F475438

General Info

Members Datasets Scaffolds Average Seq Length
690 531 413 327

Family's Representative Sequence

Representative Sequence 3300006186|Ga0075369_10002867|Ga0075369_100028675
Length 364
Sequence MARLAHMLKATPRTRRMEILEAAFGSRFGRPTSSVRPKSRLAKGVGVACLFFGAAIAGGSSGALAAGIPSWLMTYVGEGQGQIALPVLQRARALYIQKASQGAVSNPCYFAMDATRPNDPGSSGGRFYIICESQHSFRAISAGHGGGRNLRGVADFSNGRRCARHFGNAQDSELTTGGSYVTAETKTSFKGYYRVAANQDAAFLRSFIQFDGVGETANARQRAIGGHAAVALKGVCLRKAPSSPYANQDGYVPFGKLVDYAGGRSNGCTSWSLGDVKQILSMVRDYPTTLYIYPEAADVSNVARAVAAGQSPARAGLYWNAACLREIGAPKYWSRQVLEPVLAQYKLDHPAPPPRPTPICEGSE

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
4 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
5 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
6 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
7 2512875024 Mesorhizobium loti R88b Isolate Nodule
8 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
9 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
10 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
11 2519899620 Rhizobium sp. Pop5 Isolate Nodule
12 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
13 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
14 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
15 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
16 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
17 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
18 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
19 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
20 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
21 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
22 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
23 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
24 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
25 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
26 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
27 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
28 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
29 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
30 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
31 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
32 2718217882 Rhizobium sp. N741 Isolate Nodule
33 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
34 2718218009 Rhizobium sp. N561 Isolate Nodule
35 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
36 2718218363 Rhizobium sp. N113 Isolate Nodule
37 2718218365 Rhizobium sp. N731 Isolate Nodule
38 2718218366 Rhizobium sp. N621 Isolate Nodule
39 2721755514 Rhizobium sp. N6212 Isolate Nodule
40 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
41 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
42 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
43 2721755810 Rhizobium sp. N871 Isolate Nodule
44 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
45 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
46 2728369365 Rhizobium sp. N1341 Isolate Nodule
47 2728369397 Rhizobium sp. N1314 Isolate Nodule
48 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
49 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
50 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
51 2791355260 Rhizobium sp. L9 Isolate Nodule
52 2791355265 Rhizobium sp. H4 Isolate Nodule
53 2791355267 Rhizobium sp. L18 Isolate Nodule
54 2802429633 Rhizobium anhuiense J3 Isolate Nodule
55 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
56 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
57 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
58 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
59 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
60 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
61 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
62 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
63 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
64 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
65 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
66 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
67 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
68 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
69 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
70 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
71 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
72 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
73 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
74 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
75 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
76 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
77 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
78 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
79 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
80 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
81 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
82 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
83 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
84 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
85 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
86 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
87 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
88 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
89 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
90 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
91 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
92 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
93 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
94 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
95 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
96 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
97 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
98 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
99 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
100 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
101 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
102 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
103 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
104 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
105 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
106 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
107 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
108 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
109 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
110 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
111 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
112 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
113 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
114 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
115 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
116 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
117 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
118 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
119 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
120 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
121 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
122 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
123 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
124 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
125 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
126 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
127 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
128 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
129 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
130 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
131 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
132 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
133 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
134 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
135 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
136 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
137 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
138 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
139 2909042592 Labrys sp. LIt4 Isolate Nodule
140 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
141 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
142 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
143 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
144 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
145 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
146 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
147 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
148 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
149 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
150 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
151 2936381700 Rhizobium chutanense C16 Isolate Unclassified
152 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
153 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
154 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
155 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
156 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
157 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
158 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
159 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
160 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
161 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
162 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
163 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
164 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
165 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
166 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
167 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
168 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
169 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
170 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
171 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
172 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
173 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
174 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
175 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
176 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
177 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
178 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
179 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
180 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
181 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
182 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
183 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
184 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
185 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
186 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
187 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
188 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
189 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
190 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
191 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
192 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
193 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
194 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
195 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
196 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
197 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
198 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
199 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
200 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
201 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
202 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
203 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
204 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
205 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
206 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
207 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
208 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
209 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
210 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
211 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
212 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
213 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
214 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
215 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
216 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
217 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
218 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
219 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
220 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
221 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
222 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
223 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
224 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
225 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
226 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
227 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
228 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
229 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
230 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
231 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
232 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
233 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
234 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
235 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
236 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
237 2996893221 Rhizobium sp. R635 Isolate Nodule
238 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
239 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
240 3004167301 Mesorhizobium loti 582 Isolate Unclassified
241 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
242 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
243 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
244 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
245 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
246 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
247 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
248 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
249 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
250 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
251 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
252 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
253 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
254 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
255 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
256 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
257 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
258 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
259 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
260 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
261 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
262 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
263 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
264 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
265 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
266 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
267 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
268 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
269 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
270 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
271 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
272 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
273 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
274 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
275 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
276 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
277 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
278 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
279 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
280 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
281 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
282 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
283 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
284 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
285 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
286 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
287 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
288 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
289 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
290 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
291 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
292 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
293 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
294 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
295 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
296 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
297 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
298 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
299 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
300 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
301 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
302 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
303 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
304 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
305 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
306 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
307 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
308 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
309 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
310 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
311 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
312 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
313 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
314 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
315 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
316 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
317 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
318 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
319 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
320 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
321 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
322 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
323 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
324 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
325 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
326 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
327 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
328 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
329 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
330 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
331 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
332 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
333 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
334 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
335 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
336 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
337 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
338 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
339 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
340 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
341 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
342 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
343 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
344 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
362 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
368 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
369 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
370 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
371 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
372 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
373 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
375 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
376 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
377 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
378 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
379 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
380 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
381 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
382 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
383 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
384 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
385 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
386 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
387 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
388 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
389 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
390 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
391 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
392 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
393 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
394 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
395 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
396 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
397 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
398 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
399 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
400 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
401 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
402 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
403 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
404 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
405 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
406 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
407 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
408 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
409 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
410 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
411 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
412 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
413 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
414 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
415 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
416 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
417 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
418 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
419 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
420 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
421 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
422 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
423 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
424 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
425 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
426 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
427 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
428 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
429 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
430 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
431 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
432 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
433 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
434 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
435 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
436 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
437 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
438 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
439 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
440 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
441 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
442 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
443 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
444 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
445 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
446 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
447 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
448 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
449 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
450 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
451 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
452 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
453 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
454 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
455 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
456 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
457 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
458 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
459 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
460 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
461 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
462 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
463 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
464 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
465 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
466 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
467 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
468 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
469 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
470 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
471 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
472 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
473 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
474 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
475 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
476 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
477 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
478 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
479 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
480 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
481 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
482 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
483 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
484 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
485 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
486 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
487 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
488 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
489 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
490 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
491 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
492 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
493 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
494 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
495 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
496 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
497 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
498 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
499 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
500 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
501 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
502 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
503 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
504 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
505 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
506 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
507 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
508 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
509 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
510 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
511 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
512 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
513 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
514 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
515 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
516 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
517 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
518 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
519 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
520 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
521 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
522 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
523 8005382845 Rhizobium sp. R634 Isolate Nodule
524 8005395548 Rhizobium sp. R339 Isolate Nodule
525 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
526 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
527 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
528 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
529 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
530 8018176218 Rhizobium sp. N122 Isolate Nodule
531 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 59.86
Metatranscriptomes 0
Isolates 40.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.86
Nodule 34.93
Rhizoplane 6.38
Rhizosphere 38.41
Stem 0
Stem Tuber 0
Unclassified 10.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10057478 3300002067 Bacteria 1119
2 JGI25155J39150_1000183 3300002704 Bacteria 26908
3 JGI25156J39149_1000405 3300002705 Bacteria 27011
4 JGI25156J39149_1008154 3300002705 Bacteria 2667
5 JGI25162J39368_1000111 3300002737 Bacteria 89317
6 JGI25154J39366_1000342 3300002738 Bacteria 26841
7 JGI25157J39369_1000437 3300002741 Bacteria 27009
8 JGI25157J39369_1000667 3300002741 Bacteria 18873
9 JGI25150J39212_1000028 3300002774 Bacteria 105831
10 JGI25151J46595_10000123 3300003187 Bacteria 105339
11 JGI25151J46595_10000582 3300003187 Bacteria 32553
12 JGI25165J46597_1000006 3300003214 Bacteria 529784
13 JGI25165J46597_1000018 3300003214 Bacteria 374701
14 JGI25165J46597_1000440 3300003214 Bacteria 41868
15 rootL2_10017530 3300003322 Bacteria 26451
16 rootH1_10007065 3300003323 Bacteria 26406
17 rootH1_10102124 3300003323 Bacteria 4348
18 JGI25160J50197_1000095 3300003354 Bacteria 88326
19 JGI25161J50226_1000071 3300003374 Bacteria 88326
20 Ga0055542_1000675 3300003762 Bacteria 27508
21 Ga0055529_1002284 3300003763 Bacteria 3859
22 Ga0055526_1012112 3300003771 Bacteria 3799
23 Ga0055528_1000266 3300003790 Bacteria 44336
24 Ga0055543_1000250 3300004625 Bacteria 40740
25 Ga0065165_1000408 3300005262 Bacteria 68789
26 Ga0070670_100017672 3300005331 Bacteria 6119
27 Ga0070688_100013794 3300005365 Bacteria 4568
28 Ga0070688_100130504 3300005365 Bacteria 1695
29 Ga0070659_100003500 3300005366 Bacteria 11180
30 Ga0070663_100014193 3300005455 Bacteria 5107
31 Ga0070678_100131626 3300005456 Bacteria 1988
32 Ga0070662_100002562 3300005457 Bacteria 11193
33 Ga0070662_100130501 3300005457 Unclassified 1937
34 Ga0070697_100235397 3300005536 Bacteria 1563
35 Ga0068853_100006123 3300005539 Bacteria 9526
36 Ga0068853_100521709 3300005539 Bacteria 1123
37 Ga0070695_100337804 3300005545 Bacteria 1125
38 Ga0070696_100280550 3300005546 Bacteria 1270
39 Ga0070665_100013224 3300005548 Bacteria 8314
40 Ga0070665_100117858 3300005548 Bacteria 2658
41 Ga0070665_100182921 3300005548 Bacteria 2096
42 Ga0070704_100023332 3300005549 Bacteria 4039
43 Ga0068857_100023552 3300005577 Bacteria 5421
44 Ga0068857_100168348 3300005577 Bacteria 1991
45 Ga0068854_100043279 3300005578 Bacteria 3191
46 Ga0068856_100008489 3300005614 Bacteria 9991
47 Ga0068856_100123122 3300005614 Bacteria 2596
48 Ga0068856_100239981 3300005614 Bacteria 1828
49 Ga0068856_100248267 3300005614 Bacteria 1795
50 Ga0068851_10071177 3300005834 Bacteria 1799
51 Ga0068858_100132096 3300005842 Bacteria 2342
52 Ga0068858_100479678 3300005842 Bacteria 1200
53 Ga0081455_10004397 3300005937 Bacteria 15843
54 Ga0081455_10048374 3300005937 Bacteria 3675
55 Ga0081455_10279987 3300005937 Bacteria 1205
56 Ga0081540_1012683 3300005983 Bacteria 5529
57 Ga0070717_10035625 3300006028 Bacteria 4031
58 Ga0075368_10026371 3300006042 Bacteria 2235
59 Ga0075364_10043782 3300006051 Bacteria 2911
60 Ga0070712_100005373 3300006175 Bacteria 7933
61 Ga0070712_100145639 3300006175 Bacteria 1813
62 Ga0075362_10020877 3300006177 Bacteria 2740
63 Ga0075362_10145230 3300006177 Bacteria 1135
64 Ga0075367_10102900 3300006178 Bacteria 1747
65 Ga0075367_10124175 3300006178 Bacteria 1592
66 Ga0075369_10002867 3300006186 Bacteria 6216
67 Ga0075370_10020400 3300006353 Bacteria 3622
68 Ga0075428_100045321 3300006844 Bacteria 4832
69 Ga0075431_100144562 3300006847 Bacteria 2451
70 Ga0075433_10003583 3300006852 Bacteria 11991
71 Ga0075434_100003765 3300006871 Bacteria 13550
72 Ga0075436_100021371 3300006914 Bacteria 4443
73 Ga0099825_1026238 3300006941 Bacteria 3128
74 Ga0099822_1008884 3300006943 Bacteria 12777
75 Ga0099822_1036162 3300006943 Bacteria 3126
76 Ga0075435_100007194 3300007076 Bacteria 7915
77 Ga0105251_10077404 3300009011 Bacteria 1542
78 Ga0105240_10244742 3300009093 Bacteria 2077
79 Ga0111539_10052616 3300009094 Bacteria 4848
80 Ga0105247_10012304 3300009101 Bacteria 5140
81 Ga0105247_10024565 3300009101 Bacteria 3632
82 Ga0114129_10019913 3300009147 Bacteria 9550
83 Ga0105241_10038836 3300009174 Bacteria 3589
84 Ga0105241_10056102 3300009174 Bacteria 3020
85 Ga0105242_10009636 3300009176 Bacteria 7402
86 Ga0105242_10243320 3300009176 Bacteria 1618
87 Ga0105237_10012127 3300009545 Bacteria 9094
88 Ga0105237_10197811 3300009545 Bacteria 2009
89 Ga0105249_10103373 3300009553 Bacteria 2683
90 Ga0123342_1019876 3300009766 Bacteria 5024
91 Ga0105239_10040094 3300010375 Bacteria 5130
92 Ga0105239_10100974 3300010375 Bacteria 3192
93 Ga0105239_10216133 3300010375 Bacteria 2149
94 Ga0105239_10318958 3300010375 Bacteria 1752
95 Ga0105246_10002703 3300011119 Bacteria 10735
96 Ga0157369_10025687 3300013105 Bacteria 6536
97 Ga0157369_10204921 3300013105 Bacteria 2069
98 Ga0157374_10052373 3300013296 Bacteria 3801
99 Ga0157374_10409901 3300013296 Bacteria 1353
100 Ga0157378_10010443 3300013297 Bacteria 8110
101 Ga0157378_10025475 3300013297 Bacteria 5207
102 Ga0157375_10002209 3300013308 Bacteria 16831
103 Ga0157375_10011082 3300013308 Bacteria 7949
104 Ga0182008_10008376 3300014497 Bacteria 5646
105 Ga0157379_10100811 3300014968 Bacteria 2592
106 Ga0157376_10221147 3300014969 Bacteria 1754
107 Ga0209435_100039 3300025206 Bacteria 116879
108 Ga0209436_104527 3300025208 Bacteria 3421
109 Ga0209672_103894 3300025228 Bacteria 2931
110 Ga0209437_100022 3300025233 Bacteria 625694
111 Ga0209437_100064 3300025233 Bacteria 334360
112 Ga0209437_104235 3300025233 Bacteria 2543
113 Ga0207425_1000077 3300025245 Bacteria 105391
114 Ga0209646_1000137 3300025246 Bacteria 116791
115 Ga0209026_1000135 3300025250 Bacteria 117001
116 Ga0209026_1000247 3300025250 Bacteria 68920
117 Ga0209677_102562 3300025253 Bacteria 6698
118 Ga0209148_1000124 3300025254 Bacteria 185123
119 Ga0209759_1000154 3300025256 Bacteria 119427
120 Ga0209759_1000585 3300025256 Bacteria 35847
121 Ga0209129_1000036 3300025258 Bacteria 328331
122 Ga0209129_1000070 3300025258 Bacteria 212476
123 Ga0209233_1000010 3300025261 Bacteria 1194329
124 Ga0209233_1000031 3300025261 Bacteria 624646
125 Ga0209233_1000081 3300025261 Bacteria 336832
126 Ga0209233_1000203 3300025261 Bacteria 118984
127 Ga0209233_1012521 3300025261 Bacteria 2458
128 Ga0209455_1000062 3300025272 Bacteria 335169
129 Ga0209673_1000005 3300025273 Bacteria 692788
130 Ga0209673_1015706 3300025273 Bacteria 2862
131 Ga0209130_1000180 3300025284 Bacteria 89520
132 Ga0209025_1000239 3300025294 Bacteria 128436
133 Ga0209025_1000329 3300025294 Bacteria 105391
134 Ga0209025_1015999 3300025294 Bacteria 4468
135 Ga0209564_1008492 3300025295 Bacteria 5059
136 Ga0209758_1000259 3300025297 Bacteria 105391
137 Ga0209758_1008525 3300025297 Bacteria 6609
138 Ga0209758_1016180 3300025297 Bacteria 3804
139 Ga0209758_1039505 3300025297 Bacteria 1794
140 Ga0209256_1001252 3300025299 Bacteria 27983
141 Ga0207426_1000017 3300025302 Bacteria 577913
142 Ga0209051_1014356 3300025303 Bacteria 3702
143 Ga0207710_10020432 3300025900 Bacteria 2831
144 Ga0207647_10004530 3300025904 Bacteria 10300
145 Ga0207654_10054593 3300025911 Bacteria 2310
146 Ga0207695_10000118 3300025913 Bacteria 237085
147 Ga0207671_10001634 3300025914 Bacteria 25505
148 Ga0207693_10018579 3300025915 Bacteria 5535
149 Ga0207693_10025573 3300025915 Bacteria 4680
150 Ga0207657_10017311 3300025919 Bacteria 6914
151 Ga0207681_10297578 3300025923 Bacteria 1276
152 Ga0207694_10027043 3300025924 Bacteria 4367
153 Ga0207650_10011291 3300025925 Bacteria 6145
154 Ga0207690_10012744 3300025932 Bacteria 5038
155 Ga0207706_10005948 3300025933 Bacteria 11347
156 Ga0207706_10127767 3300025933 Bacteria 2235
157 Ga0207665_10169100 3300025939 Bacteria 1577
158 Ga0207679_10021491 3300025945 Bacteria 4376
159 Ga0207667_10280376 3300025949 Bacteria 1703
160 Ga0207668_10042642 3300025972 Bacteria 3074
161 Ga0207668_10142162 3300025972 Bacteria 1847
162 Ga0207640_10070828 3300025981 Bacteria 2347
163 Ga0207640_10075654 3300025981 Bacteria 2283
164 Ga0207639_10023099 3300026041 Bacteria 4487
165 Ga0207639_10335319 3300026041 Bacteria 1347
166 Ga0207678_10005382 3300026067 Bacteria 11465
167 Ga0207702_10026926 3300026078 Bacteria 4775
168 Ga0207702_10365015 3300026078 Bacteria 1385
169 Ga0207674_10031304 3300026116 Bacteria 5590
170 Ga0207674_10568160 3300026116 Bacteria 1096
171 Ga0207683_10054109 3300026121 Bacteria 3519
172 Ga0207683_10251259 3300026121 Bacteria 1614
173 Ga0207698_10242608 3300026142 Bacteria 1643
174 Ga0209389_1000046 3300027296 Bacteria 117363
175 Ga0209389_1000260 3300027296 Bacteria 33559
176 Ga0209371_1001381 3300027312 Bacteria 16726
177 Ga0209589_1000175 3300027357 Bacteria 73346
178 Ga0209589_1006990 3300027357 Bacteria 18386
179 Ga0209489_100112 3300027361 Bacteria 117364
180 Ga0209489_104601 3300027361 Bacteria 25214
181 Ga0209489_106620 3300027361 Bacteria 18386
182 Ga0209700_100029 3300027363 Bacteria 214607
183 Ga0209700_102937 3300027363 Bacteria 33569
184 Ga0209700_106374 3300027363 Bacteria 18386
185 Ga0207428_10005960 3300027907 Bacteria 11285
186 Ga0268266_10031949 3300028379 Bacteria 4473
187 Ga0268266_10050305 3300028379 Bacteria 3575
188 Ga0268266_10055237 3300028379 Bacteria 3414
189 Ga0268266_10389957 3300028379 Bacteria 1315
190 Ga0268264_10056786 3300028381 Bacteria 3273
191 Ga0268256_1000851 3300030500 Bacteria 21457
192 Ga0265330_10006943 3300031235 Bacteria 5561
193 Ga0265313_10017938 3300031595 Bacteria 3996
194 Ga0265342_10006640 3300031712 Bacteria 8587
195 Ga0307412_10048640 3300031911 Bacteria 2790
196 Ga0373928_0013404 3300035084 Unclassified 1646
197 Ga0373923_0010872 3300035111 Bacteria 3324
198 Ga0373955_0013111 3300035172 Bacteria 3998
199 Ga0373924_0015934 3300035410 Bacteria 2864
200 Ga0373927_0094172 3300035695 Unclassified 1946
201 Ga0373927_0102367 3300035695 Bacteria 1863
202 Ga0373933_0019279 3300035724 Bacteria 3850
203 Ga0373947_0098696 3300035725 Bacteria 1832
204 Ga0373937_0029258 3300036401 Bacteria 4988
205 Ga0316582_0121807 3300036647 Bacteria 1746
206 Ga0373925_0041213 3300037068 Bacteria 3422
207 Ga0373925_0063577 3300037068 Bacteria 2777
208 Ga0395899_0236486 3300037312 Bacteria 1259
209 Ga0395900_0046118 3300037418 Bacteria 4488
210 Ga0395900_0052058 3300037418 Bacteria 4215
211 Ga0395900_0187635 3300037418 Bacteria 2098
212 Ga0395898_0098236 3300037466 Bacteria 2811
213 Ga0395898_0106615 3300037466 Bacteria 2687
214 Ga0395905_0000453 3300037471 Bacteria 57443
215 Ga0395905_0100559 3300037471 Bacteria 2715
216 Ga0395905_0122792 3300037471 Bacteria 2442
217 Ga0395905_0128431 3300037471 Bacteria 2384
218 Ga0395905_0653430 3300037471 Bacteria 953
219 Ga0395901_0215888 3300038443 Bacteria 2006
220 Ga0395901_0218817 3300038443 Bacteria 1991
221 Ga0395901_0474374 3300038443 Bacteria 1277
222 Ga0395901_0613680 3300038443 Bacteria 1095
223 Ga0400485_11087 3300038735 Bacteria 1905
224 Ga0400486_14522 3300038742 Bacteria 2209
225 Ga0436360_0934992 3300039438 Bacteria 2612
226 Ga0436363_1586464 3300039450 Bacteria 5105
227 Ga0439450_009916 3300042008 Bacteria 1823
228 Ga0466972_0043178 3300044658 Bacteria 2190
229 Ga0466967_0180644 3300045976 Bacteria 1990
230 Ga0466967_0407301 3300045976 Bacteria 1324
231 Ga0495592_0005999 3300046454 Bacteria 9031
232 Ga0495603_0012906 3300046455 Bacteria 5051
233 Ga0495603_0056315 3300046455 Bacteria 2328
234 Ga0495629_0009718 3300046459 Bacteria 7024
235 Ga0495629_0019054 3300046459 Bacteria 4907
236 Ga0495651_0003482 3300046462 Bacteria 12066
237 Ga0495580_0006645 3300046472 Bacteria 9397
238 Ga0495582_0065990 3300046473 Bacteria 1999
239 Ga0495639_0014679 3300046475 Bacteria 3393
240 Ga0495639_0051043 3300046475 Bacteria 1880
241 Ga0495664_0152099 3300046477 Bacteria 1404
242 Ga0495594_0045275 3300046499 Unclassified 2415
243 Ga0495606_0001553 3300046507 Bacteria 30251
244 Ga0495606_0149738 3300046507 Bacteria 1371
245 Ga0495608_0007325 3300046511 Bacteria 7798
246 Ga0495618_0001008 3300046514 Bacteria 19283
247 Ga0495628_0086013 3300046516 Bacteria 2438
248 Ga0495666_0106087 3300046526 Unclassified 1322
249 Ga0495652_0018566 3300046529 Bacteria 6198
250 Ga0495640_0013082 3300046533 Bacteria 6319
251 Ga0495622_0048038 3300046557 Bacteria 1983
252 Ga0495667_0011350 3300046559 Bacteria 6032
253 Ga0495634_0028224 3300046642 Bacteria 3897
254 Ga0495625_0020589 3300046660 Bacteria 5089
255 Ga0495625_0205137 3300046660 Bacteria 1299
256 Ga0495588_0058275 3300046674 Bacteria 1996
257 Ga0495657_0042675 3300046675 Bacteria 3095
258 Ga0495599_0039534 3300046678 Bacteria 2963
259 Ga0495623_0001454 3300046679 Bacteria 16044
260 Ga0495646_0097961 3300046680 Bacteria 1684
261 Ga0495613_0012706 3300046689 Bacteria 6262
262 Ga0495624_0099694 3300046690 Bacteria 1789
263 Ga0495600_0026453 3300046809 Bacteria 3744
264 Ga0495581_0011585 3300047315 Bacteria 5102
265 Ga0495604_0001548 3300047317 Bacteria 18937
266 Ga0495674_0004555 3300047319 Bacteria 13337
267 Ga0495672_0166712 3300047320 Bacteria 1127
268 Ga0495680_0007192 3300047322 Bacteria 10254
269 Ga0495680_0172685 3300047322 Unclassified 1564
270 Ga0495675_0046477 3300047444 Bacteria 2763
271 Ga0495675_0173179 3300047444 Bacteria 1325
272 Ga0495686_0000547 3300047472 Bacteria 53728
273 Ga0495593_0020131 3300047673 Plasmid 3736
274 Ga0495602_0018335 3300048088 Bacteria 6995
275 Ga0496100_0002466 3300048903 Bacteria 9400
276 Ga0496100_0025159 3300048903 Bacteria 3638
277 Ga0496100_0135721 3300048903 Bacteria 1738
278 Ga0496101_0035429 3300048904 Bacteria 3530
279 Ga0496101_0091530 3300048904 Bacteria 2263
280 Ga0496102_0022788 3300048905 Bacteria 5551
281 Ga0496102_0051287 3300048905 Bacteria 3759
282 Ga0496103_0003061 3300048906 Bacteria 10281
283 Ga0496103_0051952 3300048906 Bacteria 2538
284 Ga0496103_0271853 3300048906 Bacteria 1090
285 Ga0496104_0010694 3300048907 Bacteria 8204
286 Ga0496104_0011582 3300048907 Bacteria 7904
287 Ga0496104_0239025 3300048907 Bacteria 1728
288 Ga0496105_0047601 3300048908 Bacteria 3539
289 Ga0496106_0018362 3300048909 Bacteria 5168
290 Ga0496106_0155449 3300048909 Bacteria 1806
291 Ga0496107_0008334 3300048910 Bacteria 7172
292 Ga0496107_0081722 3300048910 Bacteria 2357
293 Ga0496107_0218641 3300048910 Bacteria 1417
294 Ga0496108_0041407 3300048911 Bacteria 3846
295 Ga0496108_0273499 3300048911 Bacteria 1470
296 Ga0496108_0286702 3300048911 Bacteria 1433
297 Ga0496109_0026514 3300048912 Bacteria 5168
298 Ga0496109_0071719 3300048912 Bacteria 3181
299 Ga0496109_0078680 3300048912 Bacteria 3036
300 Ga0496109_0081879 3300048912 Bacteria 2974
301 Ga0496109_0086019 3300048912 Bacteria 2903
302 Ga0496110_0019558 3300048913 Bacteria 5701
303 Ga0496111_0002845 3300048914 Bacteria 10558
304 Ga0496111_0386851 3300048914 Bacteria 1034
305 Ga0496112_0008947 3300048915 Bacteria 8990
306 Ga0496112_0027784 3300048915 Bacteria 5457
307 Ga0496112_0035556 3300048915 Bacteria 4854
308 Ga0496112_0107322 3300048915 Bacteria 2762
309 Ga0496112_0134220 3300048915 Bacteria 2446
310 Ga0496113_0013278 3300048916 Bacteria 5573
311 Ga0496113_0098800 3300048916 Bacteria 2260
312 Ga0496113_0187729 3300048916 Bacteria 1640
313 Ga0496114_0003929 3300048917 Bacteria 11466
314 Ga0496114_0026245 3300048917 Bacteria 4768
315 Ga0496115_0006307 3300048918 Bacteria 8678
316 Ga0496115_0029809 3300048918 Bacteria 4288
317 Ga0496116_0064260 3300048919 Bacteria 2359
318 Ga0496116_0120519 3300048919 Unclassified 1519
319 Ga0496116_0132261 3300048919 Bacteria 1420
320 Ga0496117_0009121 3300048920 Bacteria 9315
321 Ga0496118_0122435 3300048921 Unclassified 1692
322 Ga0496119_0025321 3300048922 Bacteria 4148
323 Ga0496119_0030687 3300048922 Bacteria 3619
324 Ga0496119_0056763 3300048922 Bacteria 2371
325 Ga0496119_0175406 3300048922 Bacteria 1128
326 Ga0496120_0002639 3300048923 Bacteria 17745
327 Ga0496120_0084150 3300048923 Bacteria 1716
328 Ga0496121_0037640 3300048924 Bacteria 4294
329 Ga0496121_0087387 3300048924 Bacteria 2447
330 Ga0496123_0008448 3300048926 Bacteria 9456
331 Ga0496123_0031281 3300048926 Bacteria 3874
332 Ga0496124_0024322 3300048927 Bacteria 5511
333 Ga0496124_0093995 3300048927 Bacteria 2439
334 Ga0496124_0167086 3300048927 Bacteria 1709
335 Ga0496125_0088451 3300048928 Bacteria 2334
336 Ga0496126_0197392 3300048929 Bacteria 1701
337 Ga0496126_0239785 3300048929 Bacteria 1515
338 Ga0496126_0301467 3300048929 Bacteria 1322
339 Ga0501031_0000202 3300049568 Bacteria 33947
340 Ga0501032_0000443 3300049569 Bacteria 33947
341 Ga0501032_0136546 3300049569 Bacteria 1616
342 Ga0501033_0000097 3300049570 Bacteria 83228
343 Ga0501033_0371457 3300049570 Bacteria 1000
344 Ga0501034_0000186 3300049571 Bacteria 116500
345 Ga0501034_0050275 3300049571 Bacteria 4205
346 Ga0501034_0186666 3300049571 Bacteria 2036
347 Ga0501036_0000002 3300049572 Bacteria 293106
348 Ga0501036_0109252 3300049572 Bacteria 2337
349 Ga0501037_0000443 3300049573 Bacteria 33927
350 Ga0501037_0046428 3300049573 Bacteria 3185
351 Ga0501038_0000867 3300049574 Bacteria 26767
352 Ga0501038_0048154 3300049574 Bacteria 3690
353 Ga0501039_0000002 3300049575 Bacteria 375152
354 Ga0501039_0114633 3300049575 Bacteria 2109
355 Ga0501040_0001925 3300049576 Bacteria 13348
356 Ga0501040_0021610 3300049576 Bacteria 4300
357 Ga0501040_0054717 3300049576 Bacteria 2736
358 Ga0501040_0136636 3300049576 Bacteria 1726
359 Ga0501041_0027405 3300049577 Bacteria 3433
360 Ga0501042_0154504 3300049578 Bacteria 1655
361 Ga0501043_0000543 3300049579 Bacteria 33914
362 Ga0501047_0002364 3300049581 Bacteria 18037
363 Ga0501070_0012803 3300049586 Bacteria 7072
364 Ga0501070_0088306 3300049586 Bacteria 2566
365 Ga0501071_0016107 3300049587 Bacteria 5139
366 Ga0501071_0216932 3300049587 Bacteria 1439
367 Ga0501076_0129915 3300049592 Bacteria 2043
368 Ga0501077_0012266 3300049593 Bacteria 5368
369 Ga0501079_0096992 3300049741 Bacteria 2286
370 Ga0501080_0249223 3300049742 Bacteria 1620
371 Ga0501081_0007896 3300049743 Bacteria 6903
372 Ga0501081_0080054 3300049743 Bacteria 2286
373 Ga0501035_0000100 3300049822 Bacteria 107321
374 Ga0501035_0032386 3300049822 Bacteria 4756
375 Ga0501044_0000002 3300049823 Bacteria 375152
376 Ga0501044_0052784 3300049823 Bacteria 4186
377 Ga0501044_0360284 3300049823 Bacteria 1372
378 Ga0501045_0018382 3300049824 Bacteria 4972
379 Ga0501045_0090203 3300049824 Bacteria 2265
380 nmdc:mga00v17_277550_c1 3300050491 Bacteria 1088
381 nmdc:mga0yw44_218701_c1 3300050492 Bacteria 1262
382 nmdc:mga0yw44_235089_c1 3300050492 Bacteria 1217
383 nmdc:mga0yw44_241515_c1 3300050492 Bacteria 1200
384 nmdc:mga0yw44_38577_c1 3300050492 Bacteria 2828
385 nmdc:mga07m45_76491_c1 3300050496 Unclassified 1908
386 nmdc:mga05p37_157530_c1 3300050507 Bacteria 2775
387 nmdc:mga05p37_413446_c1 3300050507 Bacteria 1572
388 nmdc:mga06r32_269012_c1 3300050510 Bacteria 1692
389 nmdc:mga08y16_7637_c1 3300050511 Bacteria 11317
390 nmdc:mga0n895_3912_c1 3300050512 Bacteria 12100
391 nmdc:mga0rr50_8560_c1 3300050513 Bacteria 6376
392 nmdc:mga08x19_87064_c1 3300050514 Bacteria 2057
393 nmdc:mga0a205_7475_c1 3300050515 Bacteria 9893
394 Ga0495601_0011422 3300053077 Bacteria 5311
395 Ga0495612_0008778 3300053078 Bacteria 4097
396 Ga0495595_0000901 3300053084 Bacteria 11440
397 Ga0495619_0014841 3300053085 Plasmid 4920
398 Ga0495619_0032453 3300053085 Bacteria 3389
399 Ga0500608_117869 3300053122 Bacteria 1208
400 Ga0500618_000190 3300053125 Bacteria 50341
401 Ga0500618_001154 3300053125 Bacteria 12817
402 Ga0500618_002143 3300053125 Bacteria 7756
403 Ga0500618_007745 3300053125 Bacteria 3040
404 Ga0500620_000058 3300053155 Bacteria 20321
405 Ga0500627_0063583 3300053158 Bacteria 1626
406 Ga0500627_0160637 3300053158 Bacteria 1014
407 Ga0500636_0131564 3300053177 Bacteria 1393
408 Ga0501084_0007651 3300054114 Bacteria 8905
409 Ga0501084_0144864 3300054114 Bacteria 2001
410 Ga0501082_0065853 3300060353 Bacteria 3120
411 Ga0501082_0300851 3300060353 Bacteria 1397
412 Ga0530510_0001126 3300061734 Bacteria 17781
413 Ga0530510_0085782 3300061734 Bacteria 2294

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8056681323 8056686330 281
2 3300053177 Ga0500636_0131564 Ga0500636_0131564_516_1373 284
3 3300005937 Ga0081455_10004397 Ga0081455_1000439712 290
4 3300009101 Ga0105247_10024565 Ga0105247_100245651 291
5 3300045976 Ga0466967_0407301 Ga0466967_0407301_431_1309 292
6 iso_pu_bacteria 2871435913 2871440545 292
7 3300003354 JGI25160J50197_1000095 JGI25160J50197_100009578 294
8 3300003374 JGI25161J50226_1000071 JGI25161J50226_10000716 294
9 3300004625 Ga0055543_1000250 Ga0055543_10002506 294
10 3300005262 Ga0065165_1000408 Ga0065165_100040860 294
11 3300025208 Ga0209436_104527 Ga0209436_1045272 294
12 3300025284 Ga0209130_1000180 Ga0209130_10001806 294
13 3300025302 Ga0207426_1000017 Ga0207426_1000017461 294
14 3300048903 Ga0496100_0002466 Ga0496100_0002466_8486_9379 296
15 3300048909 Ga0496106_0155449 Ga0496106_0155449_803_1699 296
16 3300048912 Ga0496109_0071719 Ga0496109_0071719_187_1083 296
17 3300048914 Ga0496111_0386851 Ga0496111_0386851_29_925 296
18 3300025933 Ga0207706_10127767 Ga0207706_101277673 298
19 3300048926 Ga0496123_0031281 Ga0496123_0031281_198_1106 298
20 iso_pu_bacteria 8018176218 8018181267 300
21 3300046660 Ga0495625_0205137 Ga0495625_0205137_17_928 301
22 3300049570 Ga0501033_0371457 Ga0501033_0371457_39_974 301
23 3300046511 Ga0495608_0007325 Ga0495608_0007325_6668_7582 302
24 3300053085 Ga0495619_0032453 Ga0495619_0032453_424_1362 302
25 iso_pu_bacteria 2885334103 2885340522 303
26 3300005937 Ga0081455_10048374 Ga0081455_100483743 306
27 3300006177 Ga0075362_10145230 Ga0075362_101452301 307
28 3300037471 Ga0395905_0653430 Ga0395905_0653430_13_942 307
29 3300048928 Ga0496125_0088451 Ga0496125_0088451_67_1059 307
30 3300005937 Ga0081455_10279987 Ga0081455_102799871 309
31 3300053077 Ga0495601_0011422 Ga0495601_0011422_840_1802 309
32 3300053155 Ga0500620_000058 Ga0500620_000058_13738_14703 309
33 3300049576 Ga0501040_0136636 Ga0501040_0136636_169_1185 310
34 3300049587 Ga0501071_0016107 Ga0501071_0016107_254_1270 310
35 3300049743 Ga0501081_0080054 Ga0501081_0080054_772_1788 310
36 3300054114 Ga0501084_0144864 Ga0501084_0144864_782_1798 310
37 3300060353 Ga0501082_0065853 Ga0501082_0065853_760_1776 310
38 3300061734 Ga0530510_0001126 Ga0530510_0001126_2035_3051 310
39 iso_pu_bacteria 2885383462 2885384813 310
40 3300009011 Ga0105251_10077404 Ga0105251_100774042 311
41 3300009176 Ga0105242_10009636 Ga0105242_100096368 311
42 3300011119 Ga0105246_10002703 Ga0105246_100027036 311
43 3300035084 Ga0373928_0013404 Ga0373928_0013404_19_978 311
44 iso_pu_bacteria 2977971508 2977980237 311
45 3300048919 Ga0496116_0132261 Ga0496116_0132261_134_1084 312
46 3300048922 Ga0496119_0175406 Ga0496119_0175406_41_991 312
47 3300048927 Ga0496124_0024322 Ga0496124_0024322_2235_3185 312
48 3300048929 Ga0496126_0239785 Ga0496126_0239785_283_1233 312
49 3300049569 Ga0501032_0136546 Ga0501032_0136546_501_1445 312
50 3300049571 Ga0501034_0186666 Ga0501034_0186666_330_1274 312
51 3300049573 Ga0501037_0046428 Ga0501037_0046428_453_1397 312
52 3300049574 Ga0501038_0048154 Ga0501038_0048154_554_1498 312
53 3300049575 Ga0501039_0114633 Ga0501039_0114633_474_1418 312
54 3300049586 Ga0501070_0088306 Ga0501070_0088306_315_1259 312
55 3300049742 Ga0501080_0249223 Ga0501080_0249223_58_1002 312
56 3300049822 Ga0501035_0032386 Ga0501035_0032386_333_1277 312
57 3300049823 Ga0501044_0360284 Ga0501044_0360284_384_1328 312
58 3300005457 Ga0070662_100130501 Ga0070662_1001305012 313
59 3300006177 Ga0075362_10020877 Ga0075362_100208773 313
60 3300037418 Ga0395900_0187635 Ga0395900_0187635_910_1908 313
61 iso_pu_bacteria 2513237305 2514420553 314
62 iso_pu_bacteria 2903768456 2903776304 314
63 iso_pu_bacteria 2924762789 2924767990 314
64 iso_pu_bacteria 2937822353 2937822394 314
65 iso_pu_bacteria 2987666974 2987669711 314
66 3300037312 Ga0395899_0236486 Ga0395899_0236486_66_1037 315
67 3300037418 Ga0395900_0052058 Ga0395900_0052058_2534_3505 315
68 3300037466 Ga0395898_0098236 Ga0395898_0098236_725_1696 315
69 3300038443 Ga0395901_0215888 Ga0395901_0215888_351_1322 315
70 3300049592 Ga0501076_0129915 Ga0501076_0129915_110_1063 315
71 3300046477 Ga0495664_0152099 Ga0495664_0152099_105_1067 316
72 3300047444 Ga0495675_0173179 Ga0495675_0173179_226_1188 316
73 3300053125 Ga0500618_001154 Ga0500618_001154_6781_7737 316
74 iso_pu_bacteria 2721755686 2723574275 316
75 3300036647 Ga0316582_0121807 Ga0316582_0121807_595_1617 317
76 3300049576 Ga0501040_0054717 Ga0501040_0054717_736_1731 317
77 3300049824 Ga0501045_0018382 Ga0501045_0018382_1187_2182 317
78 iso_pu_bacteria 2582581294 2585204482 317
79 iso_pu_bacteria 2582581294 2585205757 317
80 iso_pu_bacteria 3004167301 3004168064 317
81 3300005365 Ga0070688_100013794 Ga0070688_1000137945 318
82 3300025919 Ga0207657_10017311 Ga0207657_100173111 318
83 3300031911 Ga0307412_10048640 Ga0307412_100486403 318
84 3300046660 Ga0495625_0020589 Ga0495625_0020589_3183_4148 318
85 3300046678 Ga0495599_0039534 Ga0495599_0039534_1406_2371 318
86 3300049571 Ga0501034_0050275 Ga0501034_0050275_1907_2890 318
87 3300049572 Ga0501036_0109252 Ga0501036_0109252_812_1837 318
88 3300049576 Ga0501040_0021610 Ga0501040_0021610_1352_2320 318
89 3300049577 Ga0501041_0027405 Ga0501041_0027405_1608_2576 318
90 3300049578 Ga0501042_0154504 Ga0501042_0154504_519_1487 318
91 3300049593 Ga0501077_0012266 Ga0501077_0012266_824_1792 318
92 3300049743 Ga0501081_0007896 Ga0501081_0007896_4476_5444 318
93 3300049824 Ga0501045_0090203 Ga0501045_0090203_66_1034 318
94 3300053158 Ga0500627_0160637 Ga0500627_0160637_26_991 318
95 3300054114 Ga0501084_0007651 Ga0501084_0007651_6283_7251 318
96 3300061734 Ga0530510_0085782 Ga0530510_0085782_1121_2089 318
97 iso_pu_bacteria 2512875024 2512960169 318
98 iso_pu_bacteria 2513237164 2514034747 318
99 iso_pu_bacteria 2869169390 2869169516 318
100 iso_pu_bacteria 2869234852 2869236767 318
101 iso_pu_bacteria 2869242130 2869246605 318
102 iso_pu_bacteria 2869256925 2869261638 318
103 iso_pu_bacteria 2871481445 2871482683 318
104 iso_pu_bacteria 2876386047 2876386394 318
105 iso_pu_bacteria 2876420981 2876426676 318
106 iso_pu_bacteria 2903513507 2903520441 318
107 iso_pu_bacteria 2906401398 2906403548 318
108 iso_pu_bacteria 2924741084 2924741146 318
109 iso_pu_bacteria 2937861824 2937864492 318
110 iso_pu_bacteria 2937980651 2937981514 318
111 iso_pu_bacteria 2958108152 2958113191 318
112 iso_pu_bacteria 2961183825 2961186640 318
113 iso_pu_bacteria 2970489779 2970493426 318
114 iso_pu_bacteria 2970627176 2970627576 318
115 iso_pu_bacteria 2977851361 2977853929 318
116 iso_pu_bacteria 2977907340 2977908047 318
117 iso_pu_bacteria 2979764755 2979768774 318
118 iso_pu_bacteria 2996386984 2996388525 318
119 iso_pu_bacteria 3004232784 3004237464 318
120 iso_pu_bacteria 8004312739 8004320880 318
121 iso_pu_bacteria 8004727605 8004728687 318
122 3300005983 Ga0081540_1012683 Ga0081540_10126831 319
123 3300009094 Ga0111539_10052616 Ga0111539_100526164 319
124 3300009147 Ga0114129_10019913 Ga0114129_100199139 319
125 3300009553 Ga0105249_10103373 Ga0105249_101033735 319
126 3300013105 Ga0157369_10025687 Ga0157369_100256873 319
127 3300013297 Ga0157378_10025475 Ga0157378_100254753 319
128 3300013308 Ga0157375_10011082 Ga0157375_100110828 319
129 3300014969 Ga0157376_10221147 Ga0157376_102211472 319
130 3300037471 Ga0395905_0122792 Ga0395905_0122792_325_1293 319
131 3300038443 Ga0395901_0474374 Ga0395901_0474374_128_1096 319
132 3300039438 Ga0436360_0934992 Ga0436360_0934992_1231_2223 319
133 3300048905 Ga0496102_0022788 Ga0496102_0022788_1848_2813 319
134 3300048906 Ga0496103_0003061 Ga0496103_0003061_1087_2052 319
135 3300048907 Ga0496104_0011582 Ga0496104_0011582_940_1905 319
136 3300048909 Ga0496106_0018362 Ga0496106_0018362_1593_2558 319
137 3300048910 Ga0496107_0081722 Ga0496107_0081722_278_1243 319
138 3300048911 Ga0496108_0286702 Ga0496108_0286702_107_1072 319
139 3300048912 Ga0496109_0026514 Ga0496109_0026514_1782_2747 319
140 3300048913 Ga0496110_0019558 Ga0496110_0019558_2739_3704 319
141 3300048914 Ga0496111_0002845 Ga0496111_0002845_8633_9598 319
142 3300048915 Ga0496112_0008947 Ga0496112_0008947_6000_6965 319
143 3300048916 Ga0496113_0013278 Ga0496113_0013278_2611_3576 319
144 3300048917 Ga0496114_0026245 Ga0496114_0026245_1065_2030 319
145 3300048918 Ga0496115_0029809 Ga0496115_0029809_2739_3704 319
146 3300050507 nmdc:mga05p37_157530_c1 nmdc:mga05p37_157530_c1_140_1105 319
147 3300050510 nmdc:mga06r32_269012_c1 nmdc:mga06r32_269012_c1_686_1651 319
148 3300050511 nmdc:mga08y16_7637_c1 nmdc:mga08y16_7637_c1_8584_9549 319
149 3300050512 nmdc:mga0n895_3912_c1 nmdc:mga0n895_3912_c1_6294_7259 319
150 3300050513 nmdc:mga0rr50_8560_c1 nmdc:mga0rr50_8560_c1_4650_5615 319
151 3300050514 nmdc:mga08x19_87064_c1 nmdc:mga08x19_87064_c1_1052_2017 319
152 3300050515 nmdc:mga0a205_7475_c1 nmdc:mga0a205_7475_c1_6505_7470 319
153 iso_pu_bacteria 2856328259 2856333533 319
154 iso_pu_bacteria 2856334872 2856337938 319
155 iso_pu_bacteria 2857367948 2857368951 319
156 iso_pu_bacteria 2869271264 2869277960 319
157 iso_pu_bacteria 2871451962 2871459546 319
158 iso_pu_bacteria 2874162495 2874165359 319
159 iso_pu_bacteria 2876399893 2876402895 319
160 iso_pu_bacteria 2876406927 2876408750 319
161 iso_pu_bacteria 2878774303 2878776219 319
162 iso_pu_bacteria 2878781027 2878786684 319
163 iso_pu_bacteria 2906386501 2906392040 319
164 iso_pu_bacteria 2906408224 2906412516 319
165 iso_pu_bacteria 2922151315 2922152031 319
166 iso_pu_bacteria 2922172374 2922175858 319
167 iso_pu_bacteria 2924748358 2924752684 319
168 iso_pu_bacteria 2958122699 2958124134 319
169 iso_pu_bacteria 2958137437 2958138658 319
170 iso_pu_bacteria 2958158011 2958163668 319
171 iso_pu_bacteria 2961136820 2961139831 319
172 iso_pu_bacteria 2965025482 2965025826 319
173 iso_pu_bacteria 2965032056 2965036790 319
174 iso_pu_bacteria 2965047637 2965052032 319
175 iso_pu_bacteria 2965102966 2965105123 319
176 iso_pu_bacteria 2965110997 2965116232 319
177 iso_pu_bacteria 2968138860 2968142513 319
178 iso_pu_bacteria 2970510686 2970511183 319
179 iso_pu_bacteria 2970547951 2970551519 319
180 iso_pu_bacteria 2977872689 2977874281 319
181 iso_pu_bacteria 2977935797 2977939065 319
182 iso_pu_bacteria 2977957713 2977963823 319
183 iso_pu_bacteria 2979793036 2979793335 319
184 iso_pu_bacteria 2987645492 2987645650 319
185 iso_pu_bacteria 2987673487 2987674327 319
186 iso_pu_bacteria 3000135777 3000139998 319
187 iso_pu_bacteria 3004239961 3004247225 319
188 iso_pu_bacteria 649633066 649872179 319
189 iso_pu_bacteria 8004300914 8004306548 319
190 iso_pu_bacteria 8004695233 8004702057 319
191 3300006186 Ga0075369_10002867 Ga0075369_100028675 320
192 3300009093 Ga0105240_10244742 Ga0105240_102447422 320
193 3300026121 Ga0207683_10054109 Ga0207683_100541093 320
194 3300048929 Ga0496126_0301467 Ga0496126_0301467_305_1276 320
195 3300050492 nmdc:mga0yw44_218701_c1 nmdc:mga0yw44_218701_c1_137_1108 320
196 3300053125 Ga0500618_002143 Ga0500618_002143_574_1644 320
197 iso_pu_bacteria 2508501123 2509117953 320
198 iso_pu_bacteria 2509276022 2509395254 320
199 iso_pu_bacteria 2519899620 2520378297 320
200 iso_pu_bacteria 2615840624 2616297312 320
201 iso_pu_bacteria 2643221595 2643987992 320
202 iso_pu_bacteria 2643221627 2644158162 320
203 iso_pu_bacteria 2718217997 2719663204 320
204 iso_pu_bacteria 2718218199 2720488608 320
205 iso_pu_bacteria 2718218365 2721155201 320
206 iso_pu_bacteria 2721755684 2723563623 320
207 iso_pu_bacteria 2721755685 2723570491 320
208 iso_pu_bacteria 2721755822 2724102038 320
209 iso_pu_bacteria 2721755823 2724107227 320
210 iso_pu_bacteria 2728369397 2730296083 320
211 iso_pu_bacteria 2756170246 2756671920 320
212 iso_pu_bacteria 2791355260 2793325274 320
213 iso_pu_bacteria 2791355265 2793356345 320
214 iso_pu_bacteria 2791355267 2793370206 320
215 iso_pu_bacteria 2802429633 2806048762 320
216 iso_pu_bacteria 2802429635 2806063600 320
217 iso_pu_bacteria 2802429636 2806070547 320
218 iso_pu_bacteria 2844002411 2844008136 320
219 iso_pu_bacteria 2856320880 2856326729 320
220 iso_pu_bacteria 2869278585 2869283718 320
221 iso_pu_bacteria 2871466892 2871468306 320
222 iso_pu_bacteria 2874139085 2874140175 320
223 iso_pu_bacteria 2878738818 2878738852 320
224 iso_pu_bacteria 2881853255 2881860029 320
225 iso_pu_bacteria 2885342637 2885349557 320
226 iso_pu_bacteria 2885350715 2885350843 320
227 iso_pu_bacteria 2888337043 2888338696 320
228 iso_pu_bacteria 2906378014 2906378889 320
229 iso_pu_bacteria 2924718760 2924722401 320
230 iso_pu_bacteria 2924733363 2924740208 320
231 iso_pu_bacteria 2924776078 2924776214 320
232 iso_pu_bacteria 2936381700 2936385624 320
233 iso_pu_bacteria 2937877337 2937884327 320
234 iso_pu_bacteria 2937972304 2937979570 320
235 iso_pu_bacteria 2958034702 2958040230 320
236 iso_pu_bacteria 2958041894 2958054574 320
237 iso_pu_bacteria 2958064165 2958069308 320
238 iso_pu_bacteria 2958084443 2958091638 320
239 iso_pu_bacteria 2958092219 2958097771 320
240 iso_pu_bacteria 2968016561 2968019072 320
241 iso_pu_bacteria 2970469710 2970470755 320
242 iso_pu_bacteria 2970593180 2970597857 320
243 iso_pu_bacteria 2977828996 2977837073 320
244 iso_pu_bacteria 2996348954 2996356708 320
245 iso_pu_bacteria 3004275668 3004283011 320
246 3300003187 JGI25151J46595_10000582 JGI25151J46595_1000058241 321
247 3300025258 Ga0209129_1000070 Ga0209129_1000070226 321
248 3300025294 Ga0209025_1000239 Ga0209025_100023959 321
249 3300025297 Ga0209758_1016180 Ga0209758_10161802 321
250 3300025303 Ga0209051_1014356 Ga0209051_10143561 321
251 3300025972 Ga0207668_10142162 Ga0207668_101421622 321
252 3300050491 nmdc:mga00v17_277550_c1 nmdc:mga00v17_277550_c1_90_1064 321
253 iso_pu_bacteria 2718217882 2719178841 321
254 iso_pu_bacteria 2718218009 2719729206 321
255 iso_pu_bacteria 2718218363 2721143453 321
256 iso_pu_bacteria 2718218366 2721166546 321
257 iso_pu_bacteria 2721755514 2722837524 321
258 iso_pu_bacteria 2721755810 2724041099 321
259 iso_pu_bacteria 2728369365 2730161302 321
260 iso_pu_bacteria 2791355123 2792752116 321
261 iso_pu_bacteria 2842489311 2842495278 321
262 iso_pu_bacteria 2842495871 2842501629 321
263 iso_pu_bacteria 8005619151 8005624929 321
264 iso_pu_bacteria 8005695170 8005698072 321
265 3300002774 JGI25150J39212_1000028 JGI25150J39212_100002819 322
266 3300003187 JGI25151J46595_10000123 JGI25151J46595_1000012378 322
267 3300006353 Ga0075370_10020400 Ga0075370_100204002 322
268 3300013296 Ga0157374_10409901 Ga0157374_104099012 322
269 3300025245 Ga0207425_1000077 Ga0207425_100007776 322
270 3300025258 Ga0209129_1000036 Ga0209129_1000036241 322
271 3300025273 Ga0209673_1015706 Ga0209673_10157063 322
272 3300025294 Ga0209025_1000329 Ga0209025_100032976 322
273 3300025297 Ga0209758_1000259 Ga0209758_100025916 322
274 3300047320 Ga0495672_0166712 Ga0495672_0166712_68_1057 322
275 3300048904 Ga0496101_0035429 Ga0496101_0035429_394_1386 322
276 3300048907 Ga0496104_0239025 Ga0496104_0239025_576_1583 322
277 3300048911 Ga0496108_0273499 Ga0496108_0273499_361_1368 322
278 3300048912 Ga0496109_0086019 Ga0496109_0086019_737_1744 322
279 3300048915 Ga0496112_0027784 Ga0496112_0027784_260_1267 322
280 3300048919 Ga0496116_0064260 Ga0496116_0064260_1123_2115 322
281 3300048919 Ga0496116_0120519 Ga0496116_0120519_283_1275 322
282 3300048920 Ga0496117_0009121 Ga0496117_0009121_2652_3644 322
283 3300048921 Ga0496118_0122435 Ga0496118_0122435_168_1160 322
284 3300048924 Ga0496121_0087387 Ga0496121_0087387_129_1121 322
285 3300048927 Ga0496124_0093995 Ga0496124_0093995_497_1489 322
286 3300049587 Ga0501071_0216932 Ga0501071_0216932_138_1118 322
287 3300049741 Ga0501079_0096992 Ga0501079_0096992_287_1267 322
288 3300050496 nmdc:mga07m45_76491_c1 nmdc:mga07m45_76491_c1_478_1470 322
289 3300050507 nmdc:mga05p37_413446_c1 nmdc:mga05p37_413446_c1_441_1475 322
290 iso_pu_bacteria 2878753008 2878753100 322
291 iso_pu_bacteria 2881861095 2881866480 322
292 iso_pu_bacteria 2885318864 2885319775 322
293 iso_pu_bacteria 2924784321 2924786249 322
294 iso_pu_bacteria 2961127735 2961136622 322
295 iso_pu_bacteria 2961170736 2961171100 322
296 iso_pu_bacteria 2970503327 2970503694 322
297 iso_pu_bacteria 2977821940 2977822032 322
298 iso_pu_bacteria 2979808191 2979808330 322
299 iso_pu_bacteria 8004374579 8004374672 322
300 3300005366 Ga0070659_100003500 Ga0070659_10000350010 323
301 3300005455 Ga0070663_100014193 Ga0070663_1000141934 323
302 3300005457 Ga0070662_100002562 Ga0070662_1000025624 323
303 3300005536 Ga0070697_100235397 Ga0070697_1002353972 323
304 3300005539 Ga0068853_100521709 Ga0068853_1005217091 323
305 3300005545 Ga0070695_100337804 Ga0070695_1003378041 323
306 3300005546 Ga0070696_100280550 Ga0070696_1002805502 323
307 3300005548 Ga0070665_100117858 Ga0070665_1001178582 323
308 3300005549 Ga0070704_100023332 Ga0070704_1000233321 323
309 3300005577 Ga0068857_100023552 Ga0068857_1000235525 323
310 3300005614 Ga0068856_100248267 Ga0068856_1002482672 323
311 3300005842 Ga0068858_100479678 Ga0068858_1004796781 323
312 3300006175 Ga0070712_100005373 Ga0070712_1000053737 323
313 3300006844 Ga0075428_100045321 Ga0075428_1000453214 323
314 3300006847 Ga0075431_100144562 Ga0075431_1001445622 323
315 3300006852 Ga0075433_10003583 Ga0075433_1000358311 323
316 3300006871 Ga0075434_100003765 Ga0075434_1000037654 323
317 3300006914 Ga0075436_100021371 Ga0075436_1000213713 323
318 3300007076 Ga0075435_100007194 Ga0075435_1000071947 323
319 3300009766 Ga0123342_1019876 Ga0123342_10198765 323
320 3300025915 Ga0207693_10025573 Ga0207693_100255733 323
321 3300025923 Ga0207681_10297578 Ga0207681_102975782 323
322 3300025932 Ga0207690_10012744 Ga0207690_100127444 323
323 3300025933 Ga0207706_10005948 Ga0207706_100059485 323
324 3300025945 Ga0207679_10021491 Ga0207679_100214913 323
325 3300025972 Ga0207668_10042642 Ga0207668_100426423 323
326 3300026067 Ga0207678_10005382 Ga0207678_100053825 323
327 3300026116 Ga0207674_10031304 Ga0207674_100313045 323
328 3300027907 Ga0207428_10005960 Ga0207428_1000596010 323
329 3300035111 Ga0373923_0010872 Ga0373923_0010872_2193_3173 323
330 3300035172 Ga0373955_0013111 Ga0373955_0013111_2573_3553 323
331 3300035410 Ga0373924_0015934 Ga0373924_0015934_1779_2759 323
332 3300035724 Ga0373933_0019279 Ga0373933_0019279_2754_3734 323
333 3300036401 Ga0373937_0029258 Ga0373937_0029258_2385_3365 323
334 3300037068 Ga0373925_0041213 Ga0373925_0041213_1515_2495 323
335 3300046454 Ga0495592_0005999 Ga0495592_0005999_7747_8727 323
336 3300046459 Ga0495629_0019054 Ga0495629_0019054_2735_3715 323
337 3300046462 Ga0495651_0003482 Ga0495651_0003482_2716_3696 323
338 3300046475 Ga0495639_0051043 Ga0495639_0051043_310_1290 323
339 3300046514 Ga0495618_0001008 Ga0495618_0001008_2655_3635 323
340 3300046516 Ga0495628_0086013 Ga0495628_0086013_1419_2399 323
341 3300046529 Ga0495652_0018566 Ga0495652_0018566_2483_3463 323
342 3300046533 Ga0495640_0013082 Ga0495640_0013082_2620_3600 323
343 3300046559 Ga0495667_0011350 Ga0495667_0011350_4035_5015 323
344 3300046642 Ga0495634_0028224 Ga0495634_0028224_2874_3854 323
345 3300046675 Ga0495657_0042675 Ga0495657_0042675_1835_2815 323
346 3300046679 Ga0495623_0001454 Ga0495623_0001454_1332_2312 323
347 3300046680 Ga0495646_0097961 Ga0495646_0097961_587_1567 323
348 3300046690 Ga0495624_0099694 Ga0495624_0099694_36_1016 323
349 3300046809 Ga0495600_0026453 Ga0495600_0026453_41_1021 323
350 3300047317 Ga0495604_0001548 Ga0495604_0001548_15313_16293 323
351 3300047319 Ga0495674_0004555 Ga0495674_0004555_2670_3650 323
352 3300047322 Ga0495680_0007192 Ga0495680_0007192_6537_7517 323
353 3300047444 Ga0495675_0046477 Ga0495675_0046477_1669_2649 323
354 3300048088 Ga0495602_0018335 Ga0495602_0018335_3223_4203 323
355 3300053078 Ga0495612_0008778 Ga0495612_0008778_2643_3623 323
356 3300053084 Ga0495595_0000901 Ga0495595_0000901_2726_3706 323
357 iso_pu_bacteria 2529292951 2530648899 323
358 iso_pu_bacteria 8056681323 8056681885 323
359 3300003771 Ga0055526_1012112 Ga0055526_10121123 324
360 3300003790 Ga0055528_1000266 Ga0055528_100026642 324
361 3300025273 Ga0209673_1000005 Ga0209673_100000565 324
362 3300025294 Ga0209025_1015999 Ga0209025_10159992 324
363 3300025295 Ga0209564_1008492 Ga0209564_10084922 324
364 3300025299 Ga0209256_1001252 Ga0209256_100125219 324
365 3300031595 Ga0265313_10017938 Ga0265313_100179382 324
366 3300045976 Ga0466967_0180644 Ga0466967_0180644_112_1200 324
367 3300048929 Ga0496126_0197392 Ga0496126_0197392_151_1134 324
368 3300049823 Ga0501044_0052784 Ga0501044_0052784_973_1968 324
369 iso_pu_bacteria 2503198000 2503200471 324
370 iso_pu_bacteria 2508501128 2509148646 324
371 iso_pu_bacteria 2582581316 2585335466 324
372 iso_pu_bacteria 2775507266 2778176932 324
373 iso_pu_bacteria 2842482326 2842484285 324
374 iso_pu_bacteria 2958144490 2958148214 324
375 3300009174 Ga0105241_10056102 Ga0105241_100561021 325
376 3300042008 Ga0439450_009916 Ga0439450_009916_127_1113 325
377 3300048906 Ga0496103_0271853 Ga0496103_0271853_43_1029 325
378 3300048908 Ga0496105_0047601 Ga0496105_0047601_777_1763 325
379 3300048915 Ga0496112_0107322 Ga0496112_0107322_55_1041 325
380 3300048916 Ga0496113_0187729 Ga0496113_0187729_369_1355 325
381 3300048922 Ga0496119_0056763 Ga0496119_0056763_1049_2032 325
382 3300048927 Ga0496124_0167086 Ga0496124_0167086_151_1134 325
383 3300053125 Ga0500618_000190 Ga0500618_000190_40076_41092 325
384 3300060353 Ga0501082_0300851 Ga0501082_0300851_265_1338 325
385 iso_pu_bacteria 2512875016 2512932166 325
386 iso_pu_bacteria 2585427633 2585993344 325
387 iso_pu_bacteria 2588253730 2588518216 325
388 iso_pu_bacteria 2847686936 2847691501 325
389 iso_pu_bacteria 2874102143 2874102774 325
390 iso_pu_bacteria 2876363079 2876367805 325
391 iso_pu_bacteria 2891373044 2891378060 325
392 iso_pu_bacteria 2903448605 2903450584 325
393 iso_pu_bacteria 2903521522 2903521677 325
394 iso_pu_bacteria 2903528002 2903528055 325
395 iso_pu_bacteria 2906328253 2906330318 325
396 iso_pu_bacteria 2909042592 2909045358 325
397 iso_pu_bacteria 2937848649 2937849950 325
398 iso_pu_bacteria 2937891427 2937892108 325
399 iso_pu_bacteria 2958115193 2958116351 325
400 iso_pu_bacteria 2963644680 2963647041 325
401 iso_pu_bacteria 2965062239 2965065768 325
402 iso_pu_bacteria 2968083720 2968088157 325
403 iso_pu_bacteria 2968091066 2968095137 325
404 iso_pu_bacteria 2968097103 2968101864 325
405 iso_pu_bacteria 2968128360 2968130693 325
406 iso_pu_bacteria 2977858184 2977864775 325
407 iso_pu_bacteria 2977922695 2977928564 325
408 iso_pu_bacteria 2977986579 2977992788 325
409 iso_pu_bacteria 2979779861 2979781488 325
410 iso_pu_bacteria 2996893221 2996895456 325
411 iso_pu_bacteria 3004211236 3004215433 325
412 iso_pu_bacteria 3004218560 3004225724 325
413 iso_pu_bacteria 637000159 637075262 325
414 iso_pu_bacteria 8004445564 8004448862 325
415 iso_pu_bacteria 8004703790 8004708957 325
416 iso_pu_bacteria 8005382845 8005384315 325
417 iso_pu_bacteria 8005395548 8005401488 325
418 3300005365 Ga0070688_100130504 Ga0070688_1001305042 326
419 3300005456 Ga0070678_100131626 Ga0070678_1001316262 326
420 3300005548 Ga0070665_100182921 Ga0070665_1001829212 326
421 3300005842 Ga0068858_100132096 Ga0068858_1001320962 326
422 3300009101 Ga0105247_10012304 Ga0105247_100123044 326
423 3300013297 Ga0157378_10010443 Ga0157378_100104434 326
424 3300013308 Ga0157375_10002209 Ga0157375_1000220927 326
425 3300014968 Ga0157379_10100811 Ga0157379_101008113 326
426 3300025900 Ga0207710_10020432 Ga0207710_100204322 326
427 3300026121 Ga0207683_10251259 Ga0207683_102512592 326
428 3300028379 Ga0268266_10389957 Ga0268266_103899571 326
429 3300028381 Ga0268264_10056786 Ga0268264_100567863 326
430 3300048903 Ga0496100_0025159 Ga0496100_0025159_371_1369 326
431 3300048904 Ga0496101_0091530 Ga0496101_0091530_486_1484 326
432 3300048907 Ga0496104_0010694 Ga0496104_0010694_4712_5710 326
433 3300048910 Ga0496107_0008334 Ga0496107_0008334_2274_3272 326
434 3300048911 Ga0496108_0041407 Ga0496108_0041407_366_1364 326
435 3300048912 Ga0496109_0078680 Ga0496109_0078680_1337_2335 326
436 3300048912 Ga0496109_0081879 Ga0496109_0081879_548_1546 326
437 3300048916 Ga0496113_0098800 Ga0496113_0098800_176_1174 326
438 3300048917 Ga0496114_0003929 Ga0496114_0003929_1142_2140 326
439 3300048918 Ga0496115_0006307 Ga0496115_0006307_2947_3945 326
440 3300053158 Ga0500627_0063583 Ga0500627_0063583_71_1060 326
441 iso_pu_bacteria 2871495908 2871502634 326
442 iso_pu_bacteria 2874168670 2874169063 326
443 iso_pu_bacteria 2878760144 2878766526 326
444 iso_pu_bacteria 2878767105 2878773722 326
445 iso_pu_bacteria 2885305155 2885308681 326
446 iso_pu_bacteria 2885326080 2885328799 326
447 iso_pu_bacteria 2903540706 2903547675 326
448 iso_pu_bacteria 2937994558 2938001550 326
449 iso_pu_bacteria 2958165035 2958171704 326
450 iso_pu_bacteria 2961163497 2961170145 326
451 iso_pu_bacteria 2965018300 2965024896 326
452 iso_pu_bacteria 2968171901 2968178537 326
453 iso_pu_bacteria 2970554993 2970561382 326
454 iso_pu_bacteria 2987659509 2987666386 326
455 iso_pu_bacteria 3002141150 3002142290 326
456 iso_pu_bacteria 3004188549 3004195392 326
457 3300025297 Ga0209758_1039505 Ga0209758_10395051 327
458 3300035695 Ga0373927_0094172 Ga0373927_0094172_743_1753 327
459 3300035725 Ga0373947_0098696 Ga0373947_0098696_475_1485 327
460 3300037068 Ga0373925_0063577 Ga0373925_0063577_94_1104 327
461 3300037471 Ga0395905_0000453 Ga0395905_0000453_46968_48026 327
462 3300038735 Ga0400485_11087 Ga0400485_11087_305_1366 327
463 3300038742 Ga0400486_14522 Ga0400486_14522_362_1423 327
464 3300046455 Ga0495603_0012906 Ga0495603_0012906_3720_4730 327
465 3300046459 Ga0495629_0009718 Ga0495629_0009718_4081_5091 327
466 3300046472 Ga0495580_0006645 Ga0495580_0006645_321_1331 327
467 3300046473 Ga0495582_0065990 Ga0495582_0065990_254_1264 327
468 3300046475 Ga0495639_0014679 Ga0495639_0014679_1850_2860 327
469 3300046499 Ga0495594_0045275 Ga0495594_0045275_412_1422 327
470 3300046526 Ga0495666_0106087 Ga0495666_0106087_114_1124 327
471 3300046557 Ga0495622_0048038 Ga0495622_0048038_419_1429 327
472 3300046674 Ga0495588_0058275 Ga0495588_0058275_577_1587 327
473 3300046689 Ga0495613_0012706 Ga0495613_0012706_1433_2443 327
474 3300047315 Ga0495581_0011585 Ga0495581_0011585_459_1469 327
475 3300047322 Ga0495680_0172685 Ga0495680_0172685_348_1358 327
476 3300047673 Ga0495593_0020131 Ga0495593_0020131_1993_3003 327
477 3300048922 Ga0496119_0030687 Ga0496119_0030687_766_1818 327
478 3300048923 Ga0496120_0084150 Ga0496120_0084150_178_1233 327
479 3300049568 Ga0501031_0000202 Ga0501031_0000202_11231_12220 327
480 3300049569 Ga0501032_0000443 Ga0501032_0000443_21728_22717 327
481 3300049570 Ga0501033_0000097 Ga0501033_0000097_11231_12220 327
482 3300049571 Ga0501034_0000186 Ga0501034_0000186_104279_105268 327
483 3300049572 Ga0501036_0000002 Ga0501036_0000002_280889_281878 327
484 3300049573 Ga0501037_0000443 Ga0501037_0000443_11224_12213 327
485 3300049574 Ga0501038_0000867 Ga0501038_0000867_14548_15537 327
486 3300049575 Ga0501039_0000002 Ga0501039_0000002_362933_363922 327
487 3300049576 Ga0501040_0001925 Ga0501040_0001925_5914_6903 327
488 3300049579 Ga0501043_0000543 Ga0501043_0000543_21707_22696 327
489 3300049581 Ga0501047_0002364 Ga0501047_0002364_11162_12151 327
490 3300049586 Ga0501070_0012803 Ga0501070_0012803_4362_5351 327
491 3300049822 Ga0501035_0000100 Ga0501035_0000100_95102_96091 327
492 3300049823 Ga0501044_0000002 Ga0501044_0000002_11231_12220 327
493 3300050492 nmdc:mga0yw44_235089_c1 nmdc:mga0yw44_235089_c1_104_1093 327
494 3300053085 Ga0495619_0014841 Ga0495619_0014841_2727_3737 327
495 iso_pu_bacteria 2617270742 2617386716 327
496 iso_pu_bacteria 2818991461 2819685303 327
497 iso_pu_bacteria 2869162929 2869167496 327
498 iso_pu_bacteria 8056681323 8056689409 327
499 3300002737 JGI25162J39368_1000111 JGI25162J39368_100011125 328
500 3300003214 JGI25165J46597_1000440 JGI25165J46597_100044013 328
501 3300006028 Ga0070717_10035625 Ga0070717_100356252 328
502 3300006941 Ga0099825_1026238 Ga0099825_10262381 328
503 3300006943 Ga0099822_1036162 Ga0099822_10361624 328
504 3300025233 Ga0209437_100064 Ga0209437_10006490 328
505 3300025261 Ga0209233_1000081 Ga0209233_1000081211 328
506 3300027357 Ga0209589_1006990 Ga0209589_100699010 328
507 3300027361 Ga0209489_106620 Ga0209489_1066209 328
508 3300027363 Ga0209700_106374 Ga0209700_10637410 328
509 3300031235 Ga0265330_10006943 Ga0265330_100069433 328
510 3300046455 Ga0495603_0056315 Ga0495603_0056315_130_1125 328
511 iso_pu_bacteria 2510917022 2511131290 328
512 iso_pu_bacteria 2513237090 2513611968 328
513 iso_pu_bacteria 2582581307 2585274499 328
514 iso_pu_bacteria 2585427531 2585561857 328
515 iso_pu_bacteria 2585427608 2585902457 328
516 iso_pu_bacteria 2585427609 2585907588 328
517 iso_pu_bacteria 2585428125 2587983009 328
518 iso_pu_bacteria 2599185301 2599936098 328
519 iso_pu_bacteria 2615840698 2616552678 328
520 iso_pu_bacteria 2667528174 2671113035 328
521 iso_pu_bacteria 2693429783 2694632403 328
522 iso_pu_bacteria 2693429784 2694639153 328
523 iso_pu_bacteria 2818991448 2819613588 328
524 iso_pu_bacteria 2838029111 2838031554 328
525 iso_pu_bacteria 2842475841 2842478286 328
526 iso_pu_bacteria 2842502639 2842505768 328
527 iso_pu_bacteria 2847670302 2847675317 328
528 iso_pu_bacteria 2856314179 2856314877 328
529 iso_pu_bacteria 2856364286 2856366247 328
530 iso_pu_bacteria 2857349434 2857351416 328
531 iso_pu_bacteria 2869285874 2869287282 328
532 iso_pu_bacteria 2871429161 2871430581 328
533 iso_pu_bacteria 2874146452 2874149140 328
534 iso_pu_bacteria 2874155637 2874156073 328
535 iso_pu_bacteria 2876392853 2876394061 328
536 iso_pu_bacteria 2876413966 2876415436 328
537 iso_pu_bacteria 2878035449 2878042120 328
538 iso_pu_bacteria 2878745973 2878747014 328
539 iso_pu_bacteria 2885383462 2885388735 328
540 iso_pu_bacteria 2888350351 2888355502 328
541 iso_pu_bacteria 2889016732 2889017859 328
542 iso_pu_bacteria 2903492973 2903500469 328
543 iso_pu_bacteria 2903768456 2903777793 328
544 iso_pu_bacteria 2904659560 2904660392 328
545 iso_pu_bacteria 2906308376 2906309827 328
546 iso_pu_bacteria 2906321335 2906322462 328
547 iso_pu_bacteria 2906414383 2906419521 328
548 iso_pu_bacteria 2919408235 2919412824 328
549 iso_pu_bacteria 2922130491 2922134202 328
550 iso_pu_bacteria 2937813078 2937814874 328
551 iso_pu_bacteria 2938014810 2938016038 328
552 iso_pu_bacteria 2958041894 2958046704 328
553 iso_pu_bacteria 2958100919 2958104819 328
554 iso_pu_bacteria 2958130278 2958131782 328
555 iso_pu_bacteria 2958172287 2958172894 328
556 iso_pu_bacteria 2958179912 2958180842 328
557 iso_pu_bacteria 2961077736 2961078680 328
558 iso_pu_bacteria 2961114664 2961115717 328
559 iso_pu_bacteria 2965119406 2965124033 328
560 iso_pu_bacteria 2968110612 2968111450 328
561 iso_pu_bacteria 2968117919 2968119720 328
562 iso_pu_bacteria 2977843712 2977845665 328
563 iso_pu_bacteria 2977942078 2977945236 328
564 iso_pu_bacteria 2979710463 2979716463 328
565 iso_pu_bacteria 2987636660 2987638600 328
566 iso_pu_bacteria 2987652177 2987659428 328
567 iso_pu_bacteria 3004203850 3004205157 328
568 iso_pu_bacteria 3005416602 3005420952 328
569 iso_pu_bacteria 8004387939 8004389119 328
570 iso_pu_bacteria 8004640170 8004641027 328
571 iso_pu_bacteria 8004714634 8004716182 328
572 iso_pu_bacteria 8005314921 8005319313 328
573 iso_pu_bacteria 8005484373 8005489348 328
574 iso_pu_bacteria 8005645114 8005650247 328
575 iso_pu_bacteria 8005682033 8005683886 328
576 3300003762 Ga0055542_1000675 Ga0055542_100067515 329
577 3300003763 Ga0055529_1002284 Ga0055529_10022842 329
578 3300005578 Ga0068854_100043279 Ga0068854_1000432794 329
579 3300005614 Ga0068856_100123122 Ga0068856_1001231223 329
580 3300005834 Ga0068851_10071177 Ga0068851_100711773 329
581 3300006042 Ga0075368_10026371 Ga0075368_100263712 329
582 3300006051 Ga0075364_10043782 Ga0075364_100437821 329
583 3300006178 Ga0075367_10124175 Ga0075367_101241752 329
584 3300009174 Ga0105241_10038836 Ga0105241_100388361 329
585 3300010375 Ga0105239_10040094 Ga0105239_100400947 329
586 3300010375 Ga0105239_10100974 Ga0105239_101009741 329
587 3300010375 Ga0105239_10216133 Ga0105239_102161332 329
588 3300013296 Ga0157374_10052373 Ga0157374_100523734 329
589 3300014497 Ga0182008_10008376 Ga0182008_100083763 329
590 3300025233 Ga0209437_104235 Ga0209437_1042353 329
591 3300025253 Ga0209677_102562 Ga0209677_1025623 329
592 3300025254 Ga0209148_1000124 Ga0209148_100012412 329
593 3300025261 Ga0209233_1000203 Ga0209233_100020318 329
594 3300025272 Ga0209455_1000062 Ga0209455_1000062239 329
595 3300025911 Ga0207654_10054593 Ga0207654_100545932 329
596 3300025913 Ga0207695_10000118 Ga0207695_10000118103 329
597 3300025914 Ga0207671_10001634 Ga0207671_100016347 329
598 3300025981 Ga0207640_10070828 Ga0207640_100708283 329
599 3300025981 Ga0207640_10075654 Ga0207640_100756541 329
600 3300026041 Ga0207639_10335319 Ga0207639_103353192 329
601 3300026078 Ga0207702_10365015 Ga0207702_103650151 329
602 3300026142 Ga0207698_10242608 Ga0207698_102426081 329
603 3300028379 Ga0268266_10031949 Ga0268266_100319494 329
604 3300028379 Ga0268266_10055237 Ga0268266_100552372 329
605 3300037466 Ga0395898_0106615 Ga0395898_0106615_573_1571 329
606 3300048915 Ga0496112_0035556 Ga0496112_0035556_2440_3498 329
607 3300053125 Ga0500618_007745 Ga0500618_007745_1918_2928 329
608 iso_pu_bacteria 3004334049 3004335269 329
609 3300009545 Ga0105237_10012127 Ga0105237_100121275 330
610 3300013105 Ga0157369_10204921 Ga0157369_102049211 330
611 3300027296 Ga0209389_1000260 Ga0209389_100026017 330
612 3300027361 Ga0209489_104601 Ga0209489_10460114 330
613 3300027363 Ga0209700_102937 Ga0209700_10293718 330
614 3300031712 Ga0265342_10006640 Ga0265342_100066407 330
615 3300038443 Ga0395901_0613680 Ga0395901_0613680_70_1071 330
616 3300039450 Ga0436363_1586464 Ga0436363_1586464_1479_2480 330
617 3300046507 Ga0495606_0149738 Ga0495606_0149738_49_1050 330
618 3300002705 JGI25156J39149_1008154 JGI25156J39149_10081542 331
619 3300002741 JGI25157J39369_1000667 JGI25157J39369_10006678 331
620 3300005548 Ga0070665_100013224 Ga0070665_1000132247 331
621 3300006175 Ga0070712_100145639 Ga0070712_1001456392 331
622 3300009176 Ga0105242_10243320 Ga0105242_102433201 331
623 3300025250 Ga0209026_1000247 Ga0209026_100024752 331
624 3300025256 Ga0209759_1000585 Ga0209759_100058521 331
625 3300025261 Ga0209233_1012521 Ga0209233_10125213 331
626 3300025915 Ga0207693_10018579 Ga0207693_100185791 331
627 3300028379 Ga0268266_10050305 Ga0268266_100503054 331
628 3300047472 Ga0495686_0000547 Ga0495686_0000547_5235_6239 331
629 3300048903 Ga0496100_0135721 Ga0496100_0135721_221_1285 331
630 3300002067 JGI24735J21928_10057478 JGI24735J21928_100574781 332
631 3300002704 JGI25155J39150_1000183 JGI25155J39150_100018322 332
632 3300002705 JGI25156J39149_1000405 JGI25156J39149_100040522 332
633 3300002738 JGI25154J39366_1000342 JGI25154J39366_10003423 332
634 3300002741 JGI25157J39369_1000437 JGI25157J39369_100043722 332
635 3300003214 JGI25165J46597_1000006 JGI25165J46597_1000006218 332
636 3300003214 JGI25165J46597_1000018 JGI25165J46597_1000018185 332
637 3300003322 rootL2_10017530 rootL2_100175308 332
638 3300003323 rootH1_10007065 rootH1_1000706518 332
639 3300003323 rootH1_10102124 rootH1_101021246 332
640 3300005331 Ga0070670_100017672 Ga0070670_1000176725 332
641 3300005539 Ga0068853_100006123 Ga0068853_1000061235 332
642 3300005577 Ga0068857_100168348 Ga0068857_1001683481 332
643 3300005614 Ga0068856_100008489 Ga0068856_1000084896 332
644 3300005614 Ga0068856_100239981 Ga0068856_1002399812 332
645 3300006178 Ga0075367_10102900 Ga0075367_101029002 332
646 3300006943 Ga0099822_1008884 Ga0099822_100888410 332
647 3300009545 Ga0105237_10197811 Ga0105237_101978112 332
648 3300010375 Ga0105239_10318958 Ga0105239_103189582 332
649 3300025206 Ga0209435_100039 Ga0209435_100039106 332
650 3300025228 Ga0209672_103894 Ga0209672_1038943 332
651 3300025233 Ga0209437_100022 Ga0209437_100022247 332
652 3300025246 Ga0209646_1000137 Ga0209646_10001375 332
653 3300025250 Ga0209026_1000135 Ga0209026_1000135106 332
654 3300025256 Ga0209759_1000154 Ga0209759_10001545 332
655 3300025261 Ga0209233_1000010 Ga0209233_1000010799 332
656 3300025261 Ga0209233_1000031 Ga0209233_1000031247 332
657 3300025297 Ga0209758_1008525 Ga0209758_10085255 332
658 3300025904 Ga0207647_10004530 Ga0207647_100045301 332
659 3300025924 Ga0207694_10027043 Ga0207694_100270432 332
660 3300025925 Ga0207650_10011291 Ga0207650_100112913 332
661 3300025939 Ga0207665_10169100 Ga0207665_101691001 332
662 3300025949 Ga0207667_10280376 Ga0207667_102803761 332
663 3300026041 Ga0207639_10023099 Ga0207639_100230993 332
664 3300026078 Ga0207702_10026926 Ga0207702_100269263 332
665 3300026116 Ga0207674_10568160 Ga0207674_105681601 332
666 3300027296 Ga0209389_1000046 Ga0209389_100004649 332
667 3300027312 Ga0209371_1001381 Ga0209371_100138112 332
668 3300027357 Ga0209589_1000175 Ga0209589_100017545 332
669 3300027361 Ga0209489_100112 Ga0209489_10011249 332
670 3300027363 Ga0209700_100029 Ga0209700_10002992 332
671 3300030500 Ga0268256_1000851 Ga0268256_100085112 332
672 3300035695 Ga0373927_0102367 Ga0373927_0102367_833_1840 332
673 3300037418 Ga0395900_0046118 Ga0395900_0046118_1110_2108 332
674 3300037471 Ga0395905_0100559 Ga0395905_0100559_1553_2551 332
675 3300037471 Ga0395905_0128431 Ga0395905_0128431_597_1595 332
676 3300038443 Ga0395901_0218817 Ga0395901_0218817_470_1468 332
677 3300044658 Ga0466972_0043178 Ga0466972_0043178_1028_2026 332
678 3300046507 Ga0495606_0001553 Ga0495606_0001553_24405_25460 332
679 3300048905 Ga0496102_0051287 Ga0496102_0051287_1164_2162 332
680 3300048906 Ga0496103_0051952 Ga0496103_0051952_584_1582 332
681 3300048910 Ga0496107_0218641 Ga0496107_0218641_53_1066 332
682 3300048915 Ga0496112_0134220 Ga0496112_0134220_973_1971 332
683 3300048922 Ga0496119_0025321 Ga0496119_0025321_578_1576 332
684 3300048923 Ga0496120_0002639 Ga0496120_0002639_14092_15090 332
685 3300048924 Ga0496121_0037640 Ga0496121_0037640_2765_3820 332
686 3300048926 Ga0496123_0008448 Ga0496123_0008448_5752_6984 332
687 3300050492 nmdc:mga0yw44_241515_c1 nmdc:mga0yw44_241515_c1_49_1047 332
688 3300050492 nmdc:mga0yw44_38577_c1 nmdc:mga0yw44_38577_c1_28_1077 332
689 3300053122 Ga0500608_117869 Ga0500608_117869_132_1136 332
690 iso_pu_bacteria 2585427634 2586003993 332

Structural Annotation

Top 5 Hits

ID Description Score Start End
4y4v-assembly1.cif.gz_B structure of helicobacter pylori csd6 in the d-ala-bound state 0.5747 75 263
7o21-assembly1.cif.gz_A structure of bdellovibrio bacteriovorus bd1075 0.5659 98 263
1pn2-assembly2.cif.gz_C crystal structure analysis of the selenomethionine labelled 2-enoyl-coa hydratase 2 domain of candida tropicalis multifunctional enzyme type 2 0.5207 146 179
1pn2-assembly1.cif.gz_B crystal structure analysis of the selenomethionine labelled 2-enoyl-coa hydratase 2 domain of candida tropicalis multifunctional enzyme type 2 0.5118 146 179
4ml9-assembly1.cif.gz_A crystal structure of uncharacterized tim barrel protein with the conserved phosphate binding site fromsebaldella termitidis 0.4853 290 318
ID Description Score Start End Superfamily
af_Q9U2U6_567_691_3.30.1520.10 Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain 0.6795 152 197 3.30.1520.10
af_Q8LSQ2_65_122_2.40.50.40 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.5729 154 181 2.40.50.40
af_Q6MWW2_15_285_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.5369 148 179 3.10.129.10
1pn2C01 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.512 144 179 3.10.129.10
4h83D01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.5037 145 180 3.30.390.10
ID Description Score Start End GO Terms
AF-G2E0M9-F1-model_v4 ErfK/YbiS/YcfS/YnhG family protein 0.9507 28 331
AF-A0A435C132-F1-model_v4 deleted 0.9504 81 332
AF-A0A0A8K4M9-F1-model_v4 YkuD domain-containing protein 0.9419 30 332
AF-A0A435C132-F1-model_v4 deleted 0.9393 81 332
AF-N6V0H3-F1-model_v4 YkuD domain-containing protein 0.9392 28 331

Feature Viewer

pLDDT pTM Quality
82.21 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map