
224 3300036401 Ga0373937_0196963 Ga0373937_0196963_802_1863 337
225 3300037068 Ga0373925_0003241 Ga0373925_0003241_5235_6296 337
226 3300046463 Ga0495653_0014292 Ga0495653_0014292_1361_2452 337
227 3300046477 Ga0495664_0034553 Ga0495664_0034553_268_1329 337
228 3300046517 Ga0495630_0049006 Ga0495630_0049006_1404_2495 337
229 3300047471 Ga0495684_0072295 Ga0495684_0072295_734_1825 337
230 3300048907 Ga0496104_0147552 Ga0496104_0147552_145_1233 337
231 3300005434 Ga0070709_10022924 Ga0070709_100229241 338
232 3300006028 Ga0070717_10013844 Ga0070717_100138446 338
233 3300006028 Ga0070717_10029577 Ga0070717_100295772 338
234 3300006175 Ga0070712_100047276 Ga0070712_1000472761 338
235 3300006852 Ga0075433_10000971 Ga0075433_1000097117 338
236 3300006871 Ga0075434_100009879 Ga0075434_1000098796 338
237 3300007076 Ga0075435_100016153 Ga0075435_1000161533 338
238 3300009176 Ga0105242_10191638 Ga0105242_101916382 338
239 3300025899 Ga0207642_10016373 Ga0207642_100163732 338
240 3300025928 Ga0207700_10125460 Ga0207700_101254602 338
241 3300025939 Ga0207665_10003706 Ga0207665_100037068 338
242 3300050512 nmdc:mga0n895_7414_c1 nmdc:mga0n895_7414_c1_400_1497 338
243 3300050513 nmdc:mga0rr50_2153_c1 nmdc:mga0rr50_2153_c1_5221_6318 338
244 3300050514 nmdc:mga08x19_12305_c1 nmdc:mga08x19_12305_c1_400_1497 338
245 3300050515 nmdc:mga0a205_2659_c1 nmdc:mga0a205_2659_c1_11764_12861 338
246 3300005434 Ga0070709_10014481 Ga0070709_100144813 339
247 3300005434 Ga0070709_10100539 Ga0070709_101005391 339
248 3300005439 Ga0070711_100216215 Ga0070711_1002162151 339
249 3300005439 Ga0070711_100239112 Ga0070711_1002391121 339
250 3300005445 Ga0070708_100000729 Ga0070708_10000072920 339
251 3300005458 Ga0070681_10044424 Ga0070681_100444241 339
252 3300005467 Ga0070706_100000499 Ga0070706_1000004997 339
253 3300005468 Ga0070707_100002005 Ga0070707_10000200510 339
254 3300005471 Ga0070698_100001258 Ga0070698_10000125814 339
255 3300005518 Ga0070699_100000621 Ga0070699_10000062114 339
256 3300005536 Ga0070697_100000258 Ga0070697_10000025816 339
257 3300005536 Ga0070697_100015413 Ga0070697_1000154134 339
258 3300005841 Ga0068863_100036172 Ga0068863_1000361722 339
259 3300005841 Ga0068863_100074999 Ga0068863_1000749994 339
260 3300006028 Ga0070717_10060214 Ga0070717_100602142 339
261 3300006173 Ga0070716_100053474 Ga0070716_1000534741 339
262 3300006175 Ga0070712_100073329 Ga0070712_1000733292 339
263 3300006237 Ga0097621_100003550 Ga0097621_1000035509 339
264 3300006358 Ga0068871_100004799 Ga0068871_1000047993 339
265 3300009093 Ga0105240_10159996 Ga0105240_101599962 339
266 3300009098 Ga0105245_10078506 Ga0105245_100785062 339
267 3300009101 Ga0105247_10017515 Ga0105247_100175153 339
268 3300009174 Ga0105241_10003005 Ga0105241_100030055 339
269 3300009177 Ga0105248_10238249 Ga0105248_102382492 339
270 3300009545 Ga0105237_10232874 Ga0105237_102328741 339
271 3300009551 Ga0105238_10017430 Ga0105238_100174303 339
272 3300010159 Ga0099796_10024290 Ga0099796_100242902 339
273 3300011119 Ga0105246_10174545 Ga0105246_101745451 339
274 3300013296 Ga0157374_10000997 Ga0157374_1000099720 339
275 3300013296 Ga0157374_10186858 Ga0157374_101868582 339
276 3300013297 Ga0157378_10010398 Ga0157378_100103987 339
277 3300013306 Ga0163162_10020438 Ga0163162_100204381 339
278 3300014325 Ga0163163_10152526 Ga0163163_101525262 339
279 3300014968 Ga0157379_10005139 Ga0157379_100051397 339
280 3300014968 Ga0157379_10055758 Ga0157379_100557582 339
281 3300025906 Ga0207699_10070157 Ga0207699_100701572 339
282 3300025910 Ga0207684_10000132 Ga0207684_1000013215 339
283 3300025910 Ga0207684_10001821 Ga0207684_1000182117 339
284 3300025911 Ga0207654_10026179 Ga0207654_100261793 339
285 3300025912 Ga0207707_10004957 Ga0207707_1000495710 339
286 3300025913 Ga0207695_10021666 Ga0207695_100216665 339
287 3300025913 Ga0207695_10321256 Ga0207695_103212562 339
288 3300025922 Ga0207646_10000301 Ga0207646_1000030115 339
289 3300025924 Ga0207694_10035217 Ga0207694_100352172 339
290 3300025939 Ga0207665_10022639 Ga0207665_100226391 339
291 3300026088 Ga0207641_10011551 Ga0207641_100115514 339
292 3300026088 Ga0207641_10062642 Ga0207641_100626422 339
293 3300046472 Ga0495580_0007428 Ga0495580_0007428_7132_8220 339
294 3300048903 Ga0496100_0116410 Ga0496100_0116410_68_1156 339
295 3300048904 Ga0496101_0023892 Ga0496101_0023892_2680_3768 339
296 3300048907 Ga0496104_0148459 Ga0496104_0148459_219_1307 339
297 3300048909 Ga0496106_0045751 Ga0496106_0045751_1242_2330 339
298 3300048915 Ga0496112_0143659 Ga0496112_0143659_39_1127 339
299 3300005436 Ga0070713_100069617 Ga0070713_1000696174 340
300 3300005844 Ga0068862_100123345 Ga0068862_1001233452 340
301 3300025940 Ga0207691_10126085 Ga0207691_101260852 340
302 3300025986 Ga0207658_10087814 Ga0207658_100878142 340
303 3300045976 Ga0466967_0171562 Ga0466967_0171562_905_1996 340
304 3300007788 Ga0099795_10031611 Ga0099795_100316112 342
305 3300009093 Ga0105240_10044008 Ga0105240_100440083 342
306 3300013105 Ga0157369_10015793 Ga0157369_100157936 342
307 3300013307 Ga0157372_10001204 Ga0157372_1000120417 342
308 3300025913 Ga0207695_10043703 Ga0207695_100437036 342
309 3300005436 Ga0070713_100007494 Ga0070713_1000074946 343
310 3300006175 Ga0070712_100002784 Ga0070712_10000278410 343
311 3300025915 Ga0207693_10002744 Ga0207693_100027446 343
312 3300045976 Ga0466967_0012847 Ga0466967_0012847_2370_3458 343
313 3300046472 Ga0495580_0071255 Ga0495580_0071255_319_1407 343
314 3300048088 Ga0495602_0036805 Ga0495602_0036805_1389_2477 343
315 3300046473 Ga0495582_0038428 Ga0495582_0038428_1066_2151 344
316 3300005437 Ga0070710_10000959 Ga0070710_1000095911 345
317 3300025898 Ga0207692_10004844 Ga0207692_100048445 345
318 3300035725 Ga0373947_0113613 Ga0373947_0113613_552_1640 345
319 3300046472 Ga0495580_0090847 Ga0495580_0090847_514_1602 345
320 3300046499 Ga0495594_0018601 Ga0495594_0018601_44_1117 346
321 3300005614 Ga0068856_100002086 Ga0068856_1000020868 347
322 3300006173 Ga0070716_100017624 Ga0070716_1000176243 347
323 3300009093 Ga0105240_10018860 Ga0105240_100188606 347
324 3300013100 Ga0157373_10123591 Ga0157373_101235912 347
325 3300013105 Ga0157369_10138228 Ga0157369_101382282 347
326 3300013307 Ga0157372_10007745 Ga0157372_1000774510 347
327 3300025906 Ga0207699_10035512 Ga0207699_100355122 347
328 3300025921 Ga0207652_10295355 Ga0207652_102953552 347
329 3300025949 Ga0207667_10162474 Ga0207667_101624742 347
330 3300026078 Ga0207702_10226089 Ga0207702_102260891 347
331 3300031090 Ga0265760_10001955 Ga0265760_100019553 348
332 3300024227 Ga0228598_1000128 Ga0228598_100012813 349
333 3300030878 Ga0265770_1004394 Ga0265770_10043942 349
334 3300031090 Ga0265760_10000243 Ga0265760_100002434 349
335 3300031090 Ga0265760_10022476 Ga0265760_100224762 349
336 3300000546 LJNas_1002028 LJNas_10020283 350
337 3300005334 Ga0068869_100006028 Ga0068869_1000060283 350
338 3300005338 Ga0068868_100008758 Ga0068868_1000087585 350
339 3300005434 Ga0070709_10189669 Ga0070709_101896691 350
340 3300005437 Ga0070710_10084190 Ga0070710_100841901 350
341 3300005439 Ga0070711_100020066 Ga0070711_1000200661 350
342 3300005445 Ga0070708_100086097 Ga0070708_1000860973 350
343 3300005467 Ga0070706_100207265 Ga0070706_1002072652 350
344 3300005468 Ga0070707_100005851 Ga0070707_1000058512 350
345 3300005471 Ga0070698_100000795 Ga0070698_1000007958 350
346 3300005518 Ga0070699_100001944 Ga0070699_1000019446 350
347 3300005539 Ga0068853_100178841 Ga0068853_1001788412 350
348 3300005617 Ga0068859_100009582 Ga0068859_1000095824 350
349 3300005841 Ga0068863_100032516 Ga0068863_1000325163 350
350 3300005843 Ga0068860_100021853 Ga0068860_1000218532 350
351 3300006028 Ga0070717_10252387 Ga0070717_102523872 350
352 3300006173 Ga0070716_100124327 Ga0070716_1001243271 350
353 3300006175 Ga0070712_100000193 Ga0070712_10000019320 350
354 3300006358 Ga0068871_100013866 Ga0068871_1000138665 350
355 3300006358 Ga0068871_100152279 Ga0068871_1001522792 350
356 3300006881 Ga0068865_100036197 Ga0068865_1000361974 350
357 3300006931 Ga0097620_100009582 Ga0097620_1000095824 350
358 3300009098 Ga0105245_10096856 Ga0105245_100968562 350
359 3300009177 Ga0105248_10107376 Ga0105248_101073762 350
360 3300010375 Ga0105239_10069680 Ga0105239_100696803 350
361 3300011119 Ga0105246_10094579 Ga0105246_100945792 350
362 3300013296 Ga0157374_10021413 Ga0157374_100214132 350
363 3300013306 Ga0163162_10017904 Ga0163162_100179046 350
364 3300013308 Ga0157375_10076539 Ga0157375_100765393 350
365 3300013308 Ga0157375_10135089 Ga0157375_101350893 350
366 3300025898 Ga0207692_10015804 Ga0207692_100158043 350
367 3300025904 Ga0207647_10025669 Ga0207647_100256693 350
368 3300025905 Ga0207685_10038700 Ga0207685_100387002 350
369 3300025906 Ga0207699_10145188 Ga0207699_101451882 350
370 3300025915 Ga0207693_10000632 Ga0207693_1000063223 350
371 3300025916 Ga0207663_10006194 Ga0207663_100061942 350
372 3300025922 Ga0207646_10001216 Ga0207646_1000121611 350
373 3300025927 Ga0207687_10146463 Ga0207687_101464631 350
374 3300025939 Ga0207665_10136687 Ga0207665_101366872 350
375 3300025941 Ga0207711_10125359 Ga0207711_101253592 350
376 3300025942 Ga0207689_10001515 Ga0207689_100015156 350
377 3300026023 Ga0207677_10008014 Ga0207677_100080144 350
378 3300026035 Ga0207703_10004042 Ga0207703_100040429 350
379 3300026118 Ga0207675_100068955 Ga0207675_1000689552 350
380 3300030760 Ga0265762_1002175 Ga0265762_10021752 350
381 3300031090 Ga0265760_10000412 Ga0265760_100004123 350
382 3300031235 Ga0265330_10006625 Ga0265330_100066254 350
383 3300045976 Ga0466967_0057364 Ga0466967_0057364_2214_3299 350
384 3300048915 Ga0496112_0018280 Ga0496112_0018280_270_1355 350
385 2162886012 MBSR1b_contig_7742423 MBSR1b_0178.00003860 351
386 3300001976 JGI24752J21851_1000806 JGI24752J21851_10008062 351
387 3300001991 JGI24743J22301_10007840 JGI24743J22301_100078401 351
388 3300002459 JGI24751J29686_10000991 JGI24751J29686_100009916 351
389 3300005293 Ga0065715_10004417 Ga0065715_100044176 351
390 3300005328 Ga0070676_10015163 Ga0070676_100151633 351
391 3300005329 Ga0070683_100001564 Ga0070683_1000015644 351
392 3300005329 Ga0070683_100059326 Ga0070683_1000593262 351
393 3300005330 Ga0070690_100014844 Ga0070690_1000148445 351
394 3300005331 Ga0070670_100030748 Ga0070670_1000307483 351
395 3300005331 Ga0070670_100229248 Ga0070670_1002292481 351
396 3300005333 Ga0070677_10042392 Ga0070677_100423922 351
397 3300005334 Ga0068869_100005664 Ga0068869_1000056644 351
398 3300005338 Ga0068868_100006287 Ga0068868_1000062877 351
399 3300005338 Ga0068868_100012075 Ga0068868_1000120756 351
400 3300005338 Ga0068868_100049467 Ga0068868_1000494672 351
401 3300005339 Ga0070660_100089814 Ga0070660_1000898143 351
402 3300005340 Ga0070689_100004902 Ga0070689_1000049027 351
403 3300005344 Ga0070661_100000794 Ga0070661_10000079415 351
404 3300005344 Ga0070661_100019296 Ga0070661_1000192962 351
405 3300005347 Ga0070668_100005232 Ga0070668_1000052328 351
406 3300005353 Ga0070669_100008095 Ga0070669_1000080958 351
407 3300005354 Ga0070675_100004164 Ga0070675_10000416410 351
408 3300005355 Ga0070671_100085747 Ga0070671_1000857471 351
409 3300005356 Ga0070674_100026924 Ga0070674_1000269242 351
410 3300005364 Ga0070673_100015803 Ga0070673_1000158032 351
411 3300005365 Ga0070688_100000826 Ga0070688_1000008263 351
412 3300005366 Ga0070659_100007081 Ga0070659_1000070819 351
413 3300005367 Ga0070667_100075732 Ga0070667_1000757322 351
414 3300005434 Ga0070709_10011222 Ga0070709_100112225 351
415 3300005435 Ga0070714_100001396 Ga0070714_10000139615 351
416 3300005435 Ga0070714_100004544 Ga0070714_1000045442 351
417 3300005435 Ga0070714_100046920 Ga0070714_1000469203 351
418 3300005435 Ga0070714_100108677 Ga0070714_1001086771 351
419 3300005435 Ga0070714_100329993 Ga0070714_1003299931 351
420 3300005436 Ga0070713_100002892 Ga0070713_1000028921 351
421 3300005436 Ga0070713_100028366 Ga0070713_1000283664 351
422 3300005436 Ga0070713_100035251 Ga0070713_1000352512 351
423 3300005438 Ga0070701_10032127 Ga0070701_100321274 351
424 3300005439 Ga0070711_100003134 Ga0070711_1000031341 351
425 3300005440 Ga0070705_100211739 Ga0070705_1002117391 351
426 3300005445 Ga0070708_100011801 Ga0070708_1000118012 351
427 3300005445 Ga0070708_100017546 Ga0070708_1000175462 351
428 3300005445 Ga0070708_100053262 Ga0070708_1000532623 351
429 3300005445 Ga0070708_100097238 Ga0070708_1000972381 351
430 3300005455 Ga0070663_100019711 Ga0070663_1000197112 351
431 3300005457 Ga0070662_100009829 Ga0070662_1000098297 351
432 3300005457 Ga0070662_100112456 Ga0070662_1001124562 351
433 3300005458 Ga0070681_10000195 Ga0070681_1000019520 351
434 3300005459 Ga0068867_100007106 Ga0068867_1000071069 351
435 3300005466 Ga0070685_10001068 Ga0070685_1000106812 351
436 3300005467 Ga0070706_100161115 Ga0070706_1001611152 351
437 3300005467 Ga0070706_100165697 Ga0070706_1001656971 351
438 3300005468 Ga0070707_100082477 Ga0070707_1000824773 351
439 3300005530 Ga0070679_100006160 Ga0070679_1000061603 351
440 3300005530 Ga0070679_100181924 Ga0070679_1001819242 351
441 3300005535 Ga0070684_100000661 Ga0070684_10000066111 351
442 3300005535 Ga0070684_100060589 Ga0070684_1000605894 351
443 3300005535 Ga0070684_100084970 Ga0070684_1000849702 351
444 3300005535 Ga0070684_100120526 Ga0070684_1001205263 351
445 3300005536 Ga0070697_100074258 Ga0070697_1000742582 351
446 3300005539 Ga0068853_100002656 Ga0068853_10000265612 351
447 3300005539 Ga0068853_100407017 Ga0068853_1004070171 351
448 3300005543 Ga0070672_100006357 Ga0070672_1000063576 351
449 3300005544 Ga0070686_100006812 Ga0070686_1000068125 351
450 3300005563 Ga0068855_100000978 Ga0068855_10000097814 351
451 3300005563 Ga0068855_100005912 Ga0068855_1000059129 351
452 3300005563 Ga0068855_100063262 Ga0068855_1000632625 351
453 3300005563 Ga0068855_100080883 Ga0068855_1000808835 351
454 3300005564 Ga0070664_100001252 Ga0070664_10000125213 351
455 3300005564 Ga0070664_100174052 Ga0070664_1001740522 351
456 3300005577 Ga0068857_100002090 Ga0068857_10000209016 351
457 3300005577 Ga0068857_100007487 Ga0068857_10000748710 351
458 3300005578 Ga0068854_100034529 Ga0068854_1000345292 351
459 3300005578 Ga0068854_100073447 Ga0068854_1000734472 351
460 3300005614 Ga0068856_100000107 Ga0068856_10000010722 351
461 3300005614 Ga0068856_100000483 Ga0068856_1000004839 351
462 3300005614 Ga0068856_100009826 Ga0068856_1000098261 351
463 3300005614 Ga0068856_100038299 Ga0068856_1000382995 351
464 3300005614 Ga0068856_100047585 Ga0068856_1000475852 351
465 3300005614 Ga0068856_100171050 Ga0068856_1001710502 351
466 3300005614 Ga0068856_100172329 Ga0068856_1001723293 351
467 3300005615 Ga0070702_100002782 Ga0070702_1000027828 351
468 3300005616 Ga0068852_100003925 Ga0068852_1000039254 351
469 3300005617 Ga0068859_100000951 Ga0068859_1000009512 351
470 3300005618 Ga0068864_100007554 Ga0068864_1000075546 351
471 3300005618 Ga0068864_100011018 Ga0068864_1000110187 351
472 3300005618 Ga0068864_100027359 Ga0068864_1000273593 351
473 3300005718 Ga0068866_10001489 Ga0068866_100014894 351
474 3300005718 Ga0068866_10005505 Ga0068866_100055051 351
475 3300005719 Ga0068861_100080384 Ga0068861_1000803844 351
476 3300005840 Ga0068870_10000594 Ga0068870_100005946 351
477 3300005841 Ga0068863_100008718 Ga0068863_1000087183 351
478 3300005841 Ga0068863_100012494 Ga0068863_1000124946 351
479 3300005841 Ga0068863_100075760 Ga0068863_1000757603 351
480 3300005842 Ga0068858_100002793 Ga0068858_1000027935 351
481 3300005842 Ga0068858_100004335 Ga0068858_1000043359 351
482 3300005843 Ga0068860_100004530 Ga0068860_1000045305 351
483 3300005843 Ga0068860_100182026 Ga0068860_1001820262 351
484 3300005843 Ga0068860_100347819 Ga0068860_1003478191 351
485 3300005844 Ga0068862_100010269 Ga0068862_1000102697 351
486 3300006028 Ga0070717_10000383 Ga0070717_1000038310 351
487 3300006028 Ga0070717_10151883 Ga0070717_101518832 351
488 3300006028 Ga0070717_10180131 Ga0070717_101801312 351
489 3300006163 Ga0070715_10043444 Ga0070715_100434442 351
490 3300006173 Ga0070716_100000278 Ga0070716_10000027815 351
491 3300006173 Ga0070716_100010295 Ga0070716_1000102955 351
492 3300006175 Ga0070712_100001997 Ga0070712_10000199710 351
493 3300006175 Ga0070712_100109397 Ga0070712_1001093972 351
494 3300006175 Ga0070712_100136165 Ga0070712_1001361651 351
495 3300006237 Ga0097621_100000223 Ga0097621_1000002232 351
496 3300006237 Ga0097621_100003554 Ga0097621_1000035543 351
497 3300006237 Ga0097621_100006566 Ga0097621_1000065664 351
498 3300006237 Ga0097621_100023835 Ga0097621_1000238353 351
499 3300006358 Ga0068871_100000410 Ga0068871_10000041018 351
500 3300006358 Ga0068871_100024200 Ga0068871_1000242002 351
501 3300006358 Ga0068871_100029703 Ga0068871_1000297032 351
502 3300006358 Ga0068871_100098226 Ga0068871_1000982262 351
503 3300006881 Ga0068865_100005068 Ga0068865_1000050688 351
504 3300006881 Ga0068865_100019589 Ga0068865_1000195892 351
505 3300006914 Ga0075436_100000709 Ga0075436_10000070916 351
506 3300006931 Ga0097620_100000951 Ga0097620_10000095126 351
507 3300007076 Ga0075435_100000841 Ga0075435_1000008418 351
508 3300007076 Ga0075435_100092912 Ga0075435_1000929122 351
509 3300009011 Ga0105251_10110807 Ga0105251_101108071 351
510 3300009093 Ga0105240_10002618 Ga0105240_1000261815 351
511 3300009093 Ga0105240_10153216 Ga0105240_101532161 351
512 3300009093 Ga0105240_10154251 Ga0105240_101542513 351
513 3300009093 Ga0105240_10205581 Ga0105240_102055811 351
514 3300009098 Ga0105245_10002658 Ga0105245_1000265812 351
515 3300009101 Ga0105247_10057598 Ga0105247_100575983 351
516 3300009174 Ga0105241_10021699 Ga0105241_100216995 351
517 3300009174 Ga0105241_10055135 Ga0105241_100551352 351
518 3300009176 Ga0105242_10025528 Ga0105242_100255282 351
519 3300009177 Ga0105248_10003183 Ga0105248_100031835 351
520 3300009177 Ga0105248_10016820 Ga0105248_100168208 351
521 3300009545 Ga0105237_10019545 Ga0105237_100195456 351
522 3300009545 Ga0105237_10021096 Ga0105237_100210965 351
523 3300009551 Ga0105238_10000090 Ga0105238_1000009064 351
524 3300009551 Ga0105238_10103373 Ga0105238_101033732 351
525 3300009553 Ga0105249_10015904 Ga0105249_100159045 351
526 3300010375 Ga0105239_10015829 Ga0105239_100158292 351
527 3300010375 Ga0105239_10025239 Ga0105239_100252394 351
528 3300010375 Ga0105239_10094539 Ga0105239_100945393 351
529 3300011119 Ga0105246_10000592 Ga0105246_1000059212 351
530 3300013100 Ga0157373_10005921 Ga0157373_100059213 351
531 3300013100 Ga0157373_10079568 Ga0157373_100795682 351
532 3300013102 Ga0157371_10053241 Ga0157371_100532414 351
533 3300013102 Ga0157371_10070345 Ga0157371_100703452 351
534 3300013102 Ga0157371_10110626 Ga0157371_101106262 351
535 3300013104 Ga0157370_10062916 Ga0157370_100629161 351
536 3300013105 Ga0157369_10005632 Ga0157369_100056326 351
537 3300013105 Ga0157369_10013615 Ga0157369_100136152 351
538 3300013105 Ga0157369_10027601 Ga0157369_100276012 351
539 3300013105 Ga0157369_10046582 Ga0157369_100465824 351
540 3300013105 Ga0157369_10108666 Ga0157369_101086663 351
541 3300013296 Ga0157374_10000097 Ga0157374_100000973 351
542 3300013296 Ga0157374_10000305 Ga0157374_1000030520 351
543 3300013296 Ga0157374_10022194 Ga0157374_100221945 351
544 3300013297 Ga0157378_10000265 Ga0157378_1000026533 351
545 3300013297 Ga0157378_10001362 Ga0157378_1000136217 351
546 3300013297 Ga0157378_10045833 Ga0157378_100458332 351
547 3300013306 Ga0163162_10091176 Ga0163162_100911762 351
548 3300013307 Ga0157372_10000766 Ga0157372_100007668 351
549 3300013307 Ga0157372_10001033 Ga0157372_1000103317 351
550 3300013307 Ga0157372_10007887 Ga0157372_100078878 351
551 3300013307 Ga0157372_10008029 Ga0157372_100080295 351
552 3300013307 Ga0157372_10008514 Ga0157372_100085147 351
553 3300013307 Ga0157372_10010175 Ga0157372_100101757 351
554 3300013307 Ga0157372_10070516 Ga0157372_100705163 351
555 3300013307 Ga0157372_10335318 Ga0157372_103353182 351
556 3300013308 Ga0157375_10027623 Ga0157375_100276236 351
557 3300013308 Ga0157375_10231066 Ga0157375_102310662 351
558 3300014325 Ga0163163_10001245 Ga0163163_100012454 351
559 3300014326 Ga0157380_10133793 Ga0157380_101337932 351
560 3300014745 Ga0157377_10000498 Ga0157377_100004987 351
561 3300014968 Ga0157379_10011871 Ga0157379_100118716 351
562 3300014969 Ga0157376_10025960 Ga0157376_100259602 351
563 3300014969 Ga0157376_10050739 Ga0157376_100507391 351
564 3300014969 Ga0157376_10119192 Ga0157376_101191922 351
565 3300025321 Ga0207656_10005808 Ga0207656_100058085 351
566 3300025898 Ga0207692_10015012 Ga0207692_100150123 351
567 3300025899 Ga0207642_10004132 Ga0207642_100041324 351
568 3300025900 Ga0207710_10016177 Ga0207710_100161772 351
569 3300025901 Ga0207688_10006592 Ga0207688_100065927 351
570 3300025903 Ga0207680_10006132 Ga0207680_100061326 351
571 3300025904 Ga0207647_10000432 Ga0207647_1000043222 351
572 3300025907 Ga0207645_10001148 Ga0207645_1000114812 351
573 3300025908 Ga0207643_10000501 Ga0207643_1000050125 351
574 3300025912 Ga0207707_10001239 Ga0207707_1000123920 351
575 3300025913 Ga0207695_10013360 Ga0207695_100133602 351
576 3300025913 Ga0207695_10028837 Ga0207695_100288375 351
577 3300025913 Ga0207695_10035284 Ga0207695_100352844 351
578 3300025913 Ga0207695_10357000 Ga0207695_103570001 351
579 3300025914 Ga0207671_10020714 Ga0207671_100207145 351
580 3300025915 Ga0207693_10003987 Ga0207693_100039876 351
581 3300025915 Ga0207693_10021582 Ga0207693_100215826 351
582 3300025915 Ga0207693_10129903 Ga0207693_101299032 351
583 3300025916 Ga0207663_10005352 Ga0207663_100053522 351
584 3300025916 Ga0207663_10138961 Ga0207663_101389612 351
585 3300025916 Ga0207663_10273423 Ga0207663_102734231 351
586 3300025919 Ga0207657_10002323 Ga0207657_1000232312 351
587 3300025920 Ga0207649_10000374 Ga0207649_1000037420 351
588 3300025920 Ga0207649_10012634 Ga0207649_100126345 351
589 3300025921 Ga0207652_10006549 Ga0207652_1000654910 351
590 3300025923 Ga0207681_10080422 Ga0207681_100804222 351
591 3300025924 Ga0207694_10057257 Ga0207694_100572572 351
592 3300025924 Ga0207694_10109623 Ga0207694_101096233 351
593 3300025925 Ga0207650_10000045 Ga0207650_10000045111 351
594 3300025927 Ga0207687_10032039 Ga0207687_100320394 351
595 3300025928 Ga0207700_10015826 Ga0207700_100158263 351
596 3300025928 Ga0207700_10046447 Ga0207700_100464472 351
597 3300025928 Ga0207700_10076706 Ga0207700_100767062 351
598 3300025928 Ga0207700_10135212 Ga0207700_101352122 351
599 3300025929 Ga0207664_10180546 Ga0207664_101805462 351
600 3300025929 Ga0207664_10344274 Ga0207664_103442741 351
601 3300025931 Ga0207644_10011926 Ga0207644_100119266 351
602 3300025931 Ga0207644_10261101 Ga0207644_102611012 351
603 3300025932 Ga0207690_10059893 Ga0207690_100598931 351
604 3300025933 Ga0207706_10000414 Ga0207706_1000041432 351
605 3300025936 Ga0207670_10002157 Ga0207670_100021572 351
606 3300025937 Ga0207669_10019116 Ga0207669_100191163 351
607 3300025938 Ga0207704_10006107 Ga0207704_100061076 351
608 3300025938 Ga0207704_10027858 Ga0207704_100278582 351
609 3300025939 Ga0207665_10000046 Ga0207665_100000467 351
610 3300025939 Ga0207665_10022159 Ga0207665_100221592 351
611 3300025940 Ga0207691_10000151 Ga0207691_1000015142 351
612 3300025941 Ga0207711_10013585 Ga0207711_100135854 351
613 3300025942 Ga0207689_10000129 Ga0207689_1000012939 351
614 3300025942 Ga0207689_10011670 Ga0207689_100116706 351
615 3300025944 Ga0207661_10000099 Ga0207661_1000009940 351
616 3300025945 Ga0207679_10000096 Ga0207679_1000009654 351
617 3300025945 Ga0207679_10030308 Ga0207679_100303083 351
618 3300025949 Ga0207667_10001904 Ga0207667_1000190421 351
619 3300025949 Ga0207667_10008001 Ga0207667_100080019 351
620 3300025949 Ga0207667_10064454 Ga0207667_100644544 351
621 3300025960 Ga0207651_10022946 Ga0207651_100229464 351
622 3300025960 Ga0207651_10265108 Ga0207651_102651082 351
623 3300025972 Ga0207668_10057817 Ga0207668_100578172 351
624 3300025981 Ga0207640_10025561 Ga0207640_100255612 351
625 3300025981 Ga0207640_10049622 Ga0207640_100496222 351
626 3300025986 Ga0207658_10009251 Ga0207658_100092516 351
627 3300026023 Ga0207677_10007414 Ga0207677_100074142 351
628 3300026023 Ga0207677_10034353 Ga0207677_100343532 351
629 3300026023 Ga0207677_10060379 Ga0207677_100603792 351
630 3300026035 Ga0207703_10011851 Ga0207703_100118514 351
631 3300026035 Ga0207703_10033153 Ga0207703_100331532 351
632 3300026067 Ga0207678_10000026 Ga0207678_1000002637 351
633 3300026078 Ga0207702_10000103 Ga0207702_1000010360 351
634 3300026078 Ga0207702_10006399 Ga0207702_100063997 351
635 3300026078 Ga0207702_10043743 Ga0207702_100437433 351
636 3300026078 Ga0207702_10059342 Ga0207702_100593423 351
637 3300026078 Ga0207702_10132350 Ga0207702_101323502 351
638 3300026088 Ga0207641_10000075 Ga0207641_10000075111 351
639 3300026088 Ga0207641_10031544 Ga0207641_100315443 351
640 3300026088 Ga0207641_10034491 Ga0207641_100344913 351
641 3300026089 Ga0207648_10002645 Ga0207648_1000264510 351
642 3300026095 Ga0207676_10000096 Ga0207676_1000009660 351
643 3300026095 Ga0207676_10001149 Ga0207676_1000114913 351
644 3300026116 Ga0207674_10000246 Ga0207674_1000024660 351
645 3300026116 Ga0207674_10004470 Ga0207674_1000447016 351
646 3300026118 Ga0207675_100009570 Ga0207675_1000095709 351
647 3300026121 Ga0207683_10000259 Ga0207683_100002597 351
648 3300026142 Ga0207698_10039929 Ga0207698_100399294 351
649 3300026142 Ga0207698_10097903 Ga0207698_100979032 351
650 3300028379 Ga0268266_10001241 Ga0268266_1000124121 351
651 3300028380 Ga0268265_10008564 Ga0268265_100085642 351
652 3300028381 Ga0268264_10013181 Ga0268264_100131816 351
653 3300028381 Ga0268264_10044707 Ga0268264_100447073 351
654 3300033547 Ga0316212_1004220 Ga0316212_10042202 351
655 3300035171 Ga0373946_0056736 Ga0373946_0056736_285_1382 351
656 3300035692 Ga0373935_0063007 Ga0373935_0063007_839_1936 351
657 3300035695 Ga0373927_0010643 Ga0373927_0010643_2089_3177 351
658 3300035725 Ga0373947_0070320 Ga0373947_0070320_300_1388 351
659 3300036401 Ga0373937_0104456 Ga0373937_0104456_319_1413 351
660 3300037068 Ga0373925_0207539 Ga0373925_0207539_196_1284 351
661 3300037853 Ga0436364_1358914 Ga0436364_1358914_892_1980 351
662 3300039450 Ga0436363_1412803 Ga0436363_1412803_49_1137 351
663 3300045051 Ga0451576_0297943 Ga0451576_0297943_191_1282 351
664 3300046472 Ga0495580_0001097 Ga0495580_0001097_20624_21712 351
665 3300046472 Ga0495580_0003312 Ga0495580_0003312_2911_3999 351
666 3300046472 Ga0495580_0004680 Ga0495580_0004680_6922_8010 351
667 3300046472 Ga0495580_0005828 Ga0495580_0005828_8064_9152 351
668 3300046472 Ga0495580_0053703 Ga0495580_0053703_149_1237 351
669 3300046472 Ga0495580_0090174 Ga0495580_0090174_1025_2113 351
670 3300046473 Ga0495582_0000452 Ga0495582_0000452_20705_21793 351
671 3300046475 Ga0495639_0140951 Ga0495639_0140951_10_1098 351
672 3300046531 Ga0495665_0067813 Ga0495665_0067813_267_1355 351
673 3300046690 Ga0495624_0125426 Ga0495624_0125426_415_1503 351
674 3300047319 Ga0495674_0088526 Ga0495674_0088526_987_2075 351
675 3300048905 Ga0496102_0090484 Ga0496102_0090484_1060_2115 351
676 3300048907 Ga0496104_0089467 Ga0496104_0089467_883_1974 351
677 3300048907 Ga0496104_0115822 Ga0496104_0115822_1456_2544 351
678 3300048909 Ga0496106_0131711 Ga0496106_0131711_117_1172 351
679 3300048911 Ga0496108_0000943 Ga0496108_0000943_18855_19910 351
680 3300048912 Ga0496109_0000132 Ga0496109_0000132_38713_39768 351
681 3300048913 Ga0496110_0031229 Ga0496110_0031229_696_1751 351
682 3300048914 Ga0496111_0016861 Ga0496111_0016861_3378_4433 351
683 3300048915 Ga0496112_0000448 Ga0496112_0000448_8007_9062 351
684 3300048915 Ga0496112_0031902 Ga0496112_0031902_1835_2893 351
685 3300048915 Ga0496112_0043755 Ga0496112_0043755_1213_2304 351
686 3300048915 Ga0496112_0214754 Ga0496112_0214754_359_1450 351
687 3300048916 Ga0496113_0004662 Ga0496113_0004662_1212_2267 351
688 3300048918 Ga0496115_0057219 Ga0496115_0057219_1995_3050 351
689 3300048918 Ga0496115_0100932 Ga0496115_0100932_684_1775 351
690 3300050512 nmdc:mga0n895_20822_c1 nmdc:mga0n895_20822_c1_4894_5988 351
691 3300050513 nmdc:mga0rr50_46417_c1 nmdc:mga0rr50_46417_c1_1239_2333 351
692 3300050513 nmdc:mga0rr50_4659_c1 nmdc:mga0rr50_4659_c1_6950_8038 351
693 3300050514 nmdc:mga08x19_8404_c1 nmdc:mga08x19_8404_c1_4862_5950 351

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01594

AI-2E_transport

AI-2E family transporter

11

345

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nb6-assembly1.cif.gz_A structure of the autoinducer-2 exporter tqsa from e. coli 0.6647 3 322
7nb6-assembly1.cif.gz_A structure of the autoinducer-2 exporter tqsa from e. coli 0.6163 3 322
7ot9-assembly1.cif.gz_A structure of the ai-2 exporter family protein ydik from e. coli 0.5054 3 350
7ot9-assembly1.cif.gz_A structure of the ai-2 exporter family protein ydik from e. coli 0.4864 3 350
7sq7-assembly1.cif.gz_A cryo-em structure of mouse pi(3,5)p2-bound trpml1 channel at 2.41 angstrom resolution 0.28 48 282
ID Description Score Start End Superfamily
af_K7MU65_40_256_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.3063 18 243 1.20.1260.10
af_K7MU65_40_256_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.3034 18 243 1.20.1260.10
af_O60635_1_114_1.20.5.780 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Single helix bin 0.2507 176 280 1.20.5.780
af_Q9VXV4_145_431_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.2477 14 257 1.20.1530.20
af_O60635_1_114_1.20.5.780 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Single helix bin 0.247 176 280 1.20.5.780
ID Description Score Start End GO Terms
AF-A0A2V9WA03-F1-model_v4 AI-2E family transporter 0.9479 2 259 GO:0016020
GO:0055085
AF-A0A2V9SAT9-F1-model_v4 AI-2E family transporter 0.9141 2 326 GO:0005886
GO:0055085
AF-A0A2V9TNG1-F1-model_v4 AI-2E family transporter 0.9058 2 351 GO:0016020
GO:0055085
AF-A0A2V9DNH4-F1-model_v4 AI-2E family transporter 0.9042 2 331 GO:0005886
GO:0055085
AF-A0A2V9TNG1-F1-model_v4 AI-2E family transporter 0.9009 2 351 GO:0016020
GO:0055085

Feature Viewer

pLDDT pTM Quality
66.73 0.59 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map