F475633
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 693 | 243 | 693 | 353 |
Family's Representative Sequence
| Representative Sequence | 3300005467|Ga0070706_100165697|Ga0070706_1001656971 |
| Length | 370 |
| Sequence | LTILDSRTSRVLFTALLFAVGLGFLYAARRTLILFLFAIFFAYLINPAVARLEKLVRSRVWAITIIYLLLLVGLGLFGFLVGPRIARQSARLGASLPELMDKASTGQLSGQITQLTARIGSQHGWSAPTQERIKGFLMSRRGDLSHLAERIGFRAAEAAQQVWLLFLVPILAIFFLRDGGSFHEVLLALVQSRTQREFLQDVFQDLNQMLAQFIRAQLTLAALSLVAYTAFLGAMRVPYALMLGTAGGALEFIPLVGPLLAGAAMMIVAVLAGYQHWPFLLLFLLVWRMVQDYVISPRIMGVSVELHPLAALFGILAGGEIAGVLGVYLSIPVMASLRIVWRRWRIYAEKRKFGPLNEYSFPQELERGRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 90 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 116 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 120 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 121 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 122 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 123 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 186 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 187 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 188 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 189 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 190 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 191 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 192 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 193 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 194 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 196 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 197 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 198 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 199 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 200 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 201 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 202 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 205 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 206 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 207 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 210 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 211 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 212 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 213 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 214 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 230 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 231 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 232 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 233 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 236 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 237 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 238 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 239 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 240 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.85 |
| Metatranscriptomes | 1.15 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.33 |
| Rhizosphere | 95.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_7742423 | 2162886012 | Bacteria | 2456 |
| 2 | LJNas_1002028 | 3300000546 | Bacteria | 2587 |
| 3 | JGI24752J21851_1000806 | 3300001976 | Unclassified | 4225 |
| 4 | JGI24747J21853_1000176 | 3300001978 | Bacteria | 3269 |
| 5 | JGI24737J22298_10026519 | 3300001990 | Bacteria | 1829 |
| 6 | JGI24743J22301_10007840 | 3300001991 | Bacteria | 1861 |
| 7 | JGI24751J29686_10000991 | 3300002459 | Bacteria | 6239 |
| 8 | Ga0065712_10028940 | 3300005290 | Bacteria | 1505 |
| 9 | Ga0065715_10004417 | 3300005293 | Bacteria | 6690 |
| 10 | Ga0070676_10015163 | 3300005328 | Bacteria | 4249 |
| 11 | Ga0070683_100001564 | 3300005329 | Bacteria | 17682 |
| 12 | Ga0070683_100030114 | 3300005329 | Unclassified | 4922 |
| 13 | Ga0070683_100059326 | 3300005329 | Unclassified | 3555 |
| 14 | Ga0070683_100460306 | 3300005329 | Bacteria | 1214 |
| 15 | Ga0070690_100014844 | 3300005330 | Unclassified | 4631 |
| 16 | Ga0070670_100030748 | 3300005331 | Unclassified | 4624 |
| 17 | Ga0070670_100208869 | 3300005331 | Bacteria | 1697 |
| 18 | Ga0070670_100229248 | 3300005331 | Bacteria | 1616 |
| 19 | Ga0070677_10042392 | 3300005333 | Bacteria | 1802 |
| 20 | Ga0068869_100005664 | 3300005334 | Bacteria | 7874 |
| 21 | Ga0068869_100006028 | 3300005334 | Bacteria | 7667 |
| 22 | Ga0068869_100052771 | 3300005334 | Bacteria | 2953 |
| 23 | Ga0070666_10046129 | 3300005335 | Bacteria | 2922 |
| 24 | Ga0070666_10057046 | 3300005335 | Bacteria | 2638 |
| 25 | Ga0070680_100051175 | 3300005336 | Unclassified | 3370 |
| 26 | Ga0070682_100015308 | 3300005337 | Unclassified | 4442 |
| 27 | Ga0070682_100019066 | 3300005337 | Unclassified | 4019 |
| 28 | Ga0070682_100304707 | 3300005337 | Unclassified | 1170 |
| 29 | Ga0068868_100006287 | 3300005338 | Bacteria | 8395 |
| 30 | Ga0068868_100008758 | 3300005338 | Bacteria | 7247 |
| 31 | Ga0068868_100011959 | 3300005338 | Bacteria | 6333 |
| 32 | Ga0068868_100012075 | 3300005338 | Bacteria | 6307 |
| 33 | Ga0068868_100049467 | 3300005338 | Bacteria | 3299 |
| 34 | Ga0070660_100064849 | 3300005339 | Bacteria | 2842 |
| 35 | Ga0070660_100089814 | 3300005339 | Bacteria | 2421 |
| 36 | Ga0070689_100004902 | 3300005340 | Bacteria | 9078 |
| 37 | Ga0070661_100000794 | 3300005344 | Bacteria | 22679 |
| 38 | Ga0070661_100019296 | 3300005344 | Unclassified | 4860 |
| 39 | Ga0070661_100049237 | 3300005344 | Bacteria | 3084 |
| 40 | Ga0070692_10038522 | 3300005345 | Bacteria | 2437 |
| 41 | Ga0070668_100005232 | 3300005347 | Bacteria | 9626 |
| 42 | Ga0070668_100037218 | 3300005347 | Unclassified | 3715 |
| 43 | Ga0070669_100008095 | 3300005353 | Bacteria | 7513 |
| 44 | Ga0070675_100004164 | 3300005354 | Bacteria | 10982 |
| 45 | Ga0070671_100085747 | 3300005355 | Bacteria | 2635 |
| 46 | Ga0070671_100102360 | 3300005355 | Bacteria | 2403 |
| 47 | Ga0070671_100259487 | 3300005355 | Bacteria | 1477 |
| 48 | Ga0070674_100026924 | 3300005356 | Bacteria | 3762 |
| 49 | Ga0070673_100015803 | 3300005364 | Bacteria | 5316 |
| 50 | Ga0070688_100000826 | 3300005365 | Bacteria | 15332 |
| 51 | Ga0070659_100007081 | 3300005366 | Bacteria | 8130 |
| 52 | Ga0070659_100271012 | 3300005366 | Unclassified | 1410 |
| 53 | Ga0070667_100075732 | 3300005367 | Bacteria | 2873 |
| 54 | Ga0070709_10000586 | 3300005434 | Bacteria | 21315 |
| 55 | Ga0070709_10011222 | 3300005434 | Bacteria | 4984 |
| 56 | Ga0070709_10014481 | 3300005434 | Bacteria | 4462 |
| 57 | Ga0070709_10022862 | 3300005434 | Bacteria | 3664 |
| 58 | Ga0070709_10022924 | 3300005434 | Unclassified | 3659 |
| 59 | Ga0070709_10100539 | 3300005434 | Bacteria | 1926 |
| 60 | Ga0070709_10189669 | 3300005434 | Unclassified | 1449 |
| 61 | Ga0070709_10262048 | 3300005434 | Unclassified | 1249 |
| 62 | Ga0070714_100001396 | 3300005435 | Bacteria | 17508 |
| 63 | Ga0070714_100004544 | 3300005435 | Bacteria | 10458 |
| 64 | Ga0070714_100046920 | 3300005435 | Unclassified | 3667 |
| 65 | Ga0070714_100108677 | 3300005435 | Unclassified | 2452 |
| 66 | Ga0070714_100329993 | 3300005435 | Bacteria | 1428 |
| 67 | Ga0070713_100000352 | 3300005436 | Bacteria | 29758 |
| 68 | Ga0070713_100000531 | 3300005436 | Bacteria | 24184 |
| 69 | Ga0070713_100002892 | 3300005436 | Bacteria | 11231 |
| 70 | Ga0070713_100007494 | 3300005436 | Bacteria | 7664 |
| 71 | Ga0070713_100028366 | 3300005436 | Bacteria | 4420 |
| 72 | Ga0070713_100035251 | 3300005436 | Unclassified | 4027 |
| 73 | Ga0070713_100069617 | 3300005436 | Bacteria | 2967 |
| 74 | Ga0070713_100181808 | 3300005436 | Bacteria | 1890 |
| 75 | Ga0070710_10000959 | 3300005437 | Bacteria | 13672 |
| 76 | Ga0070710_10008425 | 3300005437 | Bacteria | 5019 |
| 77 | Ga0070710_10031128 | 3300005437 | Bacteria | 2877 |
| 78 | Ga0070710_10084190 | 3300005437 | Bacteria | 1863 |
| 79 | Ga0070710_10089487 | 3300005437 | Bacteria | 1813 |
| 80 | Ga0070701_10032127 | 3300005438 | Bacteria | 2611 |
| 81 | Ga0070711_100001578 | 3300005439 | Bacteria | 12540 |
| 82 | Ga0070711_100003134 | 3300005439 | Bacteria | 9586 |
| 83 | Ga0070711_100020066 | 3300005439 | Unclassified | 4300 |
| 84 | Ga0070711_100216215 | 3300005439 | Bacteria | 1487 |
| 85 | Ga0070711_100239112 | 3300005439 | Unclassified | 1419 |
| 86 | Ga0070705_100211739 | 3300005440 | Bacteria | 1336 |
| 87 | Ga0070708_100000729 | 3300005445 | Bacteria | 24960 |
| 88 | Ga0070708_100008418 | 3300005445 | Bacteria | 8279 |
| 89 | Ga0070708_100011801 | 3300005445 | Bacteria | 7109 |
| 90 | Ga0070708_100016177 | 3300005445 | Bacteria | 6183 |
| 91 | Ga0070708_100017546 | 3300005445 | Bacteria | 5976 |
| 92 | Ga0070708_100026175 | 3300005445 | Bacteria | 4991 |
| 93 | Ga0070708_100053262 | 3300005445 | Bacteria | 3590 |
| 94 | Ga0070708_100086097 | 3300005445 | Unclassified | 2853 |
| 95 | Ga0070708_100089236 | 3300005445 | Bacteria | 2805 |
| 96 | Ga0070708_100097238 | 3300005445 | Unclassified | 2691 |
| 97 | Ga0070708_100193558 | 3300005445 | Bacteria | 1902 |
| 98 | Ga0070663_100019711 | 3300005455 | Bacteria | 4453 |
| 99 | Ga0070663_100065023 | 3300005455 | Unclassified | 2638 |
| 100 | Ga0070663_100100666 | 3300005455 | Bacteria | 2156 |
| 101 | Ga0070678_100037932 | 3300005456 | Bacteria | 3388 |
| 102 | Ga0070662_100009829 | 3300005457 | Bacteria | 6268 |
| 103 | Ga0070662_100029331 | 3300005457 | Bacteria | 3839 |
| 104 | Ga0070662_100112456 | 3300005457 | Bacteria | 2076 |
| 105 | Ga0070662_100141573 | 3300005457 | Bacteria | 1864 |
| 106 | Ga0070681_10000195 | 3300005458 | Bacteria | 47245 |
| 107 | Ga0070681_10044424 | 3300005458 | Bacteria | 4448 |
| 108 | Ga0068867_100007106 | 3300005459 | Bacteria | 7912 |
| 109 | Ga0068867_100076307 | 3300005459 | Bacteria | 2516 |
| 110 | Ga0070685_10001068 | 3300005466 | Bacteria | 14697 |
| 111 | Ga0070706_100000499 | 3300005467 | Bacteria | 45986 |
| 112 | Ga0070706_100096200 | 3300005467 | Unclassified | 2749 |
| 113 | Ga0070706_100129708 | 3300005467 | Unclassified | 2352 |
| 114 | Ga0070706_100161115 | 3300005467 | Bacteria | 2095 |
| 115 | Ga0070706_100165697 | 3300005467 | Bacteria | 2064 |
| 116 | Ga0070706_100207265 | 3300005467 | Unclassified | 1830 |
| 117 | Ga0070707_100002005 | 3300005468 | Bacteria | 19504 |
| 118 | Ga0070707_100005851 | 3300005468 | Bacteria | 11464 |
| 119 | Ga0070707_100023721 | 3300005468 | Bacteria | 5803 |
| 120 | Ga0070707_100040755 | 3300005468 | Unclassified | 4443 |
| 121 | Ga0070707_100082477 | 3300005468 | Bacteria | 3105 |
| 122 | Ga0070707_100087248 | 3300005468 | Bacteria | 3018 |
| 123 | Ga0070707_100106843 | 3300005468 | Unclassified | 2714 |
| 124 | Ga0070707_100470646 | 3300005468 | Unclassified | 1218 |
| 125 | Ga0070698_100000795 | 3300005471 | Bacteria | 34332 |
| 126 | Ga0070698_100001258 | 3300005471 | Bacteria | 28295 |
| 127 | Ga0070699_100000621 | 3300005518 | Bacteria | 33511 |
| 128 | Ga0070699_100001944 | 3300005518 | Bacteria | 18671 |
| 129 | Ga0070699_100027994 | 3300005518 | Bacteria | 4860 |
| 130 | Ga0070699_100039804 | 3300005518 | Bacteria | 4070 |
| 131 | Ga0070699_100090972 | 3300005518 | Bacteria | 2668 |
| 132 | Ga0070679_100006160 | 3300005530 | Bacteria | 11162 |
| 133 | Ga0070679_100073747 | 3300005530 | Bacteria | 3404 |
| 134 | Ga0070679_100181924 | 3300005530 | Bacteria | 2074 |
| 135 | Ga0070684_100000661 | 3300005535 | Bacteria | 23781 |
| 136 | Ga0070684_100009183 | 3300005535 | Bacteria | 7777 |
| 137 | Ga0070684_100060589 | 3300005535 | Unclassified | 3311 |
| 138 | Ga0070684_100084970 | 3300005535 | Bacteria | 2806 |
| 139 | Ga0070684_100120526 | 3300005535 | Unclassified | 2360 |
| 140 | Ga0070697_100000258 | 3300005536 | Bacteria | 42993 |
| 141 | Ga0070697_100000397 | 3300005536 | Bacteria | 33764 |
| 142 | Ga0070697_100015413 | 3300005536 | Bacteria | 6001 |
| 143 | Ga0070697_100027550 | 3300005536 | Bacteria | 4547 |
| 144 | Ga0070697_100074258 | 3300005536 | Unclassified | 2793 |
| 145 | Ga0070697_100350441 | 3300005536 | Bacteria | 1275 |
| 146 | Ga0068853_100002656 | 3300005539 | Bacteria | 13478 |
| 147 | Ga0068853_100178841 | 3300005539 | Bacteria | 1923 |
| 148 | Ga0068853_100407017 | 3300005539 | Unclassified | 1274 |
| 149 | Ga0070672_100006357 | 3300005543 | Bacteria | 7934 |
| 150 | Ga0070686_100006812 | 3300005544 | Bacteria | 6362 |
| 151 | Ga0070695_100014489 | 3300005545 | Bacteria | 4752 |
| 152 | Ga0070693_100050882 | 3300005547 | Unclassified | 2370 |
| 153 | Ga0070665_100014107 | 3300005548 | Bacteria | 8032 |
| 154 | Ga0068855_100000978 | 3300005563 | Bacteria | 35574 |
| 155 | Ga0068855_100005912 | 3300005563 | Bacteria | 14919 |
| 156 | Ga0068855_100063262 | 3300005563 | Unclassified | 4318 |
| 157 | Ga0068855_100080883 | 3300005563 | Unclassified | 3767 |
| 158 | Ga0068855_100292483 | 3300005563 | Bacteria | 1805 |
| 159 | Ga0070664_100001252 | 3300005564 | Bacteria | 20328 |
| 160 | Ga0070664_100055990 | 3300005564 | Bacteria | 3350 |
| 161 | Ga0070664_100174052 | 3300005564 | Unclassified | 1910 |
| 162 | Ga0068857_100002090 | 3300005577 | Bacteria | 16230 |
| 163 | Ga0068857_100007487 | 3300005577 | Bacteria | 9399 |
| 164 | Ga0068854_100034529 | 3300005578 | Unclassified | 3534 |
| 165 | Ga0068854_100039175 | 3300005578 | Unclassified | 3337 |
| 166 | Ga0068854_100073447 | 3300005578 | Bacteria | 2507 |
| 167 | Ga0068856_100000107 | 3300005614 | Bacteria | 81707 |
| 168 | Ga0068856_100000483 | 3300005614 | Bacteria | 44122 |
| 169 | Ga0068856_100002086 | 3300005614 | Bacteria | 20738 |
| 170 | Ga0068856_100009826 | 3300005614 | Bacteria | 9292 |
| 171 | Ga0068856_100028664 | 3300005614 | Bacteria | 5439 |
| 172 | Ga0068856_100038299 | 3300005614 | Unclassified | 4706 |
| 173 | Ga0068856_100047585 | 3300005614 | Bacteria | 4225 |
| 174 | Ga0068856_100171050 | 3300005614 | Unclassified | 2185 |
| 175 | Ga0068856_100172329 | 3300005614 | Bacteria | 2176 |
| 176 | Ga0070702_100002782 | 3300005615 | Bacteria | 7670 |
| 177 | Ga0068852_100003925 | 3300005616 | Bacteria | 10448 |
| 178 | Ga0068852_100078917 | 3300005616 | Unclassified | 2914 |
| 179 | Ga0068859_100000951 | 3300005617 | Bacteria | 29624 |
| 180 | Ga0068859_100009582 | 3300005617 | Bacteria | 9780 |
| 181 | Ga0068859_100066899 | 3300005617 | Bacteria | 3628 |
| 182 | Ga0068864_100007554 | 3300005618 | Bacteria | 8957 |
| 183 | Ga0068864_100011018 | 3300005618 | Bacteria | 7474 |
| 184 | Ga0068864_100027359 | 3300005618 | Unclassified | 4816 |
| 185 | Ga0068864_100121664 | 3300005618 | Bacteria | 2334 |
| 186 | Ga0068866_10001489 | 3300005718 | Bacteria | 9977 |
| 187 | Ga0068866_10005505 | 3300005718 | Bacteria | 5230 |
| 188 | Ga0068861_100080384 | 3300005719 | Bacteria | 2550 |
| 189 | Ga0068851_10022211 | 3300005834 | Unclassified | 3087 |
| 190 | Ga0068851_10048345 | 3300005834 | Bacteria | 2156 |
| 191 | Ga0068870_10000594 | 3300005840 | Bacteria | 13777 |
| 192 | Ga0068863_100008718 | 3300005841 | Bacteria | 9909 |
| 193 | Ga0068863_100012494 | 3300005841 | Bacteria | 8196 |
| 194 | Ga0068863_100032516 | 3300005841 | Bacteria | 4973 |
| 195 | Ga0068863_100036172 | 3300005841 | Bacteria | 4703 |
| 196 | Ga0068863_100074999 | 3300005841 | Unclassified | 3200 |
| 197 | Ga0068863_100075760 | 3300005841 | Bacteria | 3183 |
| 198 | Ga0068863_100112107 | 3300005841 | Unclassified | 2598 |
| 199 | Ga0068863_100119952 | 3300005841 | Bacteria | 2507 |
| 200 | Ga0068858_100002793 | 3300005842 | Bacteria | 17549 |
| 201 | Ga0068858_100004335 | 3300005842 | Bacteria | 13924 |
| 202 | Ga0068860_100004530 | 3300005843 | Bacteria | 14182 |
| 203 | Ga0068860_100021853 | 3300005843 | Bacteria | 6190 |
| 204 | Ga0068860_100078870 | 3300005843 | Bacteria | 3131 |
| 205 | Ga0068860_100182026 | 3300005843 | Bacteria | 2031 |
| 206 | Ga0068860_100347819 | 3300005843 | Bacteria | 1458 |
| 207 | Ga0068862_100010269 | 3300005844 | Bacteria | 7725 |
| 208 | Ga0068862_100123345 | 3300005844 | Bacteria | 2285 |
| 209 | Ga0070717_10000383 | 3300006028 | Bacteria | 28372 |
| 210 | Ga0070717_10002932 | 3300006028 | Bacteria | 12112 |
| 211 | Ga0070717_10012853 | 3300006028 | Bacteria | 6393 |
| 212 | Ga0070717_10013844 | 3300006028 | Bacteria | 6194 |
| 213 | Ga0070717_10029577 | 3300006028 | Unclassified | 4395 |
| 214 | Ga0070717_10042437 | 3300006028 | Unclassified | 3710 |
| 215 | Ga0070717_10060214 | 3300006028 | Bacteria | 3144 |
| 216 | Ga0070717_10151883 | 3300006028 | Bacteria | 2004 |
| 217 | Ga0070717_10180131 | 3300006028 | Unclassified | 1841 |
| 218 | Ga0070717_10252387 | 3300006028 | Unclassified | 1559 |
| 219 | Ga0070715_10010820 | 3300006163 | Bacteria | 3263 |
| 220 | Ga0070715_10043444 | 3300006163 | Bacteria | 1895 |
| 221 | Ga0070716_100000278 | 3300006173 | Bacteria | 20754 |
| 222 | Ga0070716_100003557 | 3300006173 | Bacteria | 7353 |
| 223 | Ga0070716_100003816 | 3300006173 | Bacteria | 7150 |
| 224 | Ga0070716_100010295 | 3300006173 | Unclassified | 4684 |
| 225 | Ga0070716_100017624 | 3300006173 | Bacteria | 3706 |
| 226 | Ga0070716_100053474 | 3300006173 | Bacteria | 2303 |
| 227 | Ga0070716_100124327 | 3300006173 | Unclassified | 1620 |
| 228 | Ga0070712_100000193 | 3300006175 | Bacteria | 33852 |
| 229 | Ga0070712_100000658 | 3300006175 | Bacteria | 20372 |
| 230 | Ga0070712_100001245 | 3300006175 | Bacteria | 15390 |
| 231 | Ga0070712_100001997 | 3300006175 | Bacteria | 12488 |
| 232 | Ga0070712_100002784 | 3300006175 | Bacteria | 10800 |
| 233 | Ga0070712_100047276 | 3300006175 | Unclassified | 2978 |
| 234 | Ga0070712_100073329 | 3300006175 | Unclassified | 2455 |
| 235 | Ga0070712_100109397 | 3300006175 | Bacteria | 2060 |
| 236 | Ga0070712_100136165 | 3300006175 | Unclassified | 1868 |
| 237 | Ga0097621_100000223 | 3300006237 | Bacteria | 37820 |
| 238 | Ga0097621_100002728 | 3300006237 | Bacteria | 12086 |
| 239 | Ga0097621_100003550 | 3300006237 | Bacteria | 10770 |
| 240 | Ga0097621_100003554 | 3300006237 | Bacteria | 10768 |
| 241 | Ga0097621_100006566 | 3300006237 | Bacteria | 8261 |
| 242 | Ga0097621_100023835 | 3300006237 | Unclassified | 4770 |
| 243 | Ga0068871_100000410 | 3300006358 | Bacteria | 29656 |
| 244 | Ga0068871_100004799 | 3300006358 | Bacteria | 9452 |
| 245 | Ga0068871_100013866 | 3300006358 | Bacteria | 5993 |
| 246 | Ga0068871_100024200 | 3300006358 | Unclassified | 4706 |
| 247 | Ga0068871_100029703 | 3300006358 | Unclassified | 4296 |
| 248 | Ga0068871_100034934 | 3300006358 | Unclassified | 3992 |
| 249 | Ga0068871_100098226 | 3300006358 | Bacteria | 2449 |
| 250 | Ga0068871_100152279 | 3300006358 | Bacteria | 1973 |
| 251 | Ga0075433_10000971 | 3300006852 | Bacteria | 20352 |
| 252 | Ga0075434_100009879 | 3300006871 | Bacteria | 8926 |
| 253 | Ga0075434_100163176 | 3300006871 | Bacteria | 2248 |
| 254 | Ga0068865_100005068 | 3300006881 | Bacteria | 7972 |
| 255 | Ga0068865_100019589 | 3300006881 | Unclassified | 4380 |
| 256 | Ga0068865_100036197 | 3300006881 | Bacteria | 3326 |
| 257 | Ga0075436_100000709 | 3300006914 | Bacteria | 22091 |
| 258 | Ga0097620_100000951 | 3300006931 | Bacteria | 29624 |
| 259 | Ga0097620_100009582 | 3300006931 | Bacteria | 9780 |
| 260 | Ga0097620_100066896 | 3300006931 | Bacteria | 3628 |
| 261 | Ga0075435_100000841 | 3300007076 | Bacteria | 19159 |
| 262 | Ga0075435_100016153 | 3300007076 | Bacteria | 5624 |
| 263 | Ga0075435_100092912 | 3300007076 | Unclassified | 2492 |
| 264 | Ga0099795_10031611 | 3300007788 | Bacteria | 1824 |
| 265 | Ga0105251_10110807 | 3300009011 | Bacteria | 1250 |
| 266 | Ga0105240_10002618 | 3300009093 | Bacteria | 28698 |
| 267 | Ga0105240_10008167 | 3300009093 | Bacteria | 15008 |
| 268 | Ga0105240_10018860 | 3300009093 | Bacteria | 9237 |
| 269 | Ga0105240_10044008 | 3300009093 | Bacteria | 5676 |
| 270 | Ga0105240_10153216 | 3300009093 | Unclassified | 2744 |
| 271 | Ga0105240_10154251 | 3300009093 | Unclassified | 2733 |
| 272 | Ga0105240_10159996 | 3300009093 | Bacteria | 2676 |
| 273 | Ga0105240_10205581 | 3300009093 | Bacteria | 2305 |
| 274 | Ga0105245_10002658 | 3300009098 | Bacteria | 16090 |
| 275 | Ga0105245_10004111 | 3300009098 | Bacteria | 12920 |
| 276 | Ga0105245_10078506 | 3300009098 | Unclassified | 3012 |
| 277 | Ga0105245_10096856 | 3300009098 | Unclassified | 2723 |
| 278 | Ga0105247_10017515 | 3300009101 | Unclassified | 4297 |
| 279 | Ga0105247_10020936 | 3300009101 | Unclassified | 3935 |
| 280 | Ga0105247_10057598 | 3300009101 | Bacteria | 2403 |
| 281 | Ga0105243_10055743 | 3300009148 | Unclassified | 3141 |
| 282 | Ga0105241_10001486 | 3300009174 | Bacteria | 17962 |
| 283 | Ga0105241_10003005 | 3300009174 | Bacteria | 12604 |
| 284 | Ga0105241_10021699 | 3300009174 | Unclassified | 4750 |
| 285 | Ga0105241_10055135 | 3300009174 | Unclassified | 3045 |
| 286 | Ga0105242_10006300 | 3300009176 | Bacteria | 9141 |
| 287 | Ga0105242_10025528 | 3300009176 | Unclassified | 4677 |
| 288 | Ga0105242_10191638 | 3300009176 | Unclassified | 1810 |
| 289 | Ga0105248_10003183 | 3300009177 | Bacteria | 18192 |
| 290 | Ga0105248_10016820 | 3300009177 | Bacteria | 8050 |
| 291 | Ga0105248_10034297 | 3300009177 | Bacteria | 5673 |
| 292 | Ga0105248_10054223 | 3300009177 | Unclassified | 4496 |
| 293 | Ga0105248_10107376 | 3300009177 | Bacteria | 3148 |
| 294 | Ga0105248_10238249 | 3300009177 | Unclassified | 2048 |
| 295 | Ga0105237_10019545 | 3300009545 | Bacteria | 6997 |
| 296 | Ga0105237_10021096 | 3300009545 | Bacteria | 6701 |
| 297 | Ga0105237_10029870 | 3300009545 | Bacteria | 5536 |
| 298 | Ga0105237_10050389 | 3300009545 | Unclassified | 4183 |
| 299 | Ga0105237_10232874 | 3300009545 | Bacteria | 1843 |
| 300 | Ga0105238_10000090 | 3300009551 | Bacteria | 102374 |
| 301 | Ga0105238_10017430 | 3300009551 | Bacteria | 7299 |
| 302 | Ga0105238_10103373 | 3300009551 | Bacteria | 2830 |
| 303 | Ga0105249_10015904 | 3300009553 | Bacteria | 6668 |
| 304 | Ga0105249_10376572 | 3300009553 | Unclassified | 1444 |
| 305 | Ga0099796_10024290 | 3300010159 | Unclassified | 1902 |
| 306 | Ga0105239_10015829 | 3300010375 | Bacteria | 8347 |
| 307 | Ga0105239_10025239 | 3300010375 | Bacteria | 6545 |
| 308 | Ga0105239_10069680 | 3300010375 | Bacteria | 3863 |
| 309 | Ga0105239_10094539 | 3300010375 | Unclassified | 3301 |
| 310 | Ga0105239_10137393 | 3300010375 | Bacteria | 2721 |
| 311 | Ga0105246_10000592 | 3300011119 | Bacteria | 20112 |
| 312 | Ga0105246_10094579 | 3300011119 | Unclassified | 2162 |
| 313 | Ga0105246_10174545 | 3300011119 | Bacteria | 1649 |
| 314 | Ga0157373_10005921 | 3300013100 | Bacteria | 9148 |
| 315 | Ga0157373_10006042 | 3300013100 | Bacteria | 9051 |
| 316 | Ga0157373_10079568 | 3300013100 | Archaea | 2312 |
| 317 | Ga0157373_10123591 | 3300013100 | Bacteria | 1820 |
| 318 | Ga0157371_10017563 | 3300013102 | Bacteria | 5312 |
| 319 | Ga0157371_10053241 | 3300013102 | Bacteria | 2874 |
| 320 | Ga0157371_10070345 | 3300013102 | Bacteria | 2477 |
| 321 | Ga0157371_10110626 | 3300013102 | Unclassified | 1950 |
| 322 | Ga0157370_10053518 | 3300013104 | Bacteria | 3849 |
| 323 | Ga0157370_10062916 | 3300013104 | Unclassified | 3517 |
| 324 | Ga0157370_10196902 | 3300013104 | Bacteria | 1870 |
| 325 | Ga0157369_10005632 | 3300013105 | Bacteria | 14551 |
| 326 | Ga0157369_10013615 | 3300013105 | Bacteria | 9201 |
| 327 | Ga0157369_10015793 | 3300013105 | Bacteria | 8506 |
| 328 | Ga0157369_10025206 | 3300013105 | Bacteria | 6603 |
| 329 | Ga0157369_10027601 | 3300013105 | Bacteria | 6290 |
| 330 | Ga0157369_10046582 | 3300013105 | Bacteria | 4712 |
| 331 | Ga0157369_10060435 | 3300013105 | Unclassified | 4086 |
| 332 | Ga0157369_10108666 | 3300013105 | Bacteria | 2950 |
| 333 | Ga0157369_10113854 | 3300013105 | Bacteria | 2873 |
| 334 | Ga0157369_10138228 | 3300013105 | Unclassified | 2579 |
| 335 | Ga0157374_10000097 | 3300013296 | Bacteria | 81947 |
| 336 | Ga0157374_10000305 | 3300013296 | Bacteria | 45523 |
| 337 | Ga0157374_10000997 | 3300013296 | Bacteria | 24569 |
| 338 | Ga0157374_10014051 | 3300013296 | Bacteria | 7000 |
| 339 | Ga0157374_10021413 | 3300013296 | Bacteria | 5752 |
| 340 | Ga0157374_10022194 | 3300013296 | Bacteria | 5660 |
| 341 | Ga0157374_10068555 | 3300013296 | Bacteria | 3338 |
| 342 | Ga0157374_10186858 | 3300013296 | Bacteria | 2026 |
| 343 | Ga0157378_10000265 | 3300013297 | Bacteria | 50886 |
| 344 | Ga0157378_10001362 | 3300013297 | Bacteria | 21956 |
| 345 | Ga0157378_10008887 | 3300013297 | Bacteria | 8743 |
| 346 | Ga0157378_10010398 | 3300013297 | Bacteria | 8126 |
| 347 | Ga0157378_10045833 | 3300013297 | Bacteria | 3886 |
| 348 | Ga0157378_10066055 | 3300013297 | Bacteria | 3239 |
| 349 | Ga0163162_10006230 | 3300013306 | Bacteria | 11564 |
| 350 | Ga0163162_10017904 | 3300013306 | Bacteria | 6931 |
| 351 | Ga0163162_10020438 | 3300013306 | Bacteria | 6507 |
| 352 | Ga0163162_10078740 | 3300013306 | Unclassified | 3361 |
| 353 | Ga0163162_10091176 | 3300013306 | Bacteria | 3130 |
| 354 | Ga0163162_10091738 | 3300013306 | Unclassified | 3121 |
| 355 | Ga0157372_10000766 | 3300013307 | Bacteria | 34848 |
| 356 | Ga0157372_10001033 | 3300013307 | Bacteria | 30439 |
| 357 | Ga0157372_10001204 | 3300013307 | Bacteria | 27976 |
| 358 | Ga0157372_10007745 | 3300013307 | Bacteria | 11410 |
| 359 | Ga0157372_10007887 | 3300013307 | Bacteria | 11315 |
| 360 | Ga0157372_10008029 | 3300013307 | Bacteria | 11224 |
| 361 | Ga0157372_10008514 | 3300013307 | Bacteria | 10891 |
| 362 | Ga0157372_10010175 | 3300013307 | Bacteria | 9987 |
| 363 | Ga0157372_10011993 | 3300013307 | Bacteria | 9230 |
| 364 | Ga0157372_10070516 | 3300013307 | Bacteria | 3932 |
| 365 | Ga0157372_10335318 | 3300013307 | Unclassified | 1761 |
| 366 | Ga0157375_10027623 | 3300013308 | Bacteria | 5307 |
| 367 | Ga0157375_10076539 | 3300013308 | Bacteria | 3373 |
| 368 | Ga0157375_10135089 | 3300013308 | Bacteria | 2589 |
| 369 | Ga0157375_10231066 | 3300013308 | Bacteria | 2009 |
| 370 | Ga0163163_10001245 | 3300014325 | Bacteria | 21449 |
| 371 | Ga0163163_10104250 | 3300014325 | Bacteria | 2861 |
| 372 | Ga0163163_10152526 | 3300014325 | Bacteria | 2354 |
| 373 | Ga0157380_10133793 | 3300014326 | Bacteria | 2119 |
| 374 | Ga0182008_10001046 | 3300014497 | Bacteria | 19199 |
| 375 | Ga0182008_10029047 | 3300014497 | Bacteria | 2795 |
| 376 | Ga0157377_10000498 | 3300014745 | Bacteria | 16694 |
| 377 | Ga0157379_10005139 | 3300014968 | Bacteria | 11230 |
| 378 | Ga0157379_10011871 | 3300014968 | Bacteria | 7611 |
| 379 | Ga0157379_10039232 | 3300014968 | Unclassified | 4225 |
| 380 | Ga0157379_10055758 | 3300014968 | Bacteria | 3531 |
| 381 | Ga0157376_10025960 | 3300014969 | Bacteria | 4622 |
| 382 | Ga0157376_10050739 | 3300014969 | Bacteria | 3443 |
| 383 | Ga0157376_10087801 | 3300014969 | Bacteria | 2684 |
| 384 | Ga0157376_10099202 | 3300014969 | Bacteria | 2541 |
| 385 | Ga0157376_10119192 | 3300014969 | Bacteria | 2336 |
| 386 | Ga0182006_1010221 | 3300015261 | Bacteria | 4180 |
| 387 | Ga0182006_1016692 | 3300015261 | Bacteria | 3129 |
| 388 | Ga0224570_100347 | 3300022730 | Bacteria | 3585 |
| 389 | Ga0224569_100721 | 3300022732 | Unclassified | 2831 |
| 390 | Ga0228598_1000128 | 3300024227 | Bacteria | 12910 |
| 391 | Ga0228598_1005539 | 3300024227 | Unclassified | 2635 |
| 392 | Ga0207656_10005808 | 3300025321 | Unclassified | 4393 |
| 393 | Ga0207692_10004844 | 3300025898 | Archaea | 5356 |
| 394 | Ga0207692_10006406 | 3300025898 | Unclassified | 4771 |
| 395 | Ga0207692_10014652 | 3300025898 | Bacteria | 3430 |
| 396 | Ga0207692_10015012 | 3300025898 | Unclassified | 3398 |
| 397 | Ga0207692_10015804 | 3300025898 | Unclassified | 3329 |
| 398 | Ga0207642_10004132 | 3300025899 | Bacteria | 4657 |
| 399 | Ga0207642_10016373 | 3300025899 | Bacteria | 2791 |
| 400 | Ga0207710_10015754 | 3300025900 | Bacteria | 3196 |
| 401 | Ga0207710_10016177 | 3300025900 | Bacteria | 3155 |
| 402 | Ga0207688_10006592 | 3300025901 | Bacteria | 6316 |
| 403 | Ga0207680_10006132 | 3300025903 | Bacteria | 5796 |
| 404 | Ga0207680_10139441 | 3300025903 | Bacteria | 1606 |
| 405 | Ga0207647_10000432 | 3300025904 | Bacteria | 34328 |
| 406 | Ga0207647_10025669 | 3300025904 | Unclassified | 3867 |
| 407 | Ga0207647_10117169 | 3300025904 | Unclassified | 1572 |
| 408 | Ga0207685_10019631 | 3300025905 | Bacteria | 2231 |
| 409 | Ga0207685_10038700 | 3300025905 | Bacteria | 1765 |
| 410 | Ga0207699_10001214 | 3300025906 | Bacteria | 12229 |
| 411 | Ga0207699_10035512 | 3300025906 | Bacteria | 2837 |
| 412 | Ga0207699_10035935 | 3300025906 | Bacteria | 2822 |
| 413 | Ga0207699_10070157 | 3300025906 | Bacteria | 2139 |
| 414 | Ga0207699_10145188 | 3300025906 | Bacteria | 1563 |
| 415 | Ga0207699_10183293 | 3300025906 | Unclassified | 1409 |
| 416 | Ga0207645_10001148 | 3300025907 | Bacteria | 21863 |
| 417 | Ga0207643_10000501 | 3300025908 | Bacteria | 25007 |
| 418 | Ga0207684_10000132 | 3300025910 | Bacteria | 134931 |
| 419 | Ga0207684_10001821 | 3300025910 | Bacteria | 22266 |
| 420 | Ga0207684_10004860 | 3300025910 | Bacteria | 12570 |
| 421 | Ga0207684_10069000 | 3300025910 | Unclassified | 3005 |
| 422 | Ga0207684_10303297 | 3300025910 | Unclassified | 1377 |
| 423 | Ga0207654_10001671 | 3300025911 | Bacteria | 11597 |
| 424 | Ga0207654_10004523 | 3300025911 | Bacteria | 7024 |
| 425 | Ga0207654_10026179 | 3300025911 | Unclassified | 3156 |
| 426 | Ga0207707_10001239 | 3300025912 | Bacteria | 23957 |
| 427 | Ga0207707_10004957 | 3300025912 | Bacteria | 11702 |
| 428 | Ga0207695_10013360 | 3300025913 | Bacteria | 9798 |
| 429 | Ga0207695_10021666 | 3300025913 | Bacteria | 7326 |
| 430 | Ga0207695_10028837 | 3300025913 | Bacteria | 6144 |
| 431 | Ga0207695_10035284 | 3300025913 | Bacteria | 5427 |
| 432 | Ga0207695_10043703 | 3300025913 | Unclassified | 4774 |
| 433 | Ga0207695_10255534 | 3300025913 | Bacteria | 1651 |
| 434 | Ga0207695_10321256 | 3300025913 | Bacteria | 1437 |
| 435 | Ga0207695_10357000 | 3300025913 | Bacteria | 1348 |
| 436 | Ga0207671_10020714 | 3300025914 | Bacteria | 5002 |
| 437 | Ga0207693_10000140 | 3300025915 | Bacteria | 65993 |
| 438 | Ga0207693_10000350 | 3300025915 | Bacteria | 42606 |
| 439 | Ga0207693_10000632 | 3300025915 | Bacteria | 31463 |
| 440 | Ga0207693_10002744 | 3300025915 | Bacteria | 15250 |
| 441 | Ga0207693_10003987 | 3300025915 | Bacteria | 12544 |
| 442 | Ga0207693_10021582 | 3300025915 | Bacteria | 5117 |
| 443 | Ga0207693_10129903 | 3300025915 | Unclassified | 1980 |
| 444 | Ga0207663_10000470 | 3300025916 | Bacteria | 17512 |
| 445 | Ga0207663_10005352 | 3300025916 | Bacteria | 6459 |
| 446 | Ga0207663_10006194 | 3300025916 | Bacteria | 6097 |
| 447 | Ga0207663_10138961 | 3300025916 | Bacteria | 1689 |
| 448 | Ga0207663_10273423 | 3300025916 | Unclassified | 1252 |
| 449 | Ga0207657_10001169 | 3300025919 | Bacteria | 27831 |
| 450 | Ga0207657_10001964 | 3300025919 | Bacteria | 22198 |
| 451 | Ga0207657_10002323 | 3300025919 | Bacteria | 20608 |
| 452 | Ga0207649_10000374 | 3300025920 | Bacteria | 33445 |
| 453 | Ga0207649_10012634 | 3300025920 | Unclassified | 4690 |
| 454 | Ga0207649_10035274 | 3300025920 | Unclassified | 3005 |
| 455 | Ga0207652_10006549 | 3300025921 | Bacteria | 9386 |
| 456 | Ga0207652_10104864 | 3300025921 | Bacteria | 2501 |
| 457 | Ga0207652_10295355 | 3300025921 | Unclassified | 1462 |
| 458 | Ga0207646_10000301 | 3300025922 | Bacteria | 67088 |
| 459 | Ga0207646_10001216 | 3300025922 | Bacteria | 32388 |
| 460 | Ga0207646_10221718 | 3300025922 | Bacteria | 1708 |
| 461 | Ga0207646_10326707 | 3300025922 | Bacteria | 1386 |
| 462 | Ga0207681_10080422 | 3300025923 | Bacteria | 2298 |
| 463 | Ga0207694_10035217 | 3300025924 | Unclassified | 3840 |
| 464 | Ga0207694_10057257 | 3300025924 | Unclassified | 3030 |
| 465 | Ga0207694_10109623 | 3300025924 | Bacteria | 2195 |
| 466 | Ga0207650_10000045 | 3300025925 | Bacteria | 181507 |
| 467 | Ga0207687_10005572 | 3300025927 | Bacteria | 8318 |
| 468 | Ga0207687_10005776 | 3300025927 | Bacteria | 8188 |
| 469 | Ga0207687_10032039 | 3300025927 | Bacteria | 3557 |
| 470 | Ga0207687_10146463 | 3300025927 | Unclassified | 1797 |
| 471 | Ga0207700_10000708 | 3300025928 | Bacteria | 19279 |
| 472 | Ga0207700_10004605 | 3300025928 | Bacteria | 8163 |
| 473 | Ga0207700_10015826 | 3300025928 | Unclassified | 4990 |
| 474 | Ga0207700_10046447 | 3300025928 | Bacteria | 3211 |
| 475 | Ga0207700_10076706 | 3300025928 | Bacteria | 2594 |
| 476 | Ga0207700_10125460 | 3300025928 | Unclassified | 2088 |
| 477 | Ga0207700_10135212 | 3300025928 | Bacteria | 2018 |
| 478 | Ga0207664_10000037 | 3300025929 | Bacteria | 171467 |
| 479 | Ga0207664_10180546 | 3300025929 | Bacteria | 1811 |
| 480 | Ga0207664_10344274 | 3300025929 | Unclassified | 1318 |
| 481 | Ga0207644_10011926 | 3300025931 | Bacteria | 5761 |
| 482 | Ga0207644_10258840 | 3300025931 | Bacteria | 1391 |
| 483 | Ga0207644_10261101 | 3300025931 | Bacteria | 1385 |
| 484 | Ga0207690_10059893 | 3300025932 | Bacteria | 2581 |
| 485 | Ga0207706_10000414 | 3300025933 | Bacteria | 45687 |
| 486 | Ga0207706_10000432 | 3300025933 | Bacteria | 44915 |
| 487 | Ga0207706_10014037 | 3300025933 | Bacteria | 7264 |
| 488 | Ga0207709_10009090 | 3300025935 | Bacteria | 5479 |
| 489 | Ga0207670_10002157 | 3300025936 | Bacteria | 10296 |
| 490 | Ga0207669_10019116 | 3300025937 | Bacteria | 3559 |
| 491 | Ga0207704_10006107 | 3300025938 | Bacteria | 5587 |
| 492 | Ga0207704_10027858 | 3300025938 | Unclassified | 3125 |
| 493 | Ga0207665_10000046 | 3300025939 | Bacteria | 78992 |
| 494 | Ga0207665_10002386 | 3300025939 | Bacteria | 12686 |
| 495 | Ga0207665_10003706 | 3300025939 | Bacteria | 10203 |
| 496 | Ga0207665_10013388 | 3300025939 | Bacteria | 5393 |
| 497 | Ga0207665_10022159 | 3300025939 | Unclassified | 4177 |
| 498 | Ga0207665_10022639 | 3300025939 | Bacteria | 4135 |
| 499 | Ga0207665_10136687 | 3300025939 | Unclassified | 1744 |
| 500 | Ga0207691_10000151 | 3300025940 | Bacteria | 64391 |
| 501 | Ga0207691_10126085 | 3300025940 | Bacteria | 2265 |
| 502 | Ga0207711_10013585 | 3300025941 | Bacteria | 6763 |
| 503 | Ga0207711_10125359 | 3300025941 | Unclassified | 2297 |
| 504 | Ga0207689_10000129 | 3300025942 | Bacteria | 63859 |
| 505 | Ga0207689_10001515 | 3300025942 | Bacteria | 22101 |
| 506 | Ga0207689_10011670 | 3300025942 | Bacteria | 7531 |
| 507 | Ga0207689_10097811 | 3300025942 | Bacteria | 2411 |
| 508 | Ga0207661_10000099 | 3300025944 | Bacteria | 54986 |
| 509 | Ga0207679_10000096 | 3300025945 | Bacteria | 76971 |
| 510 | Ga0207679_10030308 | 3300025945 | Bacteria | 3776 |
| 511 | Ga0207679_10195538 | 3300025945 | Unclassified | 1685 |
| 512 | Ga0207667_10001904 | 3300025949 | Bacteria | 26195 |
| 513 | Ga0207667_10007050 | 3300025949 | Bacteria | 13581 |
| 514 | Ga0207667_10008001 | 3300025949 | Bacteria | 12613 |
| 515 | Ga0207667_10064454 | 3300025949 | Bacteria | 3826 |
| 516 | Ga0207667_10152045 | 3300025949 | Bacteria | 2382 |
| 517 | Ga0207667_10162474 | 3300025949 | Unclassified | 2297 |
| 518 | Ga0207651_10022946 | 3300025960 | Bacteria | 3828 |
| 519 | Ga0207651_10265108 | 3300025960 | Bacteria | 1412 |
| 520 | Ga0207668_10057817 | 3300025972 | Bacteria | 2707 |
| 521 | Ga0207640_10025561 | 3300025981 | Bacteria | 3576 |
| 522 | Ga0207640_10049622 | 3300025981 | Bacteria | 2718 |
| 523 | Ga0207658_10009251 | 3300025986 | Bacteria | 6682 |
| 524 | Ga0207658_10087814 | 3300025986 | Bacteria | 2402 |
| 525 | Ga0207677_10007414 | 3300026023 | Bacteria | 6065 |
| 526 | Ga0207677_10007513 | 3300026023 | Bacteria | 6038 |
| 527 | Ga0207677_10008014 | 3300026023 | Bacteria | 5879 |
| 528 | Ga0207677_10034353 | 3300026023 | Bacteria | 3283 |
| 529 | Ga0207677_10060379 | 3300026023 | Bacteria | 2620 |
| 530 | Ga0207703_10004042 | 3300026035 | Bacteria | 12120 |
| 531 | Ga0207703_10011851 | 3300026035 | Bacteria | 6789 |
| 532 | Ga0207703_10033153 | 3300026035 | Unclassified | 4091 |
| 533 | Ga0207639_10046651 | 3300026041 | Bacteria | 3270 |
| 534 | Ga0207639_10216598 | 3300026041 | Unclassified | 1651 |
| 535 | Ga0207678_10000026 | 3300026067 | Bacteria | 116850 |
| 536 | Ga0207678_10000722 | 3300026067 | Bacteria | 30161 |
| 537 | Ga0207678_10104787 | 3300026067 | Bacteria | 2413 |
| 538 | Ga0207702_10000103 | 3300026078 | Bacteria | 99037 |
| 539 | Ga0207702_10000396 | 3300026078 | Bacteria | 49721 |
| 540 | Ga0207702_10006399 | 3300026078 | Bacteria | 10160 |
| 541 | Ga0207702_10037198 | 3300026078 | Bacteria | 4073 |
| 542 | Ga0207702_10043743 | 3300026078 | Bacteria | 3762 |
| 543 | Ga0207702_10059342 | 3300026078 | Bacteria | 3259 |
| 544 | Ga0207702_10132350 | 3300026078 | Unclassified | 2246 |
| 545 | Ga0207702_10226089 | 3300026078 | Unclassified | 1746 |
| 546 | Ga0207641_10000075 | 3300026088 | Bacteria | 145149 |
| 547 | Ga0207641_10011551 | 3300026088 | Bacteria | 7248 |
| 548 | Ga0207641_10031544 | 3300026088 | Unclassified | 4396 |
| 549 | Ga0207641_10034491 | 3300026088 | Bacteria | 4210 |
| 550 | Ga0207641_10062642 | 3300026088 | Bacteria | 3175 |
| 551 | Ga0207641_10109405 | 3300026088 | Bacteria | 2448 |
| 552 | Ga0207648_10002645 | 3300026089 | Bacteria | 19126 |
| 553 | Ga0207676_10000096 | 3300026095 | Bacteria | 80353 |
| 554 | Ga0207676_10001149 | 3300026095 | Bacteria | 19942 |
| 555 | Ga0207676_10158383 | 3300026095 | Unclassified | 1959 |
| 556 | Ga0207674_10000246 | 3300026116 | Bacteria | 67486 |
| 557 | Ga0207674_10004470 | 3300026116 | Bacteria | 16812 |
| 558 | Ga0207674_10017682 | 3300026116 | Bacteria | 7771 |
| 559 | Ga0207675_100009570 | 3300026118 | Bacteria | 9064 |
| 560 | Ga0207675_100068955 | 3300026118 | Bacteria | 3305 |
| 561 | Ga0207675_100105294 | 3300026118 | Bacteria | 2659 |
| 562 | Ga0207683_10000259 | 3300026121 | Bacteria | 47186 |
| 563 | Ga0207698_10039929 | 3300026142 | Bacteria | 3481 |
| 564 | Ga0207698_10097903 | 3300026142 | Unclassified | 2422 |
| 565 | Ga0207698_10134253 | 3300026142 | Bacteria | 2120 |
| 566 | Ga0265356_1002258 | 3300028017 | Bacteria | 2618 |
| 567 | Ga0268266_10001241 | 3300028379 | Bacteria | 31189 |
| 568 | Ga0268265_10008564 | 3300028380 | Bacteria | 6915 |
| 569 | Ga0268264_10013181 | 3300028381 | Bacteria | 6801 |
| 570 | Ga0268264_10044707 | 3300028381 | Bacteria | 3674 |
| 571 | Ga0268264_10206309 | 3300028381 | Unclassified | 1801 |
| 572 | Ga0265338_10008367 | 3300028800 | Bacteria | 12569 |
| 573 | Ga0265338_10048335 | 3300028800 | Bacteria | 3871 |
| 574 | Ga0265338_10060100 | 3300028800 | Unclassified | 3342 |
| 575 | Ga0265338_10076355 | 3300028800 | Unclassified | 2838 |
| 576 | Ga0265762_1000418 | 3300030760 | Bacteria | 7364 |
| 577 | Ga0265762_1000484 | 3300030760 | Bacteria | 6897 |
| 578 | Ga0265762_1002175 | 3300030760 | Unclassified | 3550 |
| 579 | Ga0265770_1004394 | 3300030878 | Bacteria | 1925 |
| 580 | Ga0265760_10000243 | 3300031090 | Bacteria | 14905 |
| 581 | Ga0265760_10000412 | 3300031090 | Bacteria | 12017 |
| 582 | Ga0265760_10001955 | 3300031090 | Bacteria | 6048 |
| 583 | Ga0265760_10022476 | 3300031090 | Unclassified | 1828 |
| 584 | Ga0265330_10006625 | 3300031235 | Bacteria | 5714 |
| 585 | Ga0265325_10026488 | 3300031241 | Unclassified | 3140 |
| 586 | Ga0265340_10048949 | 3300031247 | Unclassified | 2054 |
| 587 | Ga0265339_10006959 | 3300031249 | Bacteria | 7356 |
| 588 | Ga0265316_10012016 | 3300031344 | Bacteria | 7782 |
| 589 | Ga0265316_10018493 | 3300031344 | Bacteria | 5986 |
| 590 | Ga0265314_10021165 | 3300031711 | Bacteria | 5008 |
| 591 | Ga0265314_10032533 | 3300031711 | Unclassified | 3835 |
| 592 | Ga0265314_10128577 | 3300031711 | Bacteria | 1583 |
| 593 | Ga0316212_1004220 | 3300033547 | Bacteria | 2083 |
| 594 | Ga0373948_0002807 | 3300034817 | Bacteria | 2614 |
| 595 | Ga0373936_0003220 | 3300035113 | Bacteria | 6123 |
| 596 | Ga0373936_0003250 | 3300035113 | Bacteria | 6093 |
| 597 | Ga0373945_0024387 | 3300035116 | Bacteria | 2096 |
| 598 | Ga0373945_0029295 | 3300035116 | Bacteria | 1933 |
| 599 | Ga0373953_0028325 | 3300035117 | Unclassified | 2159 |
| 600 | Ga0373957_0002067 | 3300035120 | Bacteria | 5628 |
| 601 | Ga0373943_0000148 | 3300035170 | Bacteria | 27189 |
| 602 | Ga0373946_0056736 | 3300035171 | Bacteria | 1655 |
| 603 | Ga0373935_0013255 | 3300035692 | Bacteria | 4972 |
| 604 | Ga0373935_0050159 | 3300035692 | Unclassified | 2648 |
| 605 | Ga0373935_0063007 | 3300035692 | Bacteria | 2376 |
| 606 | Ga0373927_0001079 | 3300035695 | Bacteria | 20827 |
| 607 | Ga0373927_0010643 | 3300035695 | Bacteria | 6128 |
| 608 | Ga0373927_0042120 | 3300035695 | Bacteria | 2960 |
| 609 | Ga0373927_0065169 | 3300035695 | Bacteria | 2357 |
| 610 | Ga0373927_0077709 | 3300035695 | Bacteria | 2150 |
| 611 | Ga0373933_0055565 | 3300035724 | Unclassified | 2375 |
| 612 | Ga0373947_0001340 | 3300035725 | Bacteria | 15143 |
| 613 | Ga0373947_0070320 | 3300035725 | Bacteria | 2144 |
| 614 | Ga0373947_0070393 | 3300035725 | Bacteria | 2143 |
| 615 | Ga0373947_0113613 | 3300035725 | Unclassified | 1714 |
| 616 | Ga0373937_0104456 | 3300036401 | Unclassified | 2632 |
| 617 | Ga0373937_0196963 | 3300036401 | Unclassified | 1893 |
| 618 | Ga0373925_0003241 | 3300037068 | Bacteria | 12703 |
| 619 | Ga0373925_0012705 | 3300037068 | Bacteria | 6099 |
| 620 | Ga0373925_0207539 | 3300037068 | Bacteria | 1560 |
| 621 | Ga0436364_1358914 | 3300037853 | Bacteria | 3510 |
| 622 | Ga0436363_1412803 | 3300039450 | Bacteria | 3616 |
| 623 | Ga0436362_0466832 | 3300039453 | Bacteria | 4358 |
| 624 | Ga0451576_0297943 | 3300045051 | Unclassified | 1686 |
| 625 | Ga0466967_0012847 | 3300045976 | Bacteria | 6436 |
| 626 | Ga0466967_0057364 | 3300045976 | Bacteria | 3437 |
| 627 | Ga0466967_0171562 | 3300045976 | Unclassified | 2041 |
| 628 | Ga0466967_0735688 | 3300045976 | Unclassified | 978 |
| 629 | Ga0495629_0087997 | 3300046459 | Bacteria | 2167 |
| 630 | Ga0495653_0014292 | 3300046463 | Bacteria | 6474 |
| 631 | Ga0495580_0001097 | 3300046472 | Bacteria | 23738 |
| 632 | Ga0495580_0001908 | 3300046472 | Bacteria | 18328 |
| 633 | Ga0495580_0003312 | 3300046472 | Bacteria | 13776 |
| 634 | Ga0495580_0004680 | 3300046472 | Bacteria | 11475 |
| 635 | Ga0495580_0005828 | 3300046472 | Bacteria | 10106 |
| 636 | Ga0495580_0007428 | 3300046472 | Bacteria | 8810 |
| 637 | Ga0495580_0010830 | 3300046472 | Bacteria | 7077 |
| 638 | Ga0495580_0025265 | 3300046472 | Bacteria | 4343 |
| 639 | Ga0495580_0053703 | 3300046472 | Unclassified | 2843 |
| 640 | Ga0495580_0071255 | 3300046472 | Unclassified | 2428 |
| 641 | Ga0495580_0090174 | 3300046472 | Bacteria | 2134 |
| 642 | Ga0495580_0090847 | 3300046472 | Unclassified | 2125 |
| 643 | Ga0495582_0000452 | 3300046473 | Bacteria | 22463 |
| 644 | Ga0495582_0001438 | 3300046473 | Archaea | 13432 |
| 645 | Ga0495582_0038428 | 3300046473 | Unclassified | 2634 |
| 646 | Ga0495639_0140951 | 3300046475 | Bacteria | 1159 |
| 647 | Ga0495664_0034553 | 3300046477 | Bacteria | 2974 |
| 648 | Ga0495594_0018601 | 3300046499 | Bacteria | 3682 |
| 649 | Ga0495630_0049006 | 3300046517 | Unclassified | 3162 |
| 650 | Ga0495665_0067813 | 3300046531 | Bacteria | 1881 |
| 651 | Ga0495624_0125426 | 3300046690 | Unclassified | 1576 |
| 652 | Ga0495674_0063268 | 3300047319 | Bacteria | 3219 |
| 653 | Ga0495674_0088526 | 3300047319 | Unclassified | 2648 |
| 654 | Ga0495684_0072295 | 3300047471 | Unclassified | 2621 |
| 655 | Ga0495602_0036805 | 3300048088 | Bacteria | 4550 |
| 656 | Ga0496100_0116410 | 3300048903 | Bacteria | 1865 |
| 657 | Ga0496101_0023892 | 3300048904 | Unclassified | 4226 |
| 658 | Ga0496102_0069961 | 3300048905 | Bacteria | 3222 |
| 659 | Ga0496102_0090484 | 3300048905 | Unclassified | 2832 |
| 660 | Ga0496102_0109263 | 3300048905 | Unclassified | 2577 |
| 661 | Ga0496102_0196386 | 3300048905 | Bacteria | 1901 |
| 662 | Ga0496103_0138242 | 3300048906 | Bacteria | 1557 |
| 663 | Ga0496104_0089467 | 3300048907 | Unclassified | 2941 |
| 664 | Ga0496104_0115822 | 3300048907 | Unclassified | 2572 |
| 665 | Ga0496104_0147552 | 3300048907 | Bacteria | 2259 |
| 666 | Ga0496104_0148459 | 3300048907 | Bacteria | 2251 |
| 667 | Ga0496104_0181991 | 3300048907 | Bacteria | 2012 |
| 668 | Ga0496104_0310269 | 3300048907 | Bacteria | 1490 |
| 669 | Ga0496106_0045751 | 3300048909 | Unclassified | 3288 |
| 670 | Ga0496106_0131711 | 3300048909 | Bacteria | 1962 |
| 671 | Ga0496108_0000943 | 3300048911 | Bacteria | 22691 |
| 672 | Ga0496109_0000132 | 3300048912 | Bacteria | 76436 |
| 673 | Ga0496110_0031229 | 3300048913 | Bacteria | 4595 |
| 674 | Ga0496111_0016861 | 3300048914 | Bacteria | 5041 |
| 675 | Ga0496112_0000448 | 3300048915 | Bacteria | 27454 |
| 676 | Ga0496112_0018280 | 3300048915 | Bacteria | 6598 |
| 677 | Ga0496112_0020878 | 3300048915 | Bacteria | 6216 |
| 678 | Ga0496112_0031902 | 3300048915 | Bacteria | 5113 |
| 679 | Ga0496112_0043755 | 3300048915 | Unclassified | 4385 |
| 680 | Ga0496112_0143659 | 3300048915 | Bacteria | 2355 |
| 681 | Ga0496112_0214754 | 3300048915 | Bacteria | 1880 |
| 682 | Ga0496113_0004662 | 3300048916 | Bacteria | 8456 |
| 683 | Ga0496115_0009072 | 3300048918 | Bacteria | 7379 |
| 684 | Ga0496115_0057219 | 3300048918 | Unclassified | 3136 |
| 685 | Ga0496115_0100932 | 3300048918 | Unclassified | 2365 |
| 686 | nmdc:mga0n895_20822_c1 | 3300050512 | Bacteria | 6125 |
| 687 | nmdc:mga0n895_7414_c1 | 3300050512 | Bacteria | 9413 |
| 688 | nmdc:mga0rr50_2153_c1 | 3300050513 | Bacteria | 11011 |
| 689 | nmdc:mga0rr50_46417_c1 | 3300050513 | Unclassified | 3198 |
| 690 | nmdc:mga0rr50_4659_c1 | 3300050513 | Bacteria | 8083 |
| 691 | nmdc:mga08x19_12305_c1 | 3300050514 | Bacteria | 5151 |
| 692 | nmdc:mga08x19_8404_c1 | 3300050514 | Bacteria | 6151 |
| 693 | nmdc:mga0a205_2659_c1 | 3300050515 | Bacteria | 15797 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006028 | Ga0070717_10042437 | Ga0070717_100424373 | 283 |
| 2 | 3300013104 | Ga0157370_10196902 | Ga0157370_101969022 | 288 |
| 3 | 3300048907 | Ga0496104_0181991 | Ga0496104_0181991_14_892 | 292 |
| 4 | 3300045976 | Ga0466967_0735688 | Ga0466967_0735688_13_957 | 300 |
| 5 | 3300030760 | Ga0265762_1000418 | Ga0265762_10004184 | 302 |
| 6 | 3300028800 | Ga0265338_10048335 | Ga0265338_100483353 | 304 |
| 7 | 3300005445 | Ga0070708_100016177 | Ga0070708_1000161773 | 309 |
| 8 | 3300005467 | Ga0070706_100129708 | Ga0070706_1001297082 | 309 |
| 9 | 3300005468 | Ga0070707_100040755 | Ga0070707_1000407552 | 309 |
| 10 | 3300025910 | Ga0207684_10069000 | Ga0207684_100690002 | 309 |
| 11 | 3300028800 | Ga0265338_10076355 | Ga0265338_100763552 | 311 |
| 12 | 3300035695 | Ga0373927_0065169 | Ga0373927_0065169_35_970 | 311 |
| 13 | 3300005445 | Ga0070708_100089236 | Ga0070708_1000892362 | 312 |
| 14 | 3300005467 | Ga0070706_100096200 | Ga0070706_1000962002 | 312 |
| 15 | 3300022730 | Ga0224570_100347 | Ga0224570_1003472 | 312 |
| 16 | 3300024227 | Ga0228598_1005539 | Ga0228598_10055392 | 312 |
| 17 | 3300031711 | Ga0265314_10128577 | Ga0265314_101285771 | 313 |
| 18 | 3300005518 | Ga0070699_100090972 | Ga0070699_1000909722 | 315 |
| 19 | 3300005468 | Ga0070707_100023721 | Ga0070707_1000237215 | 316 |
| 20 | 3300005518 | Ga0070699_100039804 | Ga0070699_1000398041 | 316 |
| 21 | 3300005536 | Ga0070697_100350441 | Ga0070697_1003504411 | 316 |
| 22 | 3300005434 | Ga0070709_10022862 | Ga0070709_100228623 | 317 |
| 23 | 3300005436 | Ga0070713_100000531 | Ga0070713_1000005313 | 317 |
| 24 | 3300005437 | Ga0070710_10008425 | Ga0070710_100084255 | 317 |
| 25 | 3300005439 | Ga0070711_100001578 | Ga0070711_1000015788 | 317 |
| 26 | 3300006028 | Ga0070717_10002932 | Ga0070717_100029327 | 317 |
| 27 | 3300006163 | Ga0070715_10010820 | Ga0070715_100108203 | 317 |
| 28 | 3300006173 | Ga0070716_100003816 | Ga0070716_1000038167 | 317 |
| 29 | 3300006175 | Ga0070712_100001245 | Ga0070712_10000124512 | 317 |
| 30 | 3300025898 | Ga0207692_10006406 | Ga0207692_100064062 | 317 |
| 31 | 3300025905 | Ga0207685_10019631 | Ga0207685_100196312 | 317 |
| 32 | 3300025906 | Ga0207699_10035935 | Ga0207699_100359352 | 317 |
| 33 | 3300025915 | Ga0207693_10000140 | Ga0207693_1000014046 | 317 |
| 34 | 3300025916 | Ga0207663_10000470 | Ga0207663_100004702 | 317 |
| 35 | 3300025928 | Ga0207700_10000708 | Ga0207700_1000070810 | 317 |
| 36 | 3300025939 | Ga0207665_10002386 | Ga0207665_100023862 | 317 |
| 37 | 3300035695 | Ga0373927_0077709 | Ga0373927_0077709_166_1254 | 317 |
| 38 | 3300035725 | Ga0373947_0070393 | Ga0373947_0070393_61_1149 | 317 |
| 39 | 3300046459 | Ga0495629_0087997 | Ga0495629_0087997_508_1596 | 317 |
| 40 | 3300046472 | Ga0495580_0001908 | Ga0495580_0001908_10529_11617 | 317 |
| 41 | 3300046473 | Ga0495582_0001438 | Ga0495582_0001438_5747_6835 | 317 |
| 42 | 3300048918 | Ga0496115_0009072 | Ga0496115_0009072_1860_2948 | 317 |
| 43 | 3300001978 | JGI24747J21853_1000176 | JGI24747J21853_10001762 | 318 |
| 44 | 3300001990 | JGI24737J22298_10026519 | JGI24737J22298_100265192 | 318 |
| 45 | 3300005334 | Ga0068869_100052771 | Ga0068869_1000527713 | 318 |
| 46 | 3300005335 | Ga0070666_10057046 | Ga0070666_100570462 | 318 |
| 47 | 3300005337 | Ga0070682_100015308 | Ga0070682_1000153082 | 318 |
| 48 | 3300005345 | Ga0070692_10038522 | Ga0070692_100385222 | 318 |
| 49 | 3300005355 | Ga0070671_100102360 | Ga0070671_1001023602 | 318 |
| 50 | 3300005456 | Ga0070678_100037932 | Ga0070678_1000379323 | 318 |
| 51 | 3300035113 | Ga0373936_0003250 | Ga0373936_0003250_2509_3597 | 318 |
| 52 | 3300035116 | Ga0373945_0024387 | Ga0373945_0024387_941_2029 | 318 |
| 53 | 3300035692 | Ga0373935_0050159 | Ga0373935_0050159_277_1365 | 318 |
| 54 | 3300047319 | Ga0495674_0063268 | Ga0495674_0063268_1906_2994 | 318 |
| 55 | 3300028017 | Ga0265356_1002258 | Ga0265356_10022582 | 323 |
| 56 | 3300030760 | Ga0265762_1000484 | Ga0265762_10004846 | 323 |
| 57 | 3300031241 | Ga0265325_10026488 | Ga0265325_100264882 | 324 |
| 58 | 3300031247 | Ga0265340_10048949 | Ga0265340_100489492 | 324 |
| 59 | 3300031711 | Ga0265314_10032533 | Ga0265314_100325334 | 324 |
| 60 | 3300005445 | Ga0070708_100008418 | Ga0070708_1000084184 | 327 |
| 61 | 3300005468 | Ga0070707_100087248 | Ga0070707_1000872481 | 327 |
| 62 | 3300025922 | Ga0207646_10326707 | Ga0207646_103267072 | 327 |
| 63 | 3300025910 | Ga0207684_10303297 | Ga0207684_103032971 | 328 |
| 64 | 3300031344 | Ga0265316_10012016 | Ga0265316_100120164 | 328 |
| 65 | 3300031711 | Ga0265314_10021165 | Ga0265314_100211651 | 328 |
| 66 | 3300046472 | Ga0495580_0025265 | Ga0495580_0025265_2948_4039 | 328 |
| 67 | 3300039453 | Ga0436362_0466832 | Ga0436362_0466832_2884_3966 | 329 |
| 68 | 3300014497 | Ga0182008_10001046 | Ga0182008_1000104610 | 330 |
| 69 | 3300015261 | Ga0182006_1010221 | Ga0182006_10102214 | 330 |
| 70 | 3300022732 | Ga0224569_100721 | Ga0224569_1007213 | 330 |
| 71 | 3300005434 | Ga0070709_10000586 | Ga0070709_1000058620 | 331 |
| 72 | 3300005436 | Ga0070713_100000352 | Ga0070713_1000003528 | 331 |
| 73 | 3300005437 | Ga0070710_10031128 | Ga0070710_100311283 | 331 |
| 74 | 3300006173 | Ga0070716_100003557 | Ga0070716_1000035576 | 331 |
| 75 | 3300006175 | Ga0070712_100000658 | Ga0070712_10000065811 | 331 |
| 76 | 3300025898 | Ga0207692_10014652 | Ga0207692_100146521 | 331 |
| 77 | 3300025906 | Ga0207699_10001214 | Ga0207699_1000121410 | 331 |
| 78 | 3300025915 | Ga0207693_10000350 | Ga0207693_100003505 | 331 |
| 79 | 3300025928 | Ga0207700_10004605 | Ga0207700_100046053 | 331 |
| 80 | 3300025939 | Ga0207665_10013388 | Ga0207665_100133884 | 331 |
| 81 | 3300005445 | Ga0070708_100026175 | Ga0070708_1000261752 | 332 |
| 82 | 3300005468 | Ga0070707_100106843 | Ga0070707_1001068433 | 332 |
| 83 | 3300005530 | Ga0070679_100073747 | Ga0070679_1000737473 | 332 |
| 84 | 3300009174 | Ga0105241_10001486 | Ga0105241_1000148616 | 332 |
| 85 | 3300009545 | Ga0105237_10029870 | Ga0105237_100298704 | 332 |
| 86 | 3300013100 | Ga0157373_10006042 | Ga0157373_100060428 | 332 |
| 87 | 3300013104 | Ga0157370_10053518 | Ga0157370_100535183 | 332 |
| 88 | 3300013105 | Ga0157369_10025206 | Ga0157369_100252067 | 332 |
| 89 | 3300013296 | Ga0157374_10068555 | Ga0157374_100685552 | 332 |
| 90 | 3300013307 | Ga0157372_10011993 | Ga0157372_100119933 | 332 |
| 91 | 3300025910 | Ga0207684_10004860 | Ga0207684_100048606 | 332 |
| 92 | 3300025911 | Ga0207654_10001671 | Ga0207654_100016719 | 332 |
| 93 | 3300025921 | Ga0207652_10104864 | Ga0207652_101048642 | 332 |
| 94 | 3300025922 | Ga0207646_10221718 | Ga0207646_102217182 | 332 |
| 95 | 3300025945 | Ga0207679_10195538 | Ga0207679_101955382 | 332 |
| 96 | 3300025949 | Ga0207667_10152045 | Ga0207667_101520453 | 332 |
| 97 | 3300026078 | Ga0207702_10000396 | Ga0207702_1000039613 | 332 |
| 98 | 3300026078 | Ga0207702_10037198 | Ga0207702_100371985 | 332 |
| 99 | 3300037068 | Ga0373925_0012705 | Ga0373925_0012705_1677_2768 | 332 |
| 100 | 3300048915 | Ga0496112_0020878 | Ga0496112_0020878_4929_6020 | 332 |
| 101 | 3300005536 | Ga0070697_100000397 | Ga0070697_10000039718 | 333 |
| 102 | 3300005841 | Ga0068863_100119952 | Ga0068863_1001199522 | 333 |
| 103 | 3300026088 | Ga0207641_10109405 | Ga0207641_101094051 | 333 |
| 104 | 3300028800 | Ga0265338_10060100 | Ga0265338_100601003 | 333 |
| 105 | 3300031249 | Ga0265339_10006959 | Ga0265339_100069594 | 333 |
| 106 | 3300031344 | Ga0265316_10018493 | Ga0265316_100184935 | 333 |
| 107 | 3300035695 | Ga0373927_0042120 | Ga0373927_0042120_1504_2616 | 333 |
| 108 | 3300046472 | Ga0495580_0010830 | Ga0495580_0010830_4349_5461 | 333 |
| 109 | 3300005290 | Ga0065712_10028940 | Ga0065712_100289401 | 334 |
| 110 | 3300005329 | Ga0070683_100460306 | Ga0070683_1004603061 | 334 |
| 111 | 3300005331 | Ga0070670_100208869 | Ga0070670_1002088692 | 334 |
| 112 | 3300005337 | Ga0070682_100019066 | Ga0070682_1000190664 | 334 |
| 113 | 3300005339 | Ga0070660_100064849 | Ga0070660_1000648493 | 334 |
| 114 | 3300005344 | Ga0070661_100049237 | Ga0070661_1000492373 | 334 |
| 115 | 3300005355 | Ga0070671_100259487 | Ga0070671_1002594871 | 334 |
| 116 | 3300005455 | Ga0070663_100100666 | Ga0070663_1001006662 | 334 |
| 117 | 3300005457 | Ga0070662_100141573 | Ga0070662_1001415732 | 334 |
| 118 | 3300005468 | Ga0070707_100470646 | Ga0070707_1004706461 | 334 |
| 119 | 3300005564 | Ga0070664_100055990 | Ga0070664_1000559904 | 334 |
| 120 | 3300005614 | Ga0068856_100028664 | Ga0068856_1000286647 | 334 |
| 121 | 3300005618 | Ga0068864_100121664 | Ga0068864_1001216643 | 334 |
| 122 | 3300005834 | Ga0068851_10048345 | Ga0068851_100483452 | 334 |
| 123 | 3300006871 | Ga0075434_100163176 | Ga0075434_1001631762 | 334 |
| 124 | 3300009093 | Ga0105240_10008167 | Ga0105240_100081672 | 334 |
| 125 | 3300009545 | Ga0105237_10050389 | Ga0105237_100503893 | 334 |
| 126 | 3300010375 | Ga0105239_10137393 | Ga0105239_101373933 | 334 |
| 127 | 3300013105 | Ga0157369_10113854 | Ga0157369_101138543 | 334 |
| 128 | 3300013297 | Ga0157378_10066055 | Ga0157378_100660554 | 334 |
| 129 | 3300014497 | Ga0182008_10029047 | Ga0182008_100290472 | 334 |
| 130 | 3300015261 | Ga0182006_1016692 | Ga0182006_10166923 | 334 |
| 131 | 3300025904 | Ga0207647_10117169 | Ga0207647_101171692 | 334 |
| 132 | 3300025913 | Ga0207695_10255534 | Ga0207695_102555342 | 334 |
| 133 | 3300025919 | Ga0207657_10001169 | Ga0207657_1000116911 | 334 |
| 134 | 3300025920 | Ga0207649_10035274 | Ga0207649_100352743 | 334 |
| 135 | 3300025931 | Ga0207644_10258840 | Ga0207644_102588401 | 334 |
| 136 | 3300025933 | Ga0207706_10014037 | Ga0207706_100140371 | 334 |
| 137 | 3300026041 | Ga0207639_10046651 | Ga0207639_100466512 | 334 |
| 138 | 3300026067 | Ga0207678_10104787 | Ga0207678_101047873 | 334 |
| 139 | 3300048905 | Ga0496102_0196386 | Ga0496102_0196386_456_1547 | 334 |
| 140 | 3300048906 | Ga0496103_0138242 | Ga0496103_0138242_218_1309 | 334 |
| 141 | 3300048907 | Ga0496104_0310269 | Ga0496104_0310269_343_1434 | 334 |
| 142 | 3300005338 | Ga0068868_100011959 | Ga0068868_1000119593 | 336 |
| 143 | 3300005437 | Ga0070710_10089487 | Ga0070710_100894872 | 336 |
| 144 | 3300005578 | Ga0068854_100039175 | Ga0068854_1000391752 | 336 |
| 145 | 3300005841 | Ga0068863_100112107 | Ga0068863_1001121072 | 336 |
| 146 | 3300006028 | Ga0070717_10012853 | Ga0070717_100128536 | 336 |
| 147 | 3300006237 | Ga0097621_100002728 | Ga0097621_1000027287 | 336 |
| 148 | 3300006358 | Ga0068871_100034934 | Ga0068871_1000349343 | 336 |
| 149 | 3300009098 | Ga0105245_10004111 | Ga0105245_100041118 | 336 |
| 150 | 3300009176 | Ga0105242_10006300 | Ga0105242_100063009 | 336 |
| 151 | 3300009177 | Ga0105248_10034297 | Ga0105248_100342973 | 336 |
| 152 | 3300013297 | Ga0157378_10008887 | Ga0157378_100088872 | 336 |
| 153 | 3300013306 | Ga0163162_10078740 | Ga0163162_100787403 | 336 |
| 154 | 3300013306 | Ga0163162_10091738 | Ga0163162_100917384 | 336 |
| 155 | 3300014325 | Ga0163163_10104250 | Ga0163163_101042502 | 336 |
| 156 | 3300014969 | Ga0157376_10099202 | Ga0157376_100992022 | 336 |
| 157 | 3300025903 | Ga0207680_10139441 | Ga0207680_101394412 | 336 |
| 158 | 3300025927 | Ga0207687_10005776 | Ga0207687_100057767 | 336 |
| 159 | 3300026023 | Ga0207677_10007513 | Ga0207677_100075133 | 336 |
| 160 | 3300028800 | Ga0265338_10008367 | Ga0265338_100083672 | 336 |
| 161 | 3300048905 | Ga0496102_0069961 | Ga0496102_0069961_544_1653 | 336 |
| 162 | 3300048905 | Ga0496102_0109263 | Ga0496102_0109263_143_1231 | 336 |
| 163 | 3300005329 | Ga0070683_100030114 | Ga0070683_1000301144 | 337 |
| 164 | 3300005335 | Ga0070666_10046129 | Ga0070666_100461292 | 337 |
| 165 | 3300005336 | Ga0070680_100051175 | Ga0070680_1000511752 | 337 |
| 166 | 3300005337 | Ga0070682_100304707 | Ga0070682_1003047071 | 337 |
| 167 | 3300005347 | Ga0070668_100037218 | Ga0070668_1000372182 | 337 |
| 168 | 3300005366 | Ga0070659_100271012 | Ga0070659_1002710121 | 337 |
| 169 | 3300005434 | Ga0070709_10262048 | Ga0070709_102620481 | 337 |
| 170 | 3300005436 | Ga0070713_100181808 | Ga0070713_1001818082 | 337 |
| 171 | 3300005445 | Ga0070708_100193558 | Ga0070708_1001935582 | 337 |
| 172 | 3300005455 | Ga0070663_100065023 | Ga0070663_1000650232 | 337 |
| 173 | 3300005457 | Ga0070662_100029331 | Ga0070662_1000293314 | 337 |
| 174 | 3300005459 | Ga0068867_100076307 | Ga0068867_1000763072 | 337 |
| 175 | 3300005518 | Ga0070699_100027994 | Ga0070699_1000279942 | 337 |
| 176 | 3300005535 | Ga0070684_100009183 | Ga0070684_1000091832 | 337 |
| 177 | 3300005536 | Ga0070697_100027550 | Ga0070697_1000275503 | 337 |
| 178 | 3300005545 | Ga0070695_100014489 | Ga0070695_1000144894 | 337 |
| 179 | 3300005547 | Ga0070693_100050882 | Ga0070693_1000508823 | 337 |
| 180 | 3300005548 | Ga0070665_100014107 | Ga0070665_1000141075 | 337 |
| 181 | 3300005563 | Ga0068855_100292483 | Ga0068855_1002924832 | 337 |
| 182 | 3300005616 | Ga0068852_100078917 | Ga0068852_1000789172 | 337 |
| 183 | 3300005617 | Ga0068859_100066899 | Ga0068859_1000668993 | 337 |
| 184 | 3300005834 | Ga0068851_10022211 | Ga0068851_100222114 | 337 |
| 185 | 3300005843 | Ga0068860_100078870 | Ga0068860_1000788703 | 337 |
| 186 | 3300006931 | Ga0097620_100066896 | Ga0097620_1000668963 | 337 |
| 187 | 3300009101 | Ga0105247_10020936 | Ga0105247_100209362 | 337 |
| 188 | 3300009148 | Ga0105243_10055743 | Ga0105243_100557434 | 337 |
| 189 | 3300009177 | Ga0105248_10054223 | Ga0105248_100542233 | 337 |
| 190 | 3300009553 | Ga0105249_10376572 | Ga0105249_103765721 | 337 |
| 191 | 3300013102 | Ga0157371_10017563 | Ga0157371_100175635 | 337 |
| 192 | 3300013105 | Ga0157369_10060435 | Ga0157369_100604352 | 337 |
| 193 | 3300013296 | Ga0157374_10014051 | Ga0157374_100140514 | 337 |
| 194 | 3300013306 | Ga0163162_10006230 | Ga0163162_100062308 | 337 |
| 195 | 3300014968 | Ga0157379_10039232 | Ga0157379_100392323 | 337 |
| 196 | 3300014969 | Ga0157376_10087801 | Ga0157376_100878012 | 337 |
| 197 | 3300025900 | Ga0207710_10015754 | Ga0207710_100157542 | 337 |
| 198 | 3300025906 | Ga0207699_10183293 | Ga0207699_101832931 | 337 |
| 199 | 3300025911 | Ga0207654_10004523 | Ga0207654_100045233 | 337 |
| 200 | 3300025919 | Ga0207657_10001964 | Ga0207657_1000196413 | 337 |
| 201 | 3300025927 | Ga0207687_10005572 | Ga0207687_100055722 | 337 |
| 202 | 3300025929 | Ga0207664_10000037 | Ga0207664_1000003753 | 337 |
| 203 | 3300025933 | Ga0207706_10000432 | Ga0207706_1000043220 | 337 |
| 204 | 3300025935 | Ga0207709_10009090 | Ga0207709_100090904 | 337 |
| 205 | 3300025942 | Ga0207689_10097811 | Ga0207689_100978112 | 337 |
| 206 | 3300025949 | Ga0207667_10007050 | Ga0207667_100070508 | 337 |
| 207 | 3300026041 | Ga0207639_10216598 | Ga0207639_102165982 | 337 |
| 208 | 3300026067 | Ga0207678_10000722 | Ga0207678_1000072212 | 337 |
| 209 | 3300026095 | Ga0207676_10158383 | Ga0207676_101583832 | 337 |
| 210 | 3300026116 | Ga0207674_10017682 | Ga0207674_100176829 | 337 |
| 211 | 3300026118 | Ga0207675_100105294 | Ga0207675_1001052942 | 337 |
| 212 | 3300026142 | Ga0207698_10134253 | Ga0207698_101342532 | 337 |
| 213 | 3300028381 | Ga0268264_10206309 | Ga0268264_102063092 | 337 |
| 214 | 3300034817 | Ga0373948_0002807 | Ga0373948_0002807_647_1735 | 337 |
| 215 | 3300035113 | Ga0373936_0003220 | Ga0373936_0003220_3884_4975 | 337 |
| 216 | 3300035116 | Ga0373945_0029295 | Ga0373945_0029295_152_1213 | 337 |
| 217 | 3300035117 | Ga0373953_0028325 | Ga0373953_0028325_294_1385 | 337 |
| 218 | 3300035120 | Ga0373957_0002067 | Ga0373957_0002067_1640_2731 | 337 |
| 219 | 3300035170 | Ga0373943_0000148 | Ga0373943_0000148_9114_10175 | 337 |
| 220 | 3300035692 | Ga0373935_0013255 | Ga0373935_0013255_2515_3576 | 337 |
| 221 | 3300035695 | Ga0373927_0001079 | Ga0373927_0001079_11287_12348 | 337 |
| 222 | 3300035724 | Ga0373933_0055565 | Ga0373933_0055565_566_1627 | 337 |
| 223 | 3300035725 | Ga0373947_0001340 | Ga0373947_0001340_11473_12534 | 337 |
| 224 | 3300036401 | Ga0373937_0196963 | Ga0373937_0196963_802_1863 | 337 |
| 225 | 3300037068 | Ga0373925_0003241 | Ga0373925_0003241_5235_6296 | 337 |
| 226 | 3300046463 | Ga0495653_0014292 | Ga0495653_0014292_1361_2452 | 337 |
| 227 | 3300046477 | Ga0495664_0034553 | Ga0495664_0034553_268_1329 | 337 |
| 228 | 3300046517 | Ga0495630_0049006 | Ga0495630_0049006_1404_2495 | 337 |
| 229 | 3300047471 | Ga0495684_0072295 | Ga0495684_0072295_734_1825 | 337 |
| 230 | 3300048907 | Ga0496104_0147552 | Ga0496104_0147552_145_1233 | 337 |
| 231 | 3300005434 | Ga0070709_10022924 | Ga0070709_100229241 | 338 |
| 232 | 3300006028 | Ga0070717_10013844 | Ga0070717_100138446 | 338 |
| 233 | 3300006028 | Ga0070717_10029577 | Ga0070717_100295772 | 338 |
| 234 | 3300006175 | Ga0070712_100047276 | Ga0070712_1000472761 | 338 |
| 235 | 3300006852 | Ga0075433_10000971 | Ga0075433_1000097117 | 338 |
| 236 | 3300006871 | Ga0075434_100009879 | Ga0075434_1000098796 | 338 |
| 237 | 3300007076 | Ga0075435_100016153 | Ga0075435_1000161533 | 338 |
| 238 | 3300009176 | Ga0105242_10191638 | Ga0105242_101916382 | 338 |
| 239 | 3300025899 | Ga0207642_10016373 | Ga0207642_100163732 | 338 |
| 240 | 3300025928 | Ga0207700_10125460 | Ga0207700_101254602 | 338 |
| 241 | 3300025939 | Ga0207665_10003706 | Ga0207665_100037068 | 338 |
| 242 | 3300050512 | nmdc:mga0n895_7414_c1 | nmdc:mga0n895_7414_c1_400_1497 | 338 |
| 243 | 3300050513 | nmdc:mga0rr50_2153_c1 | nmdc:mga0rr50_2153_c1_5221_6318 | 338 |
| 244 | 3300050514 | nmdc:mga08x19_12305_c1 | nmdc:mga08x19_12305_c1_400_1497 | 338 |
| 245 | 3300050515 | nmdc:mga0a205_2659_c1 | nmdc:mga0a205_2659_c1_11764_12861 | 338 |
| 246 | 3300005434 | Ga0070709_10014481 | Ga0070709_100144813 | 339 |
| 247 | 3300005434 | Ga0070709_10100539 | Ga0070709_101005391 | 339 |
| 248 | 3300005439 | Ga0070711_100216215 | Ga0070711_1002162151 | 339 |
| 249 | 3300005439 | Ga0070711_100239112 | Ga0070711_1002391121 | 339 |
| 250 | 3300005445 | Ga0070708_100000729 | Ga0070708_10000072920 | 339 |
| 251 | 3300005458 | Ga0070681_10044424 | Ga0070681_100444241 | 339 |
| 252 | 3300005467 | Ga0070706_100000499 | Ga0070706_1000004997 | 339 |
| 253 | 3300005468 | Ga0070707_100002005 | Ga0070707_10000200510 | 339 |
| 254 | 3300005471 | Ga0070698_100001258 | Ga0070698_10000125814 | 339 |
| 255 | 3300005518 | Ga0070699_100000621 | Ga0070699_10000062114 | 339 |
| 256 | 3300005536 | Ga0070697_100000258 | Ga0070697_10000025816 | 339 |
| 257 | 3300005536 | Ga0070697_100015413 | Ga0070697_1000154134 | 339 |
| 258 | 3300005841 | Ga0068863_100036172 | Ga0068863_1000361722 | 339 |
| 259 | 3300005841 | Ga0068863_100074999 | Ga0068863_1000749994 | 339 |
| 260 | 3300006028 | Ga0070717_10060214 | Ga0070717_100602142 | 339 |
| 261 | 3300006173 | Ga0070716_100053474 | Ga0070716_1000534741 | 339 |
| 262 | 3300006175 | Ga0070712_100073329 | Ga0070712_1000733292 | 339 |
| 263 | 3300006237 | Ga0097621_100003550 | Ga0097621_1000035509 | 339 |
| 264 | 3300006358 | Ga0068871_100004799 | Ga0068871_1000047993 | 339 |
| 265 | 3300009093 | Ga0105240_10159996 | Ga0105240_101599962 | 339 |
| 266 | 3300009098 | Ga0105245_10078506 | Ga0105245_100785062 | 339 |
| 267 | 3300009101 | Ga0105247_10017515 | Ga0105247_100175153 | 339 |
| 268 | 3300009174 | Ga0105241_10003005 | Ga0105241_100030055 | 339 |
| 269 | 3300009177 | Ga0105248_10238249 | Ga0105248_102382492 | 339 |
| 270 | 3300009545 | Ga0105237_10232874 | Ga0105237_102328741 | 339 |
| 271 | 3300009551 | Ga0105238_10017430 | Ga0105238_100174303 | 339 |
| 272 | 3300010159 | Ga0099796_10024290 | Ga0099796_100242902 | 339 |
| 273 | 3300011119 | Ga0105246_10174545 | Ga0105246_101745451 | 339 |
| 274 | 3300013296 | Ga0157374_10000997 | Ga0157374_1000099720 | 339 |
| 275 | 3300013296 | Ga0157374_10186858 | Ga0157374_101868582 | 339 |
| 276 | 3300013297 | Ga0157378_10010398 | Ga0157378_100103987 | 339 |
| 277 | 3300013306 | Ga0163162_10020438 | Ga0163162_100204381 | 339 |
| 278 | 3300014325 | Ga0163163_10152526 | Ga0163163_101525262 | 339 |
| 279 | 3300014968 | Ga0157379_10005139 | Ga0157379_100051397 | 339 |
| 280 | 3300014968 | Ga0157379_10055758 | Ga0157379_100557582 | 339 |
| 281 | 3300025906 | Ga0207699_10070157 | Ga0207699_100701572 | 339 |
| 282 | 3300025910 | Ga0207684_10000132 | Ga0207684_1000013215 | 339 |
| 283 | 3300025910 | Ga0207684_10001821 | Ga0207684_1000182117 | 339 |
| 284 | 3300025911 | Ga0207654_10026179 | Ga0207654_100261793 | 339 |
| 285 | 3300025912 | Ga0207707_10004957 | Ga0207707_1000495710 | 339 |
| 286 | 3300025913 | Ga0207695_10021666 | Ga0207695_100216665 | 339 |
| 287 | 3300025913 | Ga0207695_10321256 | Ga0207695_103212562 | 339 |
| 288 | 3300025922 | Ga0207646_10000301 | Ga0207646_1000030115 | 339 |
| 289 | 3300025924 | Ga0207694_10035217 | Ga0207694_100352172 | 339 |
| 290 | 3300025939 | Ga0207665_10022639 | Ga0207665_100226391 | 339 |
| 291 | 3300026088 | Ga0207641_10011551 | Ga0207641_100115514 | 339 |
| 292 | 3300026088 | Ga0207641_10062642 | Ga0207641_100626422 | 339 |
| 293 | 3300046472 | Ga0495580_0007428 | Ga0495580_0007428_7132_8220 | 339 |
| 294 | 3300048903 | Ga0496100_0116410 | Ga0496100_0116410_68_1156 | 339 |
| 295 | 3300048904 | Ga0496101_0023892 | Ga0496101_0023892_2680_3768 | 339 |
| 296 | 3300048907 | Ga0496104_0148459 | Ga0496104_0148459_219_1307 | 339 |
| 297 | 3300048909 | Ga0496106_0045751 | Ga0496106_0045751_1242_2330 | 339 |
| 298 | 3300048915 | Ga0496112_0143659 | Ga0496112_0143659_39_1127 | 339 |
| 299 | 3300005436 | Ga0070713_100069617 | Ga0070713_1000696174 | 340 |
| 300 | 3300005844 | Ga0068862_100123345 | Ga0068862_1001233452 | 340 |
| 301 | 3300025940 | Ga0207691_10126085 | Ga0207691_101260852 | 340 |
| 302 | 3300025986 | Ga0207658_10087814 | Ga0207658_100878142 | 340 |
| 303 | 3300045976 | Ga0466967_0171562 | Ga0466967_0171562_905_1996 | 340 |
| 304 | 3300007788 | Ga0099795_10031611 | Ga0099795_100316112 | 342 |
| 305 | 3300009093 | Ga0105240_10044008 | Ga0105240_100440083 | 342 |
| 306 | 3300013105 | Ga0157369_10015793 | Ga0157369_100157936 | 342 |
| 307 | 3300013307 | Ga0157372_10001204 | Ga0157372_1000120417 | 342 |
| 308 | 3300025913 | Ga0207695_10043703 | Ga0207695_100437036 | 342 |
| 309 | 3300005436 | Ga0070713_100007494 | Ga0070713_1000074946 | 343 |
| 310 | 3300006175 | Ga0070712_100002784 | Ga0070712_10000278410 | 343 |
| 311 | 3300025915 | Ga0207693_10002744 | Ga0207693_100027446 | 343 |
| 312 | 3300045976 | Ga0466967_0012847 | Ga0466967_0012847_2370_3458 | 343 |
| 313 | 3300046472 | Ga0495580_0071255 | Ga0495580_0071255_319_1407 | 343 |
| 314 | 3300048088 | Ga0495602_0036805 | Ga0495602_0036805_1389_2477 | 343 |
| 315 | 3300046473 | Ga0495582_0038428 | Ga0495582_0038428_1066_2151 | 344 |
| 316 | 3300005437 | Ga0070710_10000959 | Ga0070710_1000095911 | 345 |
| 317 | 3300025898 | Ga0207692_10004844 | Ga0207692_100048445 | 345 |
| 318 | 3300035725 | Ga0373947_0113613 | Ga0373947_0113613_552_1640 | 345 |
| 319 | 3300046472 | Ga0495580_0090847 | Ga0495580_0090847_514_1602 | 345 |
| 320 | 3300046499 | Ga0495594_0018601 | Ga0495594_0018601_44_1117 | 346 |
| 321 | 3300005614 | Ga0068856_100002086 | Ga0068856_1000020868 | 347 |
| 322 | 3300006173 | Ga0070716_100017624 | Ga0070716_1000176243 | 347 |
| 323 | 3300009093 | Ga0105240_10018860 | Ga0105240_100188606 | 347 |
| 324 | 3300013100 | Ga0157373_10123591 | Ga0157373_101235912 | 347 |
| 325 | 3300013105 | Ga0157369_10138228 | Ga0157369_101382282 | 347 |
| 326 | 3300013307 | Ga0157372_10007745 | Ga0157372_1000774510 | 347 |
| 327 | 3300025906 | Ga0207699_10035512 | Ga0207699_100355122 | 347 |
| 328 | 3300025921 | Ga0207652_10295355 | Ga0207652_102953552 | 347 |
| 329 | 3300025949 | Ga0207667_10162474 | Ga0207667_101624742 | 347 |
| 330 | 3300026078 | Ga0207702_10226089 | Ga0207702_102260891 | 347 |
| 331 | 3300031090 | Ga0265760_10001955 | Ga0265760_100019553 | 348 |
| 332 | 3300024227 | Ga0228598_1000128 | Ga0228598_100012813 | 349 |
| 333 | 3300030878 | Ga0265770_1004394 | Ga0265770_10043942 | 349 |
| 334 | 3300031090 | Ga0265760_10000243 | Ga0265760_100002434 | 349 |
| 335 | 3300031090 | Ga0265760_10022476 | Ga0265760_100224762 | 349 |
| 336 | 3300000546 | LJNas_1002028 | LJNas_10020283 | 350 |
| 337 | 3300005334 | Ga0068869_100006028 | Ga0068869_1000060283 | 350 |
| 338 | 3300005338 | Ga0068868_100008758 | Ga0068868_1000087585 | 350 |
| 339 | 3300005434 | Ga0070709_10189669 | Ga0070709_101896691 | 350 |
| 340 | 3300005437 | Ga0070710_10084190 | Ga0070710_100841901 | 350 |
| 341 | 3300005439 | Ga0070711_100020066 | Ga0070711_1000200661 | 350 |
| 342 | 3300005445 | Ga0070708_100086097 | Ga0070708_1000860973 | 350 |
| 343 | 3300005467 | Ga0070706_100207265 | Ga0070706_1002072652 | 350 |
| 344 | 3300005468 | Ga0070707_100005851 | Ga0070707_1000058512 | 350 |
| 345 | 3300005471 | Ga0070698_100000795 | Ga0070698_1000007958 | 350 |
| 346 | 3300005518 | Ga0070699_100001944 | Ga0070699_1000019446 | 350 |
| 347 | 3300005539 | Ga0068853_100178841 | Ga0068853_1001788412 | 350 |
| 348 | 3300005617 | Ga0068859_100009582 | Ga0068859_1000095824 | 350 |
| 349 | 3300005841 | Ga0068863_100032516 | Ga0068863_1000325163 | 350 |
| 350 | 3300005843 | Ga0068860_100021853 | Ga0068860_1000218532 | 350 |
| 351 | 3300006028 | Ga0070717_10252387 | Ga0070717_102523872 | 350 |
| 352 | 3300006173 | Ga0070716_100124327 | Ga0070716_1001243271 | 350 |
| 353 | 3300006175 | Ga0070712_100000193 | Ga0070712_10000019320 | 350 |
| 354 | 3300006358 | Ga0068871_100013866 | Ga0068871_1000138665 | 350 |
| 355 | 3300006358 | Ga0068871_100152279 | Ga0068871_1001522792 | 350 |
| 356 | 3300006881 | Ga0068865_100036197 | Ga0068865_1000361974 | 350 |
| 357 | 3300006931 | Ga0097620_100009582 | Ga0097620_1000095824 | 350 |
| 358 | 3300009098 | Ga0105245_10096856 | Ga0105245_100968562 | 350 |
| 359 | 3300009177 | Ga0105248_10107376 | Ga0105248_101073762 | 350 |
| 360 | 3300010375 | Ga0105239_10069680 | Ga0105239_100696803 | 350 |
| 361 | 3300011119 | Ga0105246_10094579 | Ga0105246_100945792 | 350 |
| 362 | 3300013296 | Ga0157374_10021413 | Ga0157374_100214132 | 350 |
| 363 | 3300013306 | Ga0163162_10017904 | Ga0163162_100179046 | 350 |
| 364 | 3300013308 | Ga0157375_10076539 | Ga0157375_100765393 | 350 |
| 365 | 3300013308 | Ga0157375_10135089 | Ga0157375_101350893 | 350 |
| 366 | 3300025898 | Ga0207692_10015804 | Ga0207692_100158043 | 350 |
| 367 | 3300025904 | Ga0207647_10025669 | Ga0207647_100256693 | 350 |
| 368 | 3300025905 | Ga0207685_10038700 | Ga0207685_100387002 | 350 |
| 369 | 3300025906 | Ga0207699_10145188 | Ga0207699_101451882 | 350 |
| 370 | 3300025915 | Ga0207693_10000632 | Ga0207693_1000063223 | 350 |
| 371 | 3300025916 | Ga0207663_10006194 | Ga0207663_100061942 | 350 |
| 372 | 3300025922 | Ga0207646_10001216 | Ga0207646_1000121611 | 350 |
| 373 | 3300025927 | Ga0207687_10146463 | Ga0207687_101464631 | 350 |
| 374 | 3300025939 | Ga0207665_10136687 | Ga0207665_101366872 | 350 |
| 375 | 3300025941 | Ga0207711_10125359 | Ga0207711_101253592 | 350 |
| 376 | 3300025942 | Ga0207689_10001515 | Ga0207689_100015156 | 350 |
| 377 | 3300026023 | Ga0207677_10008014 | Ga0207677_100080144 | 350 |
| 378 | 3300026035 | Ga0207703_10004042 | Ga0207703_100040429 | 350 |
| 379 | 3300026118 | Ga0207675_100068955 | Ga0207675_1000689552 | 350 |
| 380 | 3300030760 | Ga0265762_1002175 | Ga0265762_10021752 | 350 |
| 381 | 3300031090 | Ga0265760_10000412 | Ga0265760_100004123 | 350 |
| 382 | 3300031235 | Ga0265330_10006625 | Ga0265330_100066254 | 350 |
| 383 | 3300045976 | Ga0466967_0057364 | Ga0466967_0057364_2214_3299 | 350 |
| 384 | 3300048915 | Ga0496112_0018280 | Ga0496112_0018280_270_1355 | 350 |
| 385 | 2162886012 | MBSR1b_contig_7742423 | MBSR1b_0178.00003860 | 351 |
| 386 | 3300001976 | JGI24752J21851_1000806 | JGI24752J21851_10008062 | 351 |
| 387 | 3300001991 | JGI24743J22301_10007840 | JGI24743J22301_100078401 | 351 |
| 388 | 3300002459 | JGI24751J29686_10000991 | JGI24751J29686_100009916 | 351 |
| 389 | 3300005293 | Ga0065715_10004417 | Ga0065715_100044176 | 351 |
| 390 | 3300005328 | Ga0070676_10015163 | Ga0070676_100151633 | 351 |
| 391 | 3300005329 | Ga0070683_100001564 | Ga0070683_1000015644 | 351 |
| 392 | 3300005329 | Ga0070683_100059326 | Ga0070683_1000593262 | 351 |
| 393 | 3300005330 | Ga0070690_100014844 | Ga0070690_1000148445 | 351 |
| 394 | 3300005331 | Ga0070670_100030748 | Ga0070670_1000307483 | 351 |
| 395 | 3300005331 | Ga0070670_100229248 | Ga0070670_1002292481 | 351 |
| 396 | 3300005333 | Ga0070677_10042392 | Ga0070677_100423922 | 351 |
| 397 | 3300005334 | Ga0068869_100005664 | Ga0068869_1000056644 | 351 |
| 398 | 3300005338 | Ga0068868_100006287 | Ga0068868_1000062877 | 351 |
| 399 | 3300005338 | Ga0068868_100012075 | Ga0068868_1000120756 | 351 |
| 400 | 3300005338 | Ga0068868_100049467 | Ga0068868_1000494672 | 351 |
| 401 | 3300005339 | Ga0070660_100089814 | Ga0070660_1000898143 | 351 |
| 402 | 3300005340 | Ga0070689_100004902 | Ga0070689_1000049027 | 351 |
| 403 | 3300005344 | Ga0070661_100000794 | Ga0070661_10000079415 | 351 |
| 404 | 3300005344 | Ga0070661_100019296 | Ga0070661_1000192962 | 351 |
| 405 | 3300005347 | Ga0070668_100005232 | Ga0070668_1000052328 | 351 |
| 406 | 3300005353 | Ga0070669_100008095 | Ga0070669_1000080958 | 351 |
| 407 | 3300005354 | Ga0070675_100004164 | Ga0070675_10000416410 | 351 |
| 408 | 3300005355 | Ga0070671_100085747 | Ga0070671_1000857471 | 351 |
| 409 | 3300005356 | Ga0070674_100026924 | Ga0070674_1000269242 | 351 |
| 410 | 3300005364 | Ga0070673_100015803 | Ga0070673_1000158032 | 351 |
| 411 | 3300005365 | Ga0070688_100000826 | Ga0070688_1000008263 | 351 |
| 412 | 3300005366 | Ga0070659_100007081 | Ga0070659_1000070819 | 351 |
| 413 | 3300005367 | Ga0070667_100075732 | Ga0070667_1000757322 | 351 |
| 414 | 3300005434 | Ga0070709_10011222 | Ga0070709_100112225 | 351 |
| 415 | 3300005435 | Ga0070714_100001396 | Ga0070714_10000139615 | 351 |
| 416 | 3300005435 | Ga0070714_100004544 | Ga0070714_1000045442 | 351 |
| 417 | 3300005435 | Ga0070714_100046920 | Ga0070714_1000469203 | 351 |
| 418 | 3300005435 | Ga0070714_100108677 | Ga0070714_1001086771 | 351 |
| 419 | 3300005435 | Ga0070714_100329993 | Ga0070714_1003299931 | 351 |
| 420 | 3300005436 | Ga0070713_100002892 | Ga0070713_1000028921 | 351 |
| 421 | 3300005436 | Ga0070713_100028366 | Ga0070713_1000283664 | 351 |
| 422 | 3300005436 | Ga0070713_100035251 | Ga0070713_1000352512 | 351 |
| 423 | 3300005438 | Ga0070701_10032127 | Ga0070701_100321274 | 351 |
| 424 | 3300005439 | Ga0070711_100003134 | Ga0070711_1000031341 | 351 |
| 425 | 3300005440 | Ga0070705_100211739 | Ga0070705_1002117391 | 351 |
| 426 | 3300005445 | Ga0070708_100011801 | Ga0070708_1000118012 | 351 |
| 427 | 3300005445 | Ga0070708_100017546 | Ga0070708_1000175462 | 351 |
| 428 | 3300005445 | Ga0070708_100053262 | Ga0070708_1000532623 | 351 |
| 429 | 3300005445 | Ga0070708_100097238 | Ga0070708_1000972381 | 351 |
| 430 | 3300005455 | Ga0070663_100019711 | Ga0070663_1000197112 | 351 |
| 431 | 3300005457 | Ga0070662_100009829 | Ga0070662_1000098297 | 351 |
| 432 | 3300005457 | Ga0070662_100112456 | Ga0070662_1001124562 | 351 |
| 433 | 3300005458 | Ga0070681_10000195 | Ga0070681_1000019520 | 351 |
| 434 | 3300005459 | Ga0068867_100007106 | Ga0068867_1000071069 | 351 |
| 435 | 3300005466 | Ga0070685_10001068 | Ga0070685_1000106812 | 351 |
| 436 | 3300005467 | Ga0070706_100161115 | Ga0070706_1001611152 | 351 |
| 437 | 3300005467 | Ga0070706_100165697 | Ga0070706_1001656971 | 351 |
| 438 | 3300005468 | Ga0070707_100082477 | Ga0070707_1000824773 | 351 |
| 439 | 3300005530 | Ga0070679_100006160 | Ga0070679_1000061603 | 351 |
| 440 | 3300005530 | Ga0070679_100181924 | Ga0070679_1001819242 | 351 |
| 441 | 3300005535 | Ga0070684_100000661 | Ga0070684_10000066111 | 351 |
| 442 | 3300005535 | Ga0070684_100060589 | Ga0070684_1000605894 | 351 |
| 443 | 3300005535 | Ga0070684_100084970 | Ga0070684_1000849702 | 351 |
| 444 | 3300005535 | Ga0070684_100120526 | Ga0070684_1001205263 | 351 |
| 445 | 3300005536 | Ga0070697_100074258 | Ga0070697_1000742582 | 351 |
| 446 | 3300005539 | Ga0068853_100002656 | Ga0068853_10000265612 | 351 |
| 447 | 3300005539 | Ga0068853_100407017 | Ga0068853_1004070171 | 351 |
| 448 | 3300005543 | Ga0070672_100006357 | Ga0070672_1000063576 | 351 |
| 449 | 3300005544 | Ga0070686_100006812 | Ga0070686_1000068125 | 351 |
| 450 | 3300005563 | Ga0068855_100000978 | Ga0068855_10000097814 | 351 |
| 451 | 3300005563 | Ga0068855_100005912 | Ga0068855_1000059129 | 351 |
| 452 | 3300005563 | Ga0068855_100063262 | Ga0068855_1000632625 | 351 |
| 453 | 3300005563 | Ga0068855_100080883 | Ga0068855_1000808835 | 351 |
| 454 | 3300005564 | Ga0070664_100001252 | Ga0070664_10000125213 | 351 |
| 455 | 3300005564 | Ga0070664_100174052 | Ga0070664_1001740522 | 351 |
| 456 | 3300005577 | Ga0068857_100002090 | Ga0068857_10000209016 | 351 |
| 457 | 3300005577 | Ga0068857_100007487 | Ga0068857_10000748710 | 351 |
| 458 | 3300005578 | Ga0068854_100034529 | Ga0068854_1000345292 | 351 |
| 459 | 3300005578 | Ga0068854_100073447 | Ga0068854_1000734472 | 351 |
| 460 | 3300005614 | Ga0068856_100000107 | Ga0068856_10000010722 | 351 |
| 461 | 3300005614 | Ga0068856_100000483 | Ga0068856_1000004839 | 351 |
| 462 | 3300005614 | Ga0068856_100009826 | Ga0068856_1000098261 | 351 |
| 463 | 3300005614 | Ga0068856_100038299 | Ga0068856_1000382995 | 351 |
| 464 | 3300005614 | Ga0068856_100047585 | Ga0068856_1000475852 | 351 |
| 465 | 3300005614 | Ga0068856_100171050 | Ga0068856_1001710502 | 351 |
| 466 | 3300005614 | Ga0068856_100172329 | Ga0068856_1001723293 | 351 |
| 467 | 3300005615 | Ga0070702_100002782 | Ga0070702_1000027828 | 351 |
| 468 | 3300005616 | Ga0068852_100003925 | Ga0068852_1000039254 | 351 |
| 469 | 3300005617 | Ga0068859_100000951 | Ga0068859_1000009512 | 351 |
| 470 | 3300005618 | Ga0068864_100007554 | Ga0068864_1000075546 | 351 |
| 471 | 3300005618 | Ga0068864_100011018 | Ga0068864_1000110187 | 351 |
| 472 | 3300005618 | Ga0068864_100027359 | Ga0068864_1000273593 | 351 |
| 473 | 3300005718 | Ga0068866_10001489 | Ga0068866_100014894 | 351 |
| 474 | 3300005718 | Ga0068866_10005505 | Ga0068866_100055051 | 351 |
| 475 | 3300005719 | Ga0068861_100080384 | Ga0068861_1000803844 | 351 |
| 476 | 3300005840 | Ga0068870_10000594 | Ga0068870_100005946 | 351 |
| 477 | 3300005841 | Ga0068863_100008718 | Ga0068863_1000087183 | 351 |
| 478 | 3300005841 | Ga0068863_100012494 | Ga0068863_1000124946 | 351 |
| 479 | 3300005841 | Ga0068863_100075760 | Ga0068863_1000757603 | 351 |
| 480 | 3300005842 | Ga0068858_100002793 | Ga0068858_1000027935 | 351 |
| 481 | 3300005842 | Ga0068858_100004335 | Ga0068858_1000043359 | 351 |
| 482 | 3300005843 | Ga0068860_100004530 | Ga0068860_1000045305 | 351 |
| 483 | 3300005843 | Ga0068860_100182026 | Ga0068860_1001820262 | 351 |
| 484 | 3300005843 | Ga0068860_100347819 | Ga0068860_1003478191 | 351 |
| 485 | 3300005844 | Ga0068862_100010269 | Ga0068862_1000102697 | 351 |
| 486 | 3300006028 | Ga0070717_10000383 | Ga0070717_1000038310 | 351 |
| 487 | 3300006028 | Ga0070717_10151883 | Ga0070717_101518832 | 351 |
| 488 | 3300006028 | Ga0070717_10180131 | Ga0070717_101801312 | 351 |
| 489 | 3300006163 | Ga0070715_10043444 | Ga0070715_100434442 | 351 |
| 490 | 3300006173 | Ga0070716_100000278 | Ga0070716_10000027815 | 351 |
| 491 | 3300006173 | Ga0070716_100010295 | Ga0070716_1000102955 | 351 |
| 492 | 3300006175 | Ga0070712_100001997 | Ga0070712_10000199710 | 351 |
| 493 | 3300006175 | Ga0070712_100109397 | Ga0070712_1001093972 | 351 |
| 494 | 3300006175 | Ga0070712_100136165 | Ga0070712_1001361651 | 351 |
| 495 | 3300006237 | Ga0097621_100000223 | Ga0097621_1000002232 | 351 |
| 496 | 3300006237 | Ga0097621_100003554 | Ga0097621_1000035543 | 351 |
| 497 | 3300006237 | Ga0097621_100006566 | Ga0097621_1000065664 | 351 |
| 498 | 3300006237 | Ga0097621_100023835 | Ga0097621_1000238353 | 351 |
| 499 | 3300006358 | Ga0068871_100000410 | Ga0068871_10000041018 | 351 |
| 500 | 3300006358 | Ga0068871_100024200 | Ga0068871_1000242002 | 351 |
| 501 | 3300006358 | Ga0068871_100029703 | Ga0068871_1000297032 | 351 |
| 502 | 3300006358 | Ga0068871_100098226 | Ga0068871_1000982262 | 351 |
| 503 | 3300006881 | Ga0068865_100005068 | Ga0068865_1000050688 | 351 |
| 504 | 3300006881 | Ga0068865_100019589 | Ga0068865_1000195892 | 351 |
| 505 | 3300006914 | Ga0075436_100000709 | Ga0075436_10000070916 | 351 |
| 506 | 3300006931 | Ga0097620_100000951 | Ga0097620_10000095126 | 351 |
| 507 | 3300007076 | Ga0075435_100000841 | Ga0075435_1000008418 | 351 |
| 508 | 3300007076 | Ga0075435_100092912 | Ga0075435_1000929122 | 351 |
| 509 | 3300009011 | Ga0105251_10110807 | Ga0105251_101108071 | 351 |
| 510 | 3300009093 | Ga0105240_10002618 | Ga0105240_1000261815 | 351 |
| 511 | 3300009093 | Ga0105240_10153216 | Ga0105240_101532161 | 351 |
| 512 | 3300009093 | Ga0105240_10154251 | Ga0105240_101542513 | 351 |
| 513 | 3300009093 | Ga0105240_10205581 | Ga0105240_102055811 | 351 |
| 514 | 3300009098 | Ga0105245_10002658 | Ga0105245_1000265812 | 351 |
| 515 | 3300009101 | Ga0105247_10057598 | Ga0105247_100575983 | 351 |
| 516 | 3300009174 | Ga0105241_10021699 | Ga0105241_100216995 | 351 |
| 517 | 3300009174 | Ga0105241_10055135 | Ga0105241_100551352 | 351 |
| 518 | 3300009176 | Ga0105242_10025528 | Ga0105242_100255282 | 351 |
| 519 | 3300009177 | Ga0105248_10003183 | Ga0105248_100031835 | 351 |
| 520 | 3300009177 | Ga0105248_10016820 | Ga0105248_100168208 | 351 |
| 521 | 3300009545 | Ga0105237_10019545 | Ga0105237_100195456 | 351 |
| 522 | 3300009545 | Ga0105237_10021096 | Ga0105237_100210965 | 351 |
| 523 | 3300009551 | Ga0105238_10000090 | Ga0105238_1000009064 | 351 |
| 524 | 3300009551 | Ga0105238_10103373 | Ga0105238_101033732 | 351 |
| 525 | 3300009553 | Ga0105249_10015904 | Ga0105249_100159045 | 351 |
| 526 | 3300010375 | Ga0105239_10015829 | Ga0105239_100158292 | 351 |
| 527 | 3300010375 | Ga0105239_10025239 | Ga0105239_100252394 | 351 |
| 528 | 3300010375 | Ga0105239_10094539 | Ga0105239_100945393 | 351 |
| 529 | 3300011119 | Ga0105246_10000592 | Ga0105246_1000059212 | 351 |
| 530 | 3300013100 | Ga0157373_10005921 | Ga0157373_100059213 | 351 |
| 531 | 3300013100 | Ga0157373_10079568 | Ga0157373_100795682 | 351 |
| 532 | 3300013102 | Ga0157371_10053241 | Ga0157371_100532414 | 351 |
| 533 | 3300013102 | Ga0157371_10070345 | Ga0157371_100703452 | 351 |
| 534 | 3300013102 | Ga0157371_10110626 | Ga0157371_101106262 | 351 |
| 535 | 3300013104 | Ga0157370_10062916 | Ga0157370_100629161 | 351 |
| 536 | 3300013105 | Ga0157369_10005632 | Ga0157369_100056326 | 351 |
| 537 | 3300013105 | Ga0157369_10013615 | Ga0157369_100136152 | 351 |
| 538 | 3300013105 | Ga0157369_10027601 | Ga0157369_100276012 | 351 |
| 539 | 3300013105 | Ga0157369_10046582 | Ga0157369_100465824 | 351 |
| 540 | 3300013105 | Ga0157369_10108666 | Ga0157369_101086663 | 351 |
| 541 | 3300013296 | Ga0157374_10000097 | Ga0157374_100000973 | 351 |
| 542 | 3300013296 | Ga0157374_10000305 | Ga0157374_1000030520 | 351 |
| 543 | 3300013296 | Ga0157374_10022194 | Ga0157374_100221945 | 351 |
| 544 | 3300013297 | Ga0157378_10000265 | Ga0157378_1000026533 | 351 |
| 545 | 3300013297 | Ga0157378_10001362 | Ga0157378_1000136217 | 351 |
| 546 | 3300013297 | Ga0157378_10045833 | Ga0157378_100458332 | 351 |
| 547 | 3300013306 | Ga0163162_10091176 | Ga0163162_100911762 | 351 |
| 548 | 3300013307 | Ga0157372_10000766 | Ga0157372_100007668 | 351 |
| 549 | 3300013307 | Ga0157372_10001033 | Ga0157372_1000103317 | 351 |
| 550 | 3300013307 | Ga0157372_10007887 | Ga0157372_100078878 | 351 |
| 551 | 3300013307 | Ga0157372_10008029 | Ga0157372_100080295 | 351 |
| 552 | 3300013307 | Ga0157372_10008514 | Ga0157372_100085147 | 351 |
| 553 | 3300013307 | Ga0157372_10010175 | Ga0157372_100101757 | 351 |
| 554 | 3300013307 | Ga0157372_10070516 | Ga0157372_100705163 | 351 |
| 555 | 3300013307 | Ga0157372_10335318 | Ga0157372_103353182 | 351 |
| 556 | 3300013308 | Ga0157375_10027623 | Ga0157375_100276236 | 351 |
| 557 | 3300013308 | Ga0157375_10231066 | Ga0157375_102310662 | 351 |
| 558 | 3300014325 | Ga0163163_10001245 | Ga0163163_100012454 | 351 |
| 559 | 3300014326 | Ga0157380_10133793 | Ga0157380_101337932 | 351 |
| 560 | 3300014745 | Ga0157377_10000498 | Ga0157377_100004987 | 351 |
| 561 | 3300014968 | Ga0157379_10011871 | Ga0157379_100118716 | 351 |
| 562 | 3300014969 | Ga0157376_10025960 | Ga0157376_100259602 | 351 |
| 563 | 3300014969 | Ga0157376_10050739 | Ga0157376_100507391 | 351 |
| 564 | 3300014969 | Ga0157376_10119192 | Ga0157376_101191922 | 351 |
| 565 | 3300025321 | Ga0207656_10005808 | Ga0207656_100058085 | 351 |
| 566 | 3300025898 | Ga0207692_10015012 | Ga0207692_100150123 | 351 |
| 567 | 3300025899 | Ga0207642_10004132 | Ga0207642_100041324 | 351 |
| 568 | 3300025900 | Ga0207710_10016177 | Ga0207710_100161772 | 351 |
| 569 | 3300025901 | Ga0207688_10006592 | Ga0207688_100065927 | 351 |
| 570 | 3300025903 | Ga0207680_10006132 | Ga0207680_100061326 | 351 |
| 571 | 3300025904 | Ga0207647_10000432 | Ga0207647_1000043222 | 351 |
| 572 | 3300025907 | Ga0207645_10001148 | Ga0207645_1000114812 | 351 |
| 573 | 3300025908 | Ga0207643_10000501 | Ga0207643_1000050125 | 351 |
| 574 | 3300025912 | Ga0207707_10001239 | Ga0207707_1000123920 | 351 |
| 575 | 3300025913 | Ga0207695_10013360 | Ga0207695_100133602 | 351 |
| 576 | 3300025913 | Ga0207695_10028837 | Ga0207695_100288375 | 351 |
| 577 | 3300025913 | Ga0207695_10035284 | Ga0207695_100352844 | 351 |
| 578 | 3300025913 | Ga0207695_10357000 | Ga0207695_103570001 | 351 |
| 579 | 3300025914 | Ga0207671_10020714 | Ga0207671_100207145 | 351 |
| 580 | 3300025915 | Ga0207693_10003987 | Ga0207693_100039876 | 351 |
| 581 | 3300025915 | Ga0207693_10021582 | Ga0207693_100215826 | 351 |
| 582 | 3300025915 | Ga0207693_10129903 | Ga0207693_101299032 | 351 |
| 583 | 3300025916 | Ga0207663_10005352 | Ga0207663_100053522 | 351 |
| 584 | 3300025916 | Ga0207663_10138961 | Ga0207663_101389612 | 351 |
| 585 | 3300025916 | Ga0207663_10273423 | Ga0207663_102734231 | 351 |
| 586 | 3300025919 | Ga0207657_10002323 | Ga0207657_1000232312 | 351 |
| 587 | 3300025920 | Ga0207649_10000374 | Ga0207649_1000037420 | 351 |
| 588 | 3300025920 | Ga0207649_10012634 | Ga0207649_100126345 | 351 |
| 589 | 3300025921 | Ga0207652_10006549 | Ga0207652_1000654910 | 351 |
| 590 | 3300025923 | Ga0207681_10080422 | Ga0207681_100804222 | 351 |
| 591 | 3300025924 | Ga0207694_10057257 | Ga0207694_100572572 | 351 |
| 592 | 3300025924 | Ga0207694_10109623 | Ga0207694_101096233 | 351 |
| 593 | 3300025925 | Ga0207650_10000045 | Ga0207650_10000045111 | 351 |
| 594 | 3300025927 | Ga0207687_10032039 | Ga0207687_100320394 | 351 |
| 595 | 3300025928 | Ga0207700_10015826 | Ga0207700_100158263 | 351 |
| 596 | 3300025928 | Ga0207700_10046447 | Ga0207700_100464472 | 351 |
| 597 | 3300025928 | Ga0207700_10076706 | Ga0207700_100767062 | 351 |
| 598 | 3300025928 | Ga0207700_10135212 | Ga0207700_101352122 | 351 |
| 599 | 3300025929 | Ga0207664_10180546 | Ga0207664_101805462 | 351 |
| 600 | 3300025929 | Ga0207664_10344274 | Ga0207664_103442741 | 351 |
| 601 | 3300025931 | Ga0207644_10011926 | Ga0207644_100119266 | 351 |
| 602 | 3300025931 | Ga0207644_10261101 | Ga0207644_102611012 | 351 |
| 603 | 3300025932 | Ga0207690_10059893 | Ga0207690_100598931 | 351 |
| 604 | 3300025933 | Ga0207706_10000414 | Ga0207706_1000041432 | 351 |
| 605 | 3300025936 | Ga0207670_10002157 | Ga0207670_100021572 | 351 |
| 606 | 3300025937 | Ga0207669_10019116 | Ga0207669_100191163 | 351 |
| 607 | 3300025938 | Ga0207704_10006107 | Ga0207704_100061076 | 351 |
| 608 | 3300025938 | Ga0207704_10027858 | Ga0207704_100278582 | 351 |
| 609 | 3300025939 | Ga0207665_10000046 | Ga0207665_100000467 | 351 |
| 610 | 3300025939 | Ga0207665_10022159 | Ga0207665_100221592 | 351 |
| 611 | 3300025940 | Ga0207691_10000151 | Ga0207691_1000015142 | 351 |
| 612 | 3300025941 | Ga0207711_10013585 | Ga0207711_100135854 | 351 |
| 613 | 3300025942 | Ga0207689_10000129 | Ga0207689_1000012939 | 351 |
| 614 | 3300025942 | Ga0207689_10011670 | Ga0207689_100116706 | 351 |
| 615 | 3300025944 | Ga0207661_10000099 | Ga0207661_1000009940 | 351 |
| 616 | 3300025945 | Ga0207679_10000096 | Ga0207679_1000009654 | 351 |
| 617 | 3300025945 | Ga0207679_10030308 | Ga0207679_100303083 | 351 |
| 618 | 3300025949 | Ga0207667_10001904 | Ga0207667_1000190421 | 351 |
| 619 | 3300025949 | Ga0207667_10008001 | Ga0207667_100080019 | 351 |
| 620 | 3300025949 | Ga0207667_10064454 | Ga0207667_100644544 | 351 |
| 621 | 3300025960 | Ga0207651_10022946 | Ga0207651_100229464 | 351 |
| 622 | 3300025960 | Ga0207651_10265108 | Ga0207651_102651082 | 351 |
| 623 | 3300025972 | Ga0207668_10057817 | Ga0207668_100578172 | 351 |
| 624 | 3300025981 | Ga0207640_10025561 | Ga0207640_100255612 | 351 |
| 625 | 3300025981 | Ga0207640_10049622 | Ga0207640_100496222 | 351 |
| 626 | 3300025986 | Ga0207658_10009251 | Ga0207658_100092516 | 351 |
| 627 | 3300026023 | Ga0207677_10007414 | Ga0207677_100074142 | 351 |
| 628 | 3300026023 | Ga0207677_10034353 | Ga0207677_100343532 | 351 |
| 629 | 3300026023 | Ga0207677_10060379 | Ga0207677_100603792 | 351 |
| 630 | 3300026035 | Ga0207703_10011851 | Ga0207703_100118514 | 351 |
| 631 | 3300026035 | Ga0207703_10033153 | Ga0207703_100331532 | 351 |
| 632 | 3300026067 | Ga0207678_10000026 | Ga0207678_1000002637 | 351 |
| 633 | 3300026078 | Ga0207702_10000103 | Ga0207702_1000010360 | 351 |
| 634 | 3300026078 | Ga0207702_10006399 | Ga0207702_100063997 | 351 |
| 635 | 3300026078 | Ga0207702_10043743 | Ga0207702_100437433 | 351 |
| 636 | 3300026078 | Ga0207702_10059342 | Ga0207702_100593423 | 351 |
| 637 | 3300026078 | Ga0207702_10132350 | Ga0207702_101323502 | 351 |
| 638 | 3300026088 | Ga0207641_10000075 | Ga0207641_10000075111 | 351 |
| 639 | 3300026088 | Ga0207641_10031544 | Ga0207641_100315443 | 351 |
| 640 | 3300026088 | Ga0207641_10034491 | Ga0207641_100344913 | 351 |
| 641 | 3300026089 | Ga0207648_10002645 | Ga0207648_1000264510 | 351 |
| 642 | 3300026095 | Ga0207676_10000096 | Ga0207676_1000009660 | 351 |
| 643 | 3300026095 | Ga0207676_10001149 | Ga0207676_1000114913 | 351 |
| 644 | 3300026116 | Ga0207674_10000246 | Ga0207674_1000024660 | 351 |
| 645 | 3300026116 | Ga0207674_10004470 | Ga0207674_1000447016 | 351 |
| 646 | 3300026118 | Ga0207675_100009570 | Ga0207675_1000095709 | 351 |
| 647 | 3300026121 | Ga0207683_10000259 | Ga0207683_100002597 | 351 |
| 648 | 3300026142 | Ga0207698_10039929 | Ga0207698_100399294 | 351 |
| 649 | 3300026142 | Ga0207698_10097903 | Ga0207698_100979032 | 351 |
| 650 | 3300028379 | Ga0268266_10001241 | Ga0268266_1000124121 | 351 |
| 651 | 3300028380 | Ga0268265_10008564 | Ga0268265_100085642 | 351 |
| 652 | 3300028381 | Ga0268264_10013181 | Ga0268264_100131816 | 351 |
| 653 | 3300028381 | Ga0268264_10044707 | Ga0268264_100447073 | 351 |
| 654 | 3300033547 | Ga0316212_1004220 | Ga0316212_10042202 | 351 |
| 655 | 3300035171 | Ga0373946_0056736 | Ga0373946_0056736_285_1382 | 351 |
| 656 | 3300035692 | Ga0373935_0063007 | Ga0373935_0063007_839_1936 | 351 |
| 657 | 3300035695 | Ga0373927_0010643 | Ga0373927_0010643_2089_3177 | 351 |
| 658 | 3300035725 | Ga0373947_0070320 | Ga0373947_0070320_300_1388 | 351 |
| 659 | 3300036401 | Ga0373937_0104456 | Ga0373937_0104456_319_1413 | 351 |
| 660 | 3300037068 | Ga0373925_0207539 | Ga0373925_0207539_196_1284 | 351 |
| 661 | 3300037853 | Ga0436364_1358914 | Ga0436364_1358914_892_1980 | 351 |
| 662 | 3300039450 | Ga0436363_1412803 | Ga0436363_1412803_49_1137 | 351 |
| 663 | 3300045051 | Ga0451576_0297943 | Ga0451576_0297943_191_1282 | 351 |
| 664 | 3300046472 | Ga0495580_0001097 | Ga0495580_0001097_20624_21712 | 351 |
| 665 | 3300046472 | Ga0495580_0003312 | Ga0495580_0003312_2911_3999 | 351 |
| 666 | 3300046472 | Ga0495580_0004680 | Ga0495580_0004680_6922_8010 | 351 |
| 667 | 3300046472 | Ga0495580_0005828 | Ga0495580_0005828_8064_9152 | 351 |
| 668 | 3300046472 | Ga0495580_0053703 | Ga0495580_0053703_149_1237 | 351 |
| 669 | 3300046472 | Ga0495580_0090174 | Ga0495580_0090174_1025_2113 | 351 |
| 670 | 3300046473 | Ga0495582_0000452 | Ga0495582_0000452_20705_21793 | 351 |
| 671 | 3300046475 | Ga0495639_0140951 | Ga0495639_0140951_10_1098 | 351 |
| 672 | 3300046531 | Ga0495665_0067813 | Ga0495665_0067813_267_1355 | 351 |
| 673 | 3300046690 | Ga0495624_0125426 | Ga0495624_0125426_415_1503 | 351 |
| 674 | 3300047319 | Ga0495674_0088526 | Ga0495674_0088526_987_2075 | 351 |
| 675 | 3300048905 | Ga0496102_0090484 | Ga0496102_0090484_1060_2115 | 351 |
| 676 | 3300048907 | Ga0496104_0089467 | Ga0496104_0089467_883_1974 | 351 |
| 677 | 3300048907 | Ga0496104_0115822 | Ga0496104_0115822_1456_2544 | 351 |
| 678 | 3300048909 | Ga0496106_0131711 | Ga0496106_0131711_117_1172 | 351 |
| 679 | 3300048911 | Ga0496108_0000943 | Ga0496108_0000943_18855_19910 | 351 |
| 680 | 3300048912 | Ga0496109_0000132 | Ga0496109_0000132_38713_39768 | 351 |
| 681 | 3300048913 | Ga0496110_0031229 | Ga0496110_0031229_696_1751 | 351 |
| 682 | 3300048914 | Ga0496111_0016861 | Ga0496111_0016861_3378_4433 | 351 |
| 683 | 3300048915 | Ga0496112_0000448 | Ga0496112_0000448_8007_9062 | 351 |
| 684 | 3300048915 | Ga0496112_0031902 | Ga0496112_0031902_1835_2893 | 351 |
| 685 | 3300048915 | Ga0496112_0043755 | Ga0496112_0043755_1213_2304 | 351 |
| 686 | 3300048915 | Ga0496112_0214754 | Ga0496112_0214754_359_1450 | 351 |
| 687 | 3300048916 | Ga0496113_0004662 | Ga0496113_0004662_1212_2267 | 351 |
| 688 | 3300048918 | Ga0496115_0057219 | Ga0496115_0057219_1995_3050 | 351 |
| 689 | 3300048918 | Ga0496115_0100932 | Ga0496115_0100932_684_1775 | 351 |
| 690 | 3300050512 | nmdc:mga0n895_20822_c1 | nmdc:mga0n895_20822_c1_4894_5988 | 351 |
| 691 | 3300050513 | nmdc:mga0rr50_46417_c1 | nmdc:mga0rr50_46417_c1_1239_2333 | 351 |
| 692 | 3300050513 | nmdc:mga0rr50_4659_c1 | nmdc:mga0rr50_4659_c1_6950_8038 | 351 |
| 693 | 3300050514 | nmdc:mga08x19_8404_c1 | nmdc:mga08x19_8404_c1_4862_5950 | 351 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7nb6-assembly1.cif.gz_A | structure of the autoinducer-2 exporter tqsa from e. coli | 0.6647 | 3 | 322 |
| 7nb6-assembly1.cif.gz_A | structure of the autoinducer-2 exporter tqsa from e. coli | 0.6163 | 3 | 322 |
| 7ot9-assembly1.cif.gz_A | structure of the ai-2 exporter family protein ydik from e. coli | 0.5054 | 3 | 350 |
| 7ot9-assembly1.cif.gz_A | structure of the ai-2 exporter family protein ydik from e. coli | 0.4864 | 3 | 350 |
| 7sq7-assembly1.cif.gz_A | cryo-em structure of mouse pi(3,5)p2-bound trpml1 channel at 2.41 angstrom resolution | 0.28 | 48 | 282 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7MU65_40_256_1.20.1260.10 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.3063 | 18 | 243 | 1.20.1260.10 |
| af_K7MU65_40_256_1.20.1260.10 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.3034 | 18 | 243 | 1.20.1260.10 |
| af_O60635_1_114_1.20.5.780 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Single helix bin | 0.2507 | 176 | 280 | 1.20.5.780 |
| af_Q9VXV4_145_431_1.20.1530.20 | Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; | 0.2477 | 14 | 257 | 1.20.1530.20 |
| af_O60635_1_114_1.20.5.780 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Single helix bin | 0.247 | 176 | 280 | 1.20.5.780 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9WA03-F1-model_v4 | AI-2E family transporter | 0.9479 | 2 | 259 |
GO:0016020
GO:0055085 |
| AF-A0A2V9SAT9-F1-model_v4 | AI-2E family transporter | 0.9141 | 2 | 326 |
GO:0005886
GO:0055085 |
| AF-A0A2V9TNG1-F1-model_v4 | AI-2E family transporter | 0.9058 | 2 | 351 |
GO:0016020
GO:0055085 |
| AF-A0A2V9DNH4-F1-model_v4 | AI-2E family transporter | 0.9042 | 2 | 331 |
GO:0005886
GO:0055085 |
| AF-A0A2V9TNG1-F1-model_v4 | AI-2E family transporter | 0.9009 | 2 | 351 |
GO:0016020
GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar