F475438
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 690 | 531 | 413 | 327 |
Family's Representative Sequence
| Representative Sequence | 3300006186|Ga0075369_10002867|Ga0075369_100028675 |
| Length | 364 |
| Sequence | MARLAHMLKATPRTRRMEILEAAFGSRFGRPTSSVRPKSRLAKGVGVACLFFGAAIAGGSSGALAAGIPSWLMTYVGEGQGQIALPVLQRARALYIQKASQGAVSNPCYFAMDATRPNDPGSSGGRFYIICESQHSFRAISAGHGGGRNLRGVADFSNGRRCARHFGNAQDSELTTGGSYVTAETKTSFKGYYRVAANQDAAFLRSFIQFDGVGETANARQRAIGGHAAVALKGVCLRKAPSSPYANQDGYVPFGKLVDYAGGRSNGCTSWSLGDVKQILSMVRDYPTTLYIYPEAADVSNVARAVAAGQSPARAGLYWNAACLREIGAPKYWSRQVLEPVLAQYKLDHPAPPPRPTPICEGSE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 3 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 4 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 5 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 6 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 7 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 8 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 9 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 10 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 11 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 12 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 13 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 14 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 15 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 16 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 17 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 18 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 19 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 20 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 21 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 22 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 23 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 24 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 25 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 26 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 27 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 28 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 29 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 30 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 31 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 32 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 33 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 34 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 35 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 36 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 37 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 38 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 39 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 40 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 41 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 42 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 43 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 44 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 45 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 46 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 47 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 48 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 49 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 50 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 51 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 52 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 53 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 54 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 55 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 56 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 57 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 58 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 59 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 60 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 61 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 62 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 63 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 64 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 65 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 66 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 67 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 68 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 69 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 70 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 71 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 72 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 73 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 74 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 75 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 76 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 77 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 78 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 79 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 80 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 81 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 82 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 83 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 84 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 85 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 86 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 87 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 88 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 89 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 90 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 91 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 92 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 93 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 94 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 95 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 96 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 97 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 98 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 99 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 100 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 101 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 102 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 103 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 104 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 105 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 106 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 107 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 108 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 109 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 110 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 111 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 112 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 113 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 114 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 115 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 116 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 117 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 118 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 119 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 120 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 121 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 122 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 123 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 124 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 125 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 126 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 127 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 128 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 129 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 130 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 131 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 132 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 133 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 134 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 135 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 136 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 137 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 138 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 139 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 140 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 141 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 142 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 143 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 144 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 145 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 146 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 147 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 148 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 149 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 150 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 151 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 152 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 153 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 154 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 155 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 156 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 157 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 158 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 159 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 160 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 161 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 162 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 163 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 164 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 165 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 166 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 167 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 168 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 169 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 170 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 171 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 172 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 173 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 174 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 175 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 176 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 177 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 178 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 179 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 180 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 181 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 182 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 183 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 184 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 185 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 186 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 187 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 188 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 189 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 190 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 191 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 192 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 193 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 194 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 195 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 196 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 197 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 198 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 199 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 200 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 201 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 202 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 203 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 204 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 205 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 206 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 207 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 208 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 209 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 210 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 211 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 212 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 213 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 214 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 215 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 216 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 217 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 218 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 219 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 220 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 221 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 222 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 223 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 224 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 225 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 226 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 227 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 228 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 229 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 230 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 231 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 232 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 233 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 234 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 235 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 236 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 237 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 238 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 239 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 240 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 241 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 242 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 243 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 244 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 245 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 246 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 247 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 248 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 249 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 250 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 251 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 252 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 253 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 254 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 255 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 256 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 257 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 258 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 259 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 260 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 261 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 262 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 263 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 264 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 265 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 266 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 267 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 268 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 269 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 270 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 271 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 272 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 273 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 274 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 275 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 276 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 277 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 278 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 279 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 280 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 281 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 282 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 283 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 284 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 285 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 286 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 287 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 288 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 289 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 290 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 291 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 292 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 293 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 294 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 295 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 296 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 297 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 298 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 299 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 300 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 301 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 302 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 303 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 304 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 305 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 306 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 308 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 310 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 311 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 312 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 313 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 314 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 315 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 316 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 317 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 318 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 319 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 320 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 321 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 322 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 323 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 324 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 325 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 326 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 327 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 328 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 329 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 330 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 331 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 332 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 333 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 334 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 335 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 336 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 337 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 338 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 339 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 340 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 341 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 342 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 343 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 344 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 368 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 370 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 371 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 372 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 373 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 376 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 377 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 378 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 379 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 380 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 381 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 382 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 383 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 384 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 385 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 386 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 387 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 388 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 389 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 390 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 391 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 392 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 393 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 394 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 395 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 396 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 397 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 398 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 399 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 400 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 401 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 402 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 440 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 441 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 442 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 443 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 444 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 445 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 446 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 447 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 448 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 449 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 450 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 451 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 452 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 453 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 454 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 455 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 456 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 457 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 458 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 459 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 460 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 461 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 462 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 463 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 464 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 465 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 468 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 469 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 470 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 472 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 473 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 474 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 475 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 476 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 477 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 478 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 479 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 480 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 481 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 482 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 483 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 484 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 485 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 486 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 487 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 488 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 489 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 490 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 491 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 492 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 493 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 494 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 495 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 496 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 497 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 498 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 503 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 504 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 505 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 506 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 507 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 508 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 509 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 510 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 511 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 512 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 513 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 514 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 515 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 516 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 517 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 518 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 519 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 520 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 521 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 522 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 523 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 524 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 525 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 526 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 527 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 528 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 529 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 530 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 531 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 59.86 |
| Metatranscriptomes | 0 |
| Isolates | 40.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.86 |
| Nodule | 34.93 |
| Rhizoplane | 6.38 |
| Rhizosphere | 38.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10057478 | 3300002067 | Bacteria | 1119 |
| 2 | JGI25155J39150_1000183 | 3300002704 | Bacteria | 26908 |
| 3 | JGI25156J39149_1000405 | 3300002705 | Bacteria | 27011 |
| 4 | JGI25156J39149_1008154 | 3300002705 | Bacteria | 2667 |
| 5 | JGI25162J39368_1000111 | 3300002737 | Bacteria | 89317 |
| 6 | JGI25154J39366_1000342 | 3300002738 | Bacteria | 26841 |
| 7 | JGI25157J39369_1000437 | 3300002741 | Bacteria | 27009 |
| 8 | JGI25157J39369_1000667 | 3300002741 | Bacteria | 18873 |
| 9 | JGI25150J39212_1000028 | 3300002774 | Bacteria | 105831 |
| 10 | JGI25151J46595_10000123 | 3300003187 | Bacteria | 105339 |
| 11 | JGI25151J46595_10000582 | 3300003187 | Bacteria | 32553 |
| 12 | JGI25165J46597_1000006 | 3300003214 | Bacteria | 529784 |
| 13 | JGI25165J46597_1000018 | 3300003214 | Bacteria | 374701 |
| 14 | JGI25165J46597_1000440 | 3300003214 | Bacteria | 41868 |
| 15 | rootL2_10017530 | 3300003322 | Bacteria | 26451 |
| 16 | rootH1_10007065 | 3300003323 | Bacteria | 26406 |
| 17 | rootH1_10102124 | 3300003323 | Bacteria | 4348 |
| 18 | JGI25160J50197_1000095 | 3300003354 | Bacteria | 88326 |
| 19 | JGI25161J50226_1000071 | 3300003374 | Bacteria | 88326 |
| 20 | Ga0055542_1000675 | 3300003762 | Bacteria | 27508 |
| 21 | Ga0055529_1002284 | 3300003763 | Bacteria | 3859 |
| 22 | Ga0055526_1012112 | 3300003771 | Bacteria | 3799 |
| 23 | Ga0055528_1000266 | 3300003790 | Bacteria | 44336 |
| 24 | Ga0055543_1000250 | 3300004625 | Bacteria | 40740 |
| 25 | Ga0065165_1000408 | 3300005262 | Bacteria | 68789 |
| 26 | Ga0070670_100017672 | 3300005331 | Bacteria | 6119 |
| 27 | Ga0070688_100013794 | 3300005365 | Bacteria | 4568 |
| 28 | Ga0070688_100130504 | 3300005365 | Bacteria | 1695 |
| 29 | Ga0070659_100003500 | 3300005366 | Bacteria | 11180 |
| 30 | Ga0070663_100014193 | 3300005455 | Bacteria | 5107 |
| 31 | Ga0070678_100131626 | 3300005456 | Bacteria | 1988 |
| 32 | Ga0070662_100002562 | 3300005457 | Bacteria | 11193 |
| 33 | Ga0070662_100130501 | 3300005457 | Unclassified | 1937 |
| 34 | Ga0070697_100235397 | 3300005536 | Bacteria | 1563 |
| 35 | Ga0068853_100006123 | 3300005539 | Bacteria | 9526 |
| 36 | Ga0068853_100521709 | 3300005539 | Bacteria | 1123 |
| 37 | Ga0070695_100337804 | 3300005545 | Bacteria | 1125 |
| 38 | Ga0070696_100280550 | 3300005546 | Bacteria | 1270 |
| 39 | Ga0070665_100013224 | 3300005548 | Bacteria | 8314 |
| 40 | Ga0070665_100117858 | 3300005548 | Bacteria | 2658 |
| 41 | Ga0070665_100182921 | 3300005548 | Bacteria | 2096 |
| 42 | Ga0070704_100023332 | 3300005549 | Bacteria | 4039 |
| 43 | Ga0068857_100023552 | 3300005577 | Bacteria | 5421 |
| 44 | Ga0068857_100168348 | 3300005577 | Bacteria | 1991 |
| 45 | Ga0068854_100043279 | 3300005578 | Bacteria | 3191 |
| 46 | Ga0068856_100008489 | 3300005614 | Bacteria | 9991 |
| 47 | Ga0068856_100123122 | 3300005614 | Bacteria | 2596 |
| 48 | Ga0068856_100239981 | 3300005614 | Bacteria | 1828 |
| 49 | Ga0068856_100248267 | 3300005614 | Bacteria | 1795 |
| 50 | Ga0068851_10071177 | 3300005834 | Bacteria | 1799 |
| 51 | Ga0068858_100132096 | 3300005842 | Bacteria | 2342 |
| 52 | Ga0068858_100479678 | 3300005842 | Bacteria | 1200 |
| 53 | Ga0081455_10004397 | 3300005937 | Bacteria | 15843 |
| 54 | Ga0081455_10048374 | 3300005937 | Bacteria | 3675 |
| 55 | Ga0081455_10279987 | 3300005937 | Bacteria | 1205 |
| 56 | Ga0081540_1012683 | 3300005983 | Bacteria | 5529 |
| 57 | Ga0070717_10035625 | 3300006028 | Bacteria | 4031 |
| 58 | Ga0075368_10026371 | 3300006042 | Bacteria | 2235 |
| 59 | Ga0075364_10043782 | 3300006051 | Bacteria | 2911 |
| 60 | Ga0070712_100005373 | 3300006175 | Bacteria | 7933 |
| 61 | Ga0070712_100145639 | 3300006175 | Bacteria | 1813 |
| 62 | Ga0075362_10020877 | 3300006177 | Bacteria | 2740 |
| 63 | Ga0075362_10145230 | 3300006177 | Bacteria | 1135 |
| 64 | Ga0075367_10102900 | 3300006178 | Bacteria | 1747 |
| 65 | Ga0075367_10124175 | 3300006178 | Bacteria | 1592 |
| 66 | Ga0075369_10002867 | 3300006186 | Bacteria | 6216 |
| 67 | Ga0075370_10020400 | 3300006353 | Bacteria | 3622 |
| 68 | Ga0075428_100045321 | 3300006844 | Bacteria | 4832 |
| 69 | Ga0075431_100144562 | 3300006847 | Bacteria | 2451 |
| 70 | Ga0075433_10003583 | 3300006852 | Bacteria | 11991 |
| 71 | Ga0075434_100003765 | 3300006871 | Bacteria | 13550 |
| 72 | Ga0075436_100021371 | 3300006914 | Bacteria | 4443 |
| 73 | Ga0099825_1026238 | 3300006941 | Bacteria | 3128 |
| 74 | Ga0099822_1008884 | 3300006943 | Bacteria | 12777 |
| 75 | Ga0099822_1036162 | 3300006943 | Bacteria | 3126 |
| 76 | Ga0075435_100007194 | 3300007076 | Bacteria | 7915 |
| 77 | Ga0105251_10077404 | 3300009011 | Bacteria | 1542 |
| 78 | Ga0105240_10244742 | 3300009093 | Bacteria | 2077 |
| 79 | Ga0111539_10052616 | 3300009094 | Bacteria | 4848 |
| 80 | Ga0105247_10012304 | 3300009101 | Bacteria | 5140 |
| 81 | Ga0105247_10024565 | 3300009101 | Bacteria | 3632 |
| 82 | Ga0114129_10019913 | 3300009147 | Bacteria | 9550 |
| 83 | Ga0105241_10038836 | 3300009174 | Bacteria | 3589 |
| 84 | Ga0105241_10056102 | 3300009174 | Bacteria | 3020 |
| 85 | Ga0105242_10009636 | 3300009176 | Bacteria | 7402 |
| 86 | Ga0105242_10243320 | 3300009176 | Bacteria | 1618 |
| 87 | Ga0105237_10012127 | 3300009545 | Bacteria | 9094 |
| 88 | Ga0105237_10197811 | 3300009545 | Bacteria | 2009 |
| 89 | Ga0105249_10103373 | 3300009553 | Bacteria | 2683 |
| 90 | Ga0123342_1019876 | 3300009766 | Bacteria | 5024 |
| 91 | Ga0105239_10040094 | 3300010375 | Bacteria | 5130 |
| 92 | Ga0105239_10100974 | 3300010375 | Bacteria | 3192 |
| 93 | Ga0105239_10216133 | 3300010375 | Bacteria | 2149 |
| 94 | Ga0105239_10318958 | 3300010375 | Bacteria | 1752 |
| 95 | Ga0105246_10002703 | 3300011119 | Bacteria | 10735 |
| 96 | Ga0157369_10025687 | 3300013105 | Bacteria | 6536 |
| 97 | Ga0157369_10204921 | 3300013105 | Bacteria | 2069 |
| 98 | Ga0157374_10052373 | 3300013296 | Bacteria | 3801 |
| 99 | Ga0157374_10409901 | 3300013296 | Bacteria | 1353 |
| 100 | Ga0157378_10010443 | 3300013297 | Bacteria | 8110 |
| 101 | Ga0157378_10025475 | 3300013297 | Bacteria | 5207 |
| 102 | Ga0157375_10002209 | 3300013308 | Bacteria | 16831 |
| 103 | Ga0157375_10011082 | 3300013308 | Bacteria | 7949 |
| 104 | Ga0182008_10008376 | 3300014497 | Bacteria | 5646 |
| 105 | Ga0157379_10100811 | 3300014968 | Bacteria | 2592 |
| 106 | Ga0157376_10221147 | 3300014969 | Bacteria | 1754 |
| 107 | Ga0209435_100039 | 3300025206 | Bacteria | 116879 |
| 108 | Ga0209436_104527 | 3300025208 | Bacteria | 3421 |
| 109 | Ga0209672_103894 | 3300025228 | Bacteria | 2931 |
| 110 | Ga0209437_100022 | 3300025233 | Bacteria | 625694 |
| 111 | Ga0209437_100064 | 3300025233 | Bacteria | 334360 |
| 112 | Ga0209437_104235 | 3300025233 | Bacteria | 2543 |
| 113 | Ga0207425_1000077 | 3300025245 | Bacteria | 105391 |
| 114 | Ga0209646_1000137 | 3300025246 | Bacteria | 116791 |
| 115 | Ga0209026_1000135 | 3300025250 | Bacteria | 117001 |
| 116 | Ga0209026_1000247 | 3300025250 | Bacteria | 68920 |
| 117 | Ga0209677_102562 | 3300025253 | Bacteria | 6698 |
| 118 | Ga0209148_1000124 | 3300025254 | Bacteria | 185123 |
| 119 | Ga0209759_1000154 | 3300025256 | Bacteria | 119427 |
| 120 | Ga0209759_1000585 | 3300025256 | Bacteria | 35847 |
| 121 | Ga0209129_1000036 | 3300025258 | Bacteria | 328331 |
| 122 | Ga0209129_1000070 | 3300025258 | Bacteria | 212476 |
| 123 | Ga0209233_1000010 | 3300025261 | Bacteria | 1194329 |
| 124 | Ga0209233_1000031 | 3300025261 | Bacteria | 624646 |
| 125 | Ga0209233_1000081 | 3300025261 | Bacteria | 336832 |
| 126 | Ga0209233_1000203 | 3300025261 | Bacteria | 118984 |
| 127 | Ga0209233_1012521 | 3300025261 | Bacteria | 2458 |
| 128 | Ga0209455_1000062 | 3300025272 | Bacteria | 335169 |
| 129 | Ga0209673_1000005 | 3300025273 | Bacteria | 692788 |
| 130 | Ga0209673_1015706 | 3300025273 | Bacteria | 2862 |
| 131 | Ga0209130_1000180 | 3300025284 | Bacteria | 89520 |
| 132 | Ga0209025_1000239 | 3300025294 | Bacteria | 128436 |
| 133 | Ga0209025_1000329 | 3300025294 | Bacteria | 105391 |
| 134 | Ga0209025_1015999 | 3300025294 | Bacteria | 4468 |
| 135 | Ga0209564_1008492 | 3300025295 | Bacteria | 5059 |
| 136 | Ga0209758_1000259 | 3300025297 | Bacteria | 105391 |
| 137 | Ga0209758_1008525 | 3300025297 | Bacteria | 6609 |
| 138 | Ga0209758_1016180 | 3300025297 | Bacteria | 3804 |
| 139 | Ga0209758_1039505 | 3300025297 | Bacteria | 1794 |
| 140 | Ga0209256_1001252 | 3300025299 | Bacteria | 27983 |
| 141 | Ga0207426_1000017 | 3300025302 | Bacteria | 577913 |
| 142 | Ga0209051_1014356 | 3300025303 | Bacteria | 3702 |
| 143 | Ga0207710_10020432 | 3300025900 | Bacteria | 2831 |
| 144 | Ga0207647_10004530 | 3300025904 | Bacteria | 10300 |
| 145 | Ga0207654_10054593 | 3300025911 | Bacteria | 2310 |
| 146 | Ga0207695_10000118 | 3300025913 | Bacteria | 237085 |
| 147 | Ga0207671_10001634 | 3300025914 | Bacteria | 25505 |
| 148 | Ga0207693_10018579 | 3300025915 | Bacteria | 5535 |
| 149 | Ga0207693_10025573 | 3300025915 | Bacteria | 4680 |
| 150 | Ga0207657_10017311 | 3300025919 | Bacteria | 6914 |
| 151 | Ga0207681_10297578 | 3300025923 | Bacteria | 1276 |
| 152 | Ga0207694_10027043 | 3300025924 | Bacteria | 4367 |
| 153 | Ga0207650_10011291 | 3300025925 | Bacteria | 6145 |
| 154 | Ga0207690_10012744 | 3300025932 | Bacteria | 5038 |
| 155 | Ga0207706_10005948 | 3300025933 | Bacteria | 11347 |
| 156 | Ga0207706_10127767 | 3300025933 | Bacteria | 2235 |
| 157 | Ga0207665_10169100 | 3300025939 | Bacteria | 1577 |
| 158 | Ga0207679_10021491 | 3300025945 | Bacteria | 4376 |
| 159 | Ga0207667_10280376 | 3300025949 | Bacteria | 1703 |
| 160 | Ga0207668_10042642 | 3300025972 | Bacteria | 3074 |
| 161 | Ga0207668_10142162 | 3300025972 | Bacteria | 1847 |
| 162 | Ga0207640_10070828 | 3300025981 | Bacteria | 2347 |
| 163 | Ga0207640_10075654 | 3300025981 | Bacteria | 2283 |
| 164 | Ga0207639_10023099 | 3300026041 | Bacteria | 4487 |
| 165 | Ga0207639_10335319 | 3300026041 | Bacteria | 1347 |
| 166 | Ga0207678_10005382 | 3300026067 | Bacteria | 11465 |
| 167 | Ga0207702_10026926 | 3300026078 | Bacteria | 4775 |
| 168 | Ga0207702_10365015 | 3300026078 | Bacteria | 1385 |
| 169 | Ga0207674_10031304 | 3300026116 | Bacteria | 5590 |
| 170 | Ga0207674_10568160 | 3300026116 | Bacteria | 1096 |
| 171 | Ga0207683_10054109 | 3300026121 | Bacteria | 3519 |
| 172 | Ga0207683_10251259 | 3300026121 | Bacteria | 1614 |
| 173 | Ga0207698_10242608 | 3300026142 | Bacteria | 1643 |
| 174 | Ga0209389_1000046 | 3300027296 | Bacteria | 117363 |
| 175 | Ga0209389_1000260 | 3300027296 | Bacteria | 33559 |
| 176 | Ga0209371_1001381 | 3300027312 | Bacteria | 16726 |
| 177 | Ga0209589_1000175 | 3300027357 | Bacteria | 73346 |
| 178 | Ga0209589_1006990 | 3300027357 | Bacteria | 18386 |
| 179 | Ga0209489_100112 | 3300027361 | Bacteria | 117364 |
| 180 | Ga0209489_104601 | 3300027361 | Bacteria | 25214 |
| 181 | Ga0209489_106620 | 3300027361 | Bacteria | 18386 |
| 182 | Ga0209700_100029 | 3300027363 | Bacteria | 214607 |
| 183 | Ga0209700_102937 | 3300027363 | Bacteria | 33569 |
| 184 | Ga0209700_106374 | 3300027363 | Bacteria | 18386 |
| 185 | Ga0207428_10005960 | 3300027907 | Bacteria | 11285 |
| 186 | Ga0268266_10031949 | 3300028379 | Bacteria | 4473 |
| 187 | Ga0268266_10050305 | 3300028379 | Bacteria | 3575 |
| 188 | Ga0268266_10055237 | 3300028379 | Bacteria | 3414 |
| 189 | Ga0268266_10389957 | 3300028379 | Bacteria | 1315 |
| 190 | Ga0268264_10056786 | 3300028381 | Bacteria | 3273 |
| 191 | Ga0268256_1000851 | 3300030500 | Bacteria | 21457 |
| 192 | Ga0265330_10006943 | 3300031235 | Bacteria | 5561 |
| 193 | Ga0265313_10017938 | 3300031595 | Bacteria | 3996 |
| 194 | Ga0265342_10006640 | 3300031712 | Bacteria | 8587 |
| 195 | Ga0307412_10048640 | 3300031911 | Bacteria | 2790 |
| 196 | Ga0373928_0013404 | 3300035084 | Unclassified | 1646 |
| 197 | Ga0373923_0010872 | 3300035111 | Bacteria | 3324 |
| 198 | Ga0373955_0013111 | 3300035172 | Bacteria | 3998 |
| 199 | Ga0373924_0015934 | 3300035410 | Bacteria | 2864 |
| 200 | Ga0373927_0094172 | 3300035695 | Unclassified | 1946 |
| 201 | Ga0373927_0102367 | 3300035695 | Bacteria | 1863 |
| 202 | Ga0373933_0019279 | 3300035724 | Bacteria | 3850 |
| 203 | Ga0373947_0098696 | 3300035725 | Bacteria | 1832 |
| 204 | Ga0373937_0029258 | 3300036401 | Bacteria | 4988 |
| 205 | Ga0316582_0121807 | 3300036647 | Bacteria | 1746 |
| 206 | Ga0373925_0041213 | 3300037068 | Bacteria | 3422 |
| 207 | Ga0373925_0063577 | 3300037068 | Bacteria | 2777 |
| 208 | Ga0395899_0236486 | 3300037312 | Bacteria | 1259 |
| 209 | Ga0395900_0046118 | 3300037418 | Bacteria | 4488 |
| 210 | Ga0395900_0052058 | 3300037418 | Bacteria | 4215 |
| 211 | Ga0395900_0187635 | 3300037418 | Bacteria | 2098 |
| 212 | Ga0395898_0098236 | 3300037466 | Bacteria | 2811 |
| 213 | Ga0395898_0106615 | 3300037466 | Bacteria | 2687 |
| 214 | Ga0395905_0000453 | 3300037471 | Bacteria | 57443 |
| 215 | Ga0395905_0100559 | 3300037471 | Bacteria | 2715 |
| 216 | Ga0395905_0122792 | 3300037471 | Bacteria | 2442 |
| 217 | Ga0395905_0128431 | 3300037471 | Bacteria | 2384 |
| 218 | Ga0395905_0653430 | 3300037471 | Bacteria | 953 |
| 219 | Ga0395901_0215888 | 3300038443 | Bacteria | 2006 |
| 220 | Ga0395901_0218817 | 3300038443 | Bacteria | 1991 |
| 221 | Ga0395901_0474374 | 3300038443 | Bacteria | 1277 |
| 222 | Ga0395901_0613680 | 3300038443 | Bacteria | 1095 |
| 223 | Ga0400485_11087 | 3300038735 | Bacteria | 1905 |
| 224 | Ga0400486_14522 | 3300038742 | Bacteria | 2209 |
| 225 | Ga0436360_0934992 | 3300039438 | Bacteria | 2612 |
| 226 | Ga0436363_1586464 | 3300039450 | Bacteria | 5105 |
| 227 | Ga0439450_009916 | 3300042008 | Bacteria | 1823 |
| 228 | Ga0466972_0043178 | 3300044658 | Bacteria | 2190 |
| 229 | Ga0466967_0180644 | 3300045976 | Bacteria | 1990 |
| 230 | Ga0466967_0407301 | 3300045976 | Bacteria | 1324 |
| 231 | Ga0495592_0005999 | 3300046454 | Bacteria | 9031 |
| 232 | Ga0495603_0012906 | 3300046455 | Bacteria | 5051 |
| 233 | Ga0495603_0056315 | 3300046455 | Bacteria | 2328 |
| 234 | Ga0495629_0009718 | 3300046459 | Bacteria | 7024 |
| 235 | Ga0495629_0019054 | 3300046459 | Bacteria | 4907 |
| 236 | Ga0495651_0003482 | 3300046462 | Bacteria | 12066 |
| 237 | Ga0495580_0006645 | 3300046472 | Bacteria | 9397 |
| 238 | Ga0495582_0065990 | 3300046473 | Bacteria | 1999 |
| 239 | Ga0495639_0014679 | 3300046475 | Bacteria | 3393 |
| 240 | Ga0495639_0051043 | 3300046475 | Bacteria | 1880 |
| 241 | Ga0495664_0152099 | 3300046477 | Bacteria | 1404 |
| 242 | Ga0495594_0045275 | 3300046499 | Unclassified | 2415 |
| 243 | Ga0495606_0001553 | 3300046507 | Bacteria | 30251 |
| 244 | Ga0495606_0149738 | 3300046507 | Bacteria | 1371 |
| 245 | Ga0495608_0007325 | 3300046511 | Bacteria | 7798 |
| 246 | Ga0495618_0001008 | 3300046514 | Bacteria | 19283 |
| 247 | Ga0495628_0086013 | 3300046516 | Bacteria | 2438 |
| 248 | Ga0495666_0106087 | 3300046526 | Unclassified | 1322 |
| 249 | Ga0495652_0018566 | 3300046529 | Bacteria | 6198 |
| 250 | Ga0495640_0013082 | 3300046533 | Bacteria | 6319 |
| 251 | Ga0495622_0048038 | 3300046557 | Bacteria | 1983 |
| 252 | Ga0495667_0011350 | 3300046559 | Bacteria | 6032 |
| 253 | Ga0495634_0028224 | 3300046642 | Bacteria | 3897 |
| 254 | Ga0495625_0020589 | 3300046660 | Bacteria | 5089 |
| 255 | Ga0495625_0205137 | 3300046660 | Bacteria | 1299 |
| 256 | Ga0495588_0058275 | 3300046674 | Bacteria | 1996 |
| 257 | Ga0495657_0042675 | 3300046675 | Bacteria | 3095 |
| 258 | Ga0495599_0039534 | 3300046678 | Bacteria | 2963 |
| 259 | Ga0495623_0001454 | 3300046679 | Bacteria | 16044 |
| 260 | Ga0495646_0097961 | 3300046680 | Bacteria | 1684 |
| 261 | Ga0495613_0012706 | 3300046689 | Bacteria | 6262 |
| 262 | Ga0495624_0099694 | 3300046690 | Bacteria | 1789 |
| 263 | Ga0495600_0026453 | 3300046809 | Bacteria | 3744 |
| 264 | Ga0495581_0011585 | 3300047315 | Bacteria | 5102 |
| 265 | Ga0495604_0001548 | 3300047317 | Bacteria | 18937 |
| 266 | Ga0495674_0004555 | 3300047319 | Bacteria | 13337 |
| 267 | Ga0495672_0166712 | 3300047320 | Bacteria | 1127 |
| 268 | Ga0495680_0007192 | 3300047322 | Bacteria | 10254 |
| 269 | Ga0495680_0172685 | 3300047322 | Unclassified | 1564 |
| 270 | Ga0495675_0046477 | 3300047444 | Bacteria | 2763 |
| 271 | Ga0495675_0173179 | 3300047444 | Bacteria | 1325 |
| 272 | Ga0495686_0000547 | 3300047472 | Bacteria | 53728 |
| 273 | Ga0495593_0020131 | 3300047673 | Plasmid | 3736 |
| 274 | Ga0495602_0018335 | 3300048088 | Bacteria | 6995 |
| 275 | Ga0496100_0002466 | 3300048903 | Bacteria | 9400 |
| 276 | Ga0496100_0025159 | 3300048903 | Bacteria | 3638 |
| 277 | Ga0496100_0135721 | 3300048903 | Bacteria | 1738 |
| 278 | Ga0496101_0035429 | 3300048904 | Bacteria | 3530 |
| 279 | Ga0496101_0091530 | 3300048904 | Bacteria | 2263 |
| 280 | Ga0496102_0022788 | 3300048905 | Bacteria | 5551 |
| 281 | Ga0496102_0051287 | 3300048905 | Bacteria | 3759 |
| 282 | Ga0496103_0003061 | 3300048906 | Bacteria | 10281 |
| 283 | Ga0496103_0051952 | 3300048906 | Bacteria | 2538 |
| 284 | Ga0496103_0271853 | 3300048906 | Bacteria | 1090 |
| 285 | Ga0496104_0010694 | 3300048907 | Bacteria | 8204 |
| 286 | Ga0496104_0011582 | 3300048907 | Bacteria | 7904 |
| 287 | Ga0496104_0239025 | 3300048907 | Bacteria | 1728 |
| 288 | Ga0496105_0047601 | 3300048908 | Bacteria | 3539 |
| 289 | Ga0496106_0018362 | 3300048909 | Bacteria | 5168 |
| 290 | Ga0496106_0155449 | 3300048909 | Bacteria | 1806 |
| 291 | Ga0496107_0008334 | 3300048910 | Bacteria | 7172 |
| 292 | Ga0496107_0081722 | 3300048910 | Bacteria | 2357 |
| 293 | Ga0496107_0218641 | 3300048910 | Bacteria | 1417 |
| 294 | Ga0496108_0041407 | 3300048911 | Bacteria | 3846 |
| 295 | Ga0496108_0273499 | 3300048911 | Bacteria | 1470 |
| 296 | Ga0496108_0286702 | 3300048911 | Bacteria | 1433 |
| 297 | Ga0496109_0026514 | 3300048912 | Bacteria | 5168 |
| 298 | Ga0496109_0071719 | 3300048912 | Bacteria | 3181 |
| 299 | Ga0496109_0078680 | 3300048912 | Bacteria | 3036 |
| 300 | Ga0496109_0081879 | 3300048912 | Bacteria | 2974 |
| 301 | Ga0496109_0086019 | 3300048912 | Bacteria | 2903 |
| 302 | Ga0496110_0019558 | 3300048913 | Bacteria | 5701 |
| 303 | Ga0496111_0002845 | 3300048914 | Bacteria | 10558 |
| 304 | Ga0496111_0386851 | 3300048914 | Bacteria | 1034 |
| 305 | Ga0496112_0008947 | 3300048915 | Bacteria | 8990 |
| 306 | Ga0496112_0027784 | 3300048915 | Bacteria | 5457 |
| 307 | Ga0496112_0035556 | 3300048915 | Bacteria | 4854 |
| 308 | Ga0496112_0107322 | 3300048915 | Bacteria | 2762 |
| 309 | Ga0496112_0134220 | 3300048915 | Bacteria | 2446 |
| 310 | Ga0496113_0013278 | 3300048916 | Bacteria | 5573 |
| 311 | Ga0496113_0098800 | 3300048916 | Bacteria | 2260 |
| 312 | Ga0496113_0187729 | 3300048916 | Bacteria | 1640 |
| 313 | Ga0496114_0003929 | 3300048917 | Bacteria | 11466 |
| 314 | Ga0496114_0026245 | 3300048917 | Bacteria | 4768 |
| 315 | Ga0496115_0006307 | 3300048918 | Bacteria | 8678 |
| 316 | Ga0496115_0029809 | 3300048918 | Bacteria | 4288 |
| 317 | Ga0496116_0064260 | 3300048919 | Bacteria | 2359 |
| 318 | Ga0496116_0120519 | 3300048919 | Unclassified | 1519 |
| 319 | Ga0496116_0132261 | 3300048919 | Bacteria | 1420 |
| 320 | Ga0496117_0009121 | 3300048920 | Bacteria | 9315 |
| 321 | Ga0496118_0122435 | 3300048921 | Unclassified | 1692 |
| 322 | Ga0496119_0025321 | 3300048922 | Bacteria | 4148 |
| 323 | Ga0496119_0030687 | 3300048922 | Bacteria | 3619 |
| 324 | Ga0496119_0056763 | 3300048922 | Bacteria | 2371 |
| 325 | Ga0496119_0175406 | 3300048922 | Bacteria | 1128 |
| 326 | Ga0496120_0002639 | 3300048923 | Bacteria | 17745 |
| 327 | Ga0496120_0084150 | 3300048923 | Bacteria | 1716 |
| 328 | Ga0496121_0037640 | 3300048924 | Bacteria | 4294 |
| 329 | Ga0496121_0087387 | 3300048924 | Bacteria | 2447 |
| 330 | Ga0496123_0008448 | 3300048926 | Bacteria | 9456 |
| 331 | Ga0496123_0031281 | 3300048926 | Bacteria | 3874 |
| 332 | Ga0496124_0024322 | 3300048927 | Bacteria | 5511 |
| 333 | Ga0496124_0093995 | 3300048927 | Bacteria | 2439 |
| 334 | Ga0496124_0167086 | 3300048927 | Bacteria | 1709 |
| 335 | Ga0496125_0088451 | 3300048928 | Bacteria | 2334 |
| 336 | Ga0496126_0197392 | 3300048929 | Bacteria | 1701 |
| 337 | Ga0496126_0239785 | 3300048929 | Bacteria | 1515 |
| 338 | Ga0496126_0301467 | 3300048929 | Bacteria | 1322 |
| 339 | Ga0501031_0000202 | 3300049568 | Bacteria | 33947 |
| 340 | Ga0501032_0000443 | 3300049569 | Bacteria | 33947 |
| 341 | Ga0501032_0136546 | 3300049569 | Bacteria | 1616 |
| 342 | Ga0501033_0000097 | 3300049570 | Bacteria | 83228 |
| 343 | Ga0501033_0371457 | 3300049570 | Bacteria | 1000 |
| 344 | Ga0501034_0000186 | 3300049571 | Bacteria | 116500 |
| 345 | Ga0501034_0050275 | 3300049571 | Bacteria | 4205 |
| 346 | Ga0501034_0186666 | 3300049571 | Bacteria | 2036 |
| 347 | Ga0501036_0000002 | 3300049572 | Bacteria | 293106 |
| 348 | Ga0501036_0109252 | 3300049572 | Bacteria | 2337 |
| 349 | Ga0501037_0000443 | 3300049573 | Bacteria | 33927 |
| 350 | Ga0501037_0046428 | 3300049573 | Bacteria | 3185 |
| 351 | Ga0501038_0000867 | 3300049574 | Bacteria | 26767 |
| 352 | Ga0501038_0048154 | 3300049574 | Bacteria | 3690 |
| 353 | Ga0501039_0000002 | 3300049575 | Bacteria | 375152 |
| 354 | Ga0501039_0114633 | 3300049575 | Bacteria | 2109 |
| 355 | Ga0501040_0001925 | 3300049576 | Bacteria | 13348 |
| 356 | Ga0501040_0021610 | 3300049576 | Bacteria | 4300 |
| 357 | Ga0501040_0054717 | 3300049576 | Bacteria | 2736 |
| 358 | Ga0501040_0136636 | 3300049576 | Bacteria | 1726 |
| 359 | Ga0501041_0027405 | 3300049577 | Bacteria | 3433 |
| 360 | Ga0501042_0154504 | 3300049578 | Bacteria | 1655 |
| 361 | Ga0501043_0000543 | 3300049579 | Bacteria | 33914 |
| 362 | Ga0501047_0002364 | 3300049581 | Bacteria | 18037 |
| 363 | Ga0501070_0012803 | 3300049586 | Bacteria | 7072 |
| 364 | Ga0501070_0088306 | 3300049586 | Bacteria | 2566 |
| 365 | Ga0501071_0016107 | 3300049587 | Bacteria | 5139 |
| 366 | Ga0501071_0216932 | 3300049587 | Bacteria | 1439 |
| 367 | Ga0501076_0129915 | 3300049592 | Bacteria | 2043 |
| 368 | Ga0501077_0012266 | 3300049593 | Bacteria | 5368 |
| 369 | Ga0501079_0096992 | 3300049741 | Bacteria | 2286 |
| 370 | Ga0501080_0249223 | 3300049742 | Bacteria | 1620 |
| 371 | Ga0501081_0007896 | 3300049743 | Bacteria | 6903 |
| 372 | Ga0501081_0080054 | 3300049743 | Bacteria | 2286 |
| 373 | Ga0501035_0000100 | 3300049822 | Bacteria | 107321 |
| 374 | Ga0501035_0032386 | 3300049822 | Bacteria | 4756 |
| 375 | Ga0501044_0000002 | 3300049823 | Bacteria | 375152 |
| 376 | Ga0501044_0052784 | 3300049823 | Bacteria | 4186 |
| 377 | Ga0501044_0360284 | 3300049823 | Bacteria | 1372 |
| 378 | Ga0501045_0018382 | 3300049824 | Bacteria | 4972 |
| 379 | Ga0501045_0090203 | 3300049824 | Bacteria | 2265 |
| 380 | nmdc:mga00v17_277550_c1 | 3300050491 | Bacteria | 1088 |
| 381 | nmdc:mga0yw44_218701_c1 | 3300050492 | Bacteria | 1262 |
| 382 | nmdc:mga0yw44_235089_c1 | 3300050492 | Bacteria | 1217 |
| 383 | nmdc:mga0yw44_241515_c1 | 3300050492 | Bacteria | 1200 |
| 384 | nmdc:mga0yw44_38577_c1 | 3300050492 | Bacteria | 2828 |
| 385 | nmdc:mga07m45_76491_c1 | 3300050496 | Unclassified | 1908 |
| 386 | nmdc:mga05p37_157530_c1 | 3300050507 | Bacteria | 2775 |
| 387 | nmdc:mga05p37_413446_c1 | 3300050507 | Bacteria | 1572 |
| 388 | nmdc:mga06r32_269012_c1 | 3300050510 | Bacteria | 1692 |
| 389 | nmdc:mga08y16_7637_c1 | 3300050511 | Bacteria | 11317 |
| 390 | nmdc:mga0n895_3912_c1 | 3300050512 | Bacteria | 12100 |
| 391 | nmdc:mga0rr50_8560_c1 | 3300050513 | Bacteria | 6376 |
| 392 | nmdc:mga08x19_87064_c1 | 3300050514 | Bacteria | 2057 |
| 393 | nmdc:mga0a205_7475_c1 | 3300050515 | Bacteria | 9893 |
| 394 | Ga0495601_0011422 | 3300053077 | Bacteria | 5311 |
| 395 | Ga0495612_0008778 | 3300053078 | Bacteria | 4097 |
| 396 | Ga0495595_0000901 | 3300053084 | Bacteria | 11440 |
| 397 | Ga0495619_0014841 | 3300053085 | Plasmid | 4920 |
| 398 | Ga0495619_0032453 | 3300053085 | Bacteria | 3389 |
| 399 | Ga0500608_117869 | 3300053122 | Bacteria | 1208 |
| 400 | Ga0500618_000190 | 3300053125 | Bacteria | 50341 |
| 401 | Ga0500618_001154 | 3300053125 | Bacteria | 12817 |
| 402 | Ga0500618_002143 | 3300053125 | Bacteria | 7756 |
| 403 | Ga0500618_007745 | 3300053125 | Bacteria | 3040 |
| 404 | Ga0500620_000058 | 3300053155 | Bacteria | 20321 |
| 405 | Ga0500627_0063583 | 3300053158 | Bacteria | 1626 |
| 406 | Ga0500627_0160637 | 3300053158 | Bacteria | 1014 |
| 407 | Ga0500636_0131564 | 3300053177 | Bacteria | 1393 |
| 408 | Ga0501084_0007651 | 3300054114 | Bacteria | 8905 |
| 409 | Ga0501084_0144864 | 3300054114 | Bacteria | 2001 |
| 410 | Ga0501082_0065853 | 3300060353 | Bacteria | 3120 |
| 411 | Ga0501082_0300851 | 3300060353 | Bacteria | 1397 |
| 412 | Ga0530510_0001126 | 3300061734 | Bacteria | 17781 |
| 413 | Ga0530510_0085782 | 3300061734 | Bacteria | 2294 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 8056681323 | 8056686330 | 281 |
| 2 | 3300053177 | Ga0500636_0131564 | Ga0500636_0131564_516_1373 | 284 |
| 3 | 3300005937 | Ga0081455_10004397 | Ga0081455_1000439712 | 290 |
| 4 | 3300009101 | Ga0105247_10024565 | Ga0105247_100245651 | 291 |
| 5 | 3300045976 | Ga0466967_0407301 | Ga0466967_0407301_431_1309 | 292 |
| 6 | iso_pu_bacteria | 2871435913 | 2871440545 | 292 |
| 7 | 3300003354 | JGI25160J50197_1000095 | JGI25160J50197_100009578 | 294 |
| 8 | 3300003374 | JGI25161J50226_1000071 | JGI25161J50226_10000716 | 294 |
| 9 | 3300004625 | Ga0055543_1000250 | Ga0055543_10002506 | 294 |
| 10 | 3300005262 | Ga0065165_1000408 | Ga0065165_100040860 | 294 |
| 11 | 3300025208 | Ga0209436_104527 | Ga0209436_1045272 | 294 |
| 12 | 3300025284 | Ga0209130_1000180 | Ga0209130_10001806 | 294 |
| 13 | 3300025302 | Ga0207426_1000017 | Ga0207426_1000017461 | 294 |
| 14 | 3300048903 | Ga0496100_0002466 | Ga0496100_0002466_8486_9379 | 296 |
| 15 | 3300048909 | Ga0496106_0155449 | Ga0496106_0155449_803_1699 | 296 |
| 16 | 3300048912 | Ga0496109_0071719 | Ga0496109_0071719_187_1083 | 296 |
| 17 | 3300048914 | Ga0496111_0386851 | Ga0496111_0386851_29_925 | 296 |
| 18 | 3300025933 | Ga0207706_10127767 | Ga0207706_101277673 | 298 |
| 19 | 3300048926 | Ga0496123_0031281 | Ga0496123_0031281_198_1106 | 298 |
| 20 | iso_pu_bacteria | 8018176218 | 8018181267 | 300 |
| 21 | 3300046660 | Ga0495625_0205137 | Ga0495625_0205137_17_928 | 301 |
| 22 | 3300049570 | Ga0501033_0371457 | Ga0501033_0371457_39_974 | 301 |
| 23 | 3300046511 | Ga0495608_0007325 | Ga0495608_0007325_6668_7582 | 302 |
| 24 | 3300053085 | Ga0495619_0032453 | Ga0495619_0032453_424_1362 | 302 |
| 25 | iso_pu_bacteria | 2885334103 | 2885340522 | 303 |
| 26 | 3300005937 | Ga0081455_10048374 | Ga0081455_100483743 | 306 |
| 27 | 3300006177 | Ga0075362_10145230 | Ga0075362_101452301 | 307 |
| 28 | 3300037471 | Ga0395905_0653430 | Ga0395905_0653430_13_942 | 307 |
| 29 | 3300048928 | Ga0496125_0088451 | Ga0496125_0088451_67_1059 | 307 |
| 30 | 3300005937 | Ga0081455_10279987 | Ga0081455_102799871 | 309 |
| 31 | 3300053077 | Ga0495601_0011422 | Ga0495601_0011422_840_1802 | 309 |
| 32 | 3300053155 | Ga0500620_000058 | Ga0500620_000058_13738_14703 | 309 |
| 33 | 3300049576 | Ga0501040_0136636 | Ga0501040_0136636_169_1185 | 310 |
| 34 | 3300049587 | Ga0501071_0016107 | Ga0501071_0016107_254_1270 | 310 |
| 35 | 3300049743 | Ga0501081_0080054 | Ga0501081_0080054_772_1788 | 310 |
| 36 | 3300054114 | Ga0501084_0144864 | Ga0501084_0144864_782_1798 | 310 |
| 37 | 3300060353 | Ga0501082_0065853 | Ga0501082_0065853_760_1776 | 310 |
| 38 | 3300061734 | Ga0530510_0001126 | Ga0530510_0001126_2035_3051 | 310 |
| 39 | iso_pu_bacteria | 2885383462 | 2885384813 | 310 |
| 40 | 3300009011 | Ga0105251_10077404 | Ga0105251_100774042 | 311 |
| 41 | 3300009176 | Ga0105242_10009636 | Ga0105242_100096368 | 311 |
| 42 | 3300011119 | Ga0105246_10002703 | Ga0105246_100027036 | 311 |
| 43 | 3300035084 | Ga0373928_0013404 | Ga0373928_0013404_19_978 | 311 |
| 44 | iso_pu_bacteria | 2977971508 | 2977980237 | 311 |
| 45 | 3300048919 | Ga0496116_0132261 | Ga0496116_0132261_134_1084 | 312 |
| 46 | 3300048922 | Ga0496119_0175406 | Ga0496119_0175406_41_991 | 312 |
| 47 | 3300048927 | Ga0496124_0024322 | Ga0496124_0024322_2235_3185 | 312 |
| 48 | 3300048929 | Ga0496126_0239785 | Ga0496126_0239785_283_1233 | 312 |
| 49 | 3300049569 | Ga0501032_0136546 | Ga0501032_0136546_501_1445 | 312 |
| 50 | 3300049571 | Ga0501034_0186666 | Ga0501034_0186666_330_1274 | 312 |
| 51 | 3300049573 | Ga0501037_0046428 | Ga0501037_0046428_453_1397 | 312 |
| 52 | 3300049574 | Ga0501038_0048154 | Ga0501038_0048154_554_1498 | 312 |
| 53 | 3300049575 | Ga0501039_0114633 | Ga0501039_0114633_474_1418 | 312 |
| 54 | 3300049586 | Ga0501070_0088306 | Ga0501070_0088306_315_1259 | 312 |
| 55 | 3300049742 | Ga0501080_0249223 | Ga0501080_0249223_58_1002 | 312 |
| 56 | 3300049822 | Ga0501035_0032386 | Ga0501035_0032386_333_1277 | 312 |
| 57 | 3300049823 | Ga0501044_0360284 | Ga0501044_0360284_384_1328 | 312 |
| 58 | 3300005457 | Ga0070662_100130501 | Ga0070662_1001305012 | 313 |
| 59 | 3300006177 | Ga0075362_10020877 | Ga0075362_100208773 | 313 |
| 60 | 3300037418 | Ga0395900_0187635 | Ga0395900_0187635_910_1908 | 313 |
| 61 | iso_pu_bacteria | 2513237305 | 2514420553 | 314 |
| 62 | iso_pu_bacteria | 2903768456 | 2903776304 | 314 |
| 63 | iso_pu_bacteria | 2924762789 | 2924767990 | 314 |
| 64 | iso_pu_bacteria | 2937822353 | 2937822394 | 314 |
| 65 | iso_pu_bacteria | 2987666974 | 2987669711 | 314 |
| 66 | 3300037312 | Ga0395899_0236486 | Ga0395899_0236486_66_1037 | 315 |
| 67 | 3300037418 | Ga0395900_0052058 | Ga0395900_0052058_2534_3505 | 315 |
| 68 | 3300037466 | Ga0395898_0098236 | Ga0395898_0098236_725_1696 | 315 |
| 69 | 3300038443 | Ga0395901_0215888 | Ga0395901_0215888_351_1322 | 315 |
| 70 | 3300049592 | Ga0501076_0129915 | Ga0501076_0129915_110_1063 | 315 |
| 71 | 3300046477 | Ga0495664_0152099 | Ga0495664_0152099_105_1067 | 316 |
| 72 | 3300047444 | Ga0495675_0173179 | Ga0495675_0173179_226_1188 | 316 |
| 73 | 3300053125 | Ga0500618_001154 | Ga0500618_001154_6781_7737 | 316 |
| 74 | iso_pu_bacteria | 2721755686 | 2723574275 | 316 |
| 75 | 3300036647 | Ga0316582_0121807 | Ga0316582_0121807_595_1617 | 317 |
| 76 | 3300049576 | Ga0501040_0054717 | Ga0501040_0054717_736_1731 | 317 |
| 77 | 3300049824 | Ga0501045_0018382 | Ga0501045_0018382_1187_2182 | 317 |
| 78 | iso_pu_bacteria | 2582581294 | 2585204482 | 317 |
| 79 | iso_pu_bacteria | 2582581294 | 2585205757 | 317 |
| 80 | iso_pu_bacteria | 3004167301 | 3004168064 | 317 |
| 81 | 3300005365 | Ga0070688_100013794 | Ga0070688_1000137945 | 318 |
| 82 | 3300025919 | Ga0207657_10017311 | Ga0207657_100173111 | 318 |
| 83 | 3300031911 | Ga0307412_10048640 | Ga0307412_100486403 | 318 |
| 84 | 3300046660 | Ga0495625_0020589 | Ga0495625_0020589_3183_4148 | 318 |
| 85 | 3300046678 | Ga0495599_0039534 | Ga0495599_0039534_1406_2371 | 318 |
| 86 | 3300049571 | Ga0501034_0050275 | Ga0501034_0050275_1907_2890 | 318 |
| 87 | 3300049572 | Ga0501036_0109252 | Ga0501036_0109252_812_1837 | 318 |
| 88 | 3300049576 | Ga0501040_0021610 | Ga0501040_0021610_1352_2320 | 318 |
| 89 | 3300049577 | Ga0501041_0027405 | Ga0501041_0027405_1608_2576 | 318 |
| 90 | 3300049578 | Ga0501042_0154504 | Ga0501042_0154504_519_1487 | 318 |
| 91 | 3300049593 | Ga0501077_0012266 | Ga0501077_0012266_824_1792 | 318 |
| 92 | 3300049743 | Ga0501081_0007896 | Ga0501081_0007896_4476_5444 | 318 |
| 93 | 3300049824 | Ga0501045_0090203 | Ga0501045_0090203_66_1034 | 318 |
| 94 | 3300053158 | Ga0500627_0160637 | Ga0500627_0160637_26_991 | 318 |
| 95 | 3300054114 | Ga0501084_0007651 | Ga0501084_0007651_6283_7251 | 318 |
| 96 | 3300061734 | Ga0530510_0085782 | Ga0530510_0085782_1121_2089 | 318 |
| 97 | iso_pu_bacteria | 2512875024 | 2512960169 | 318 |
| 98 | iso_pu_bacteria | 2513237164 | 2514034747 | 318 |
| 99 | iso_pu_bacteria | 2869169390 | 2869169516 | 318 |
| 100 | iso_pu_bacteria | 2869234852 | 2869236767 | 318 |
| 101 | iso_pu_bacteria | 2869242130 | 2869246605 | 318 |
| 102 | iso_pu_bacteria | 2869256925 | 2869261638 | 318 |
| 103 | iso_pu_bacteria | 2871481445 | 2871482683 | 318 |
| 104 | iso_pu_bacteria | 2876386047 | 2876386394 | 318 |
| 105 | iso_pu_bacteria | 2876420981 | 2876426676 | 318 |
| 106 | iso_pu_bacteria | 2903513507 | 2903520441 | 318 |
| 107 | iso_pu_bacteria | 2906401398 | 2906403548 | 318 |
| 108 | iso_pu_bacteria | 2924741084 | 2924741146 | 318 |
| 109 | iso_pu_bacteria | 2937861824 | 2937864492 | 318 |
| 110 | iso_pu_bacteria | 2937980651 | 2937981514 | 318 |
| 111 | iso_pu_bacteria | 2958108152 | 2958113191 | 318 |
| 112 | iso_pu_bacteria | 2961183825 | 2961186640 | 318 |
| 113 | iso_pu_bacteria | 2970489779 | 2970493426 | 318 |
| 114 | iso_pu_bacteria | 2970627176 | 2970627576 | 318 |
| 115 | iso_pu_bacteria | 2977851361 | 2977853929 | 318 |
| 116 | iso_pu_bacteria | 2977907340 | 2977908047 | 318 |
| 117 | iso_pu_bacteria | 2979764755 | 2979768774 | 318 |
| 118 | iso_pu_bacteria | 2996386984 | 2996388525 | 318 |
| 119 | iso_pu_bacteria | 3004232784 | 3004237464 | 318 |
| 120 | iso_pu_bacteria | 8004312739 | 8004320880 | 318 |
| 121 | iso_pu_bacteria | 8004727605 | 8004728687 | 318 |
| 122 | 3300005983 | Ga0081540_1012683 | Ga0081540_10126831 | 319 |
| 123 | 3300009094 | Ga0111539_10052616 | Ga0111539_100526164 | 319 |
| 124 | 3300009147 | Ga0114129_10019913 | Ga0114129_100199139 | 319 |
| 125 | 3300009553 | Ga0105249_10103373 | Ga0105249_101033735 | 319 |
| 126 | 3300013105 | Ga0157369_10025687 | Ga0157369_100256873 | 319 |
| 127 | 3300013297 | Ga0157378_10025475 | Ga0157378_100254753 | 319 |
| 128 | 3300013308 | Ga0157375_10011082 | Ga0157375_100110828 | 319 |
| 129 | 3300014969 | Ga0157376_10221147 | Ga0157376_102211472 | 319 |
| 130 | 3300037471 | Ga0395905_0122792 | Ga0395905_0122792_325_1293 | 319 |
| 131 | 3300038443 | Ga0395901_0474374 | Ga0395901_0474374_128_1096 | 319 |
| 132 | 3300039438 | Ga0436360_0934992 | Ga0436360_0934992_1231_2223 | 319 |
| 133 | 3300048905 | Ga0496102_0022788 | Ga0496102_0022788_1848_2813 | 319 |
| 134 | 3300048906 | Ga0496103_0003061 | Ga0496103_0003061_1087_2052 | 319 |
| 135 | 3300048907 | Ga0496104_0011582 | Ga0496104_0011582_940_1905 | 319 |
| 136 | 3300048909 | Ga0496106_0018362 | Ga0496106_0018362_1593_2558 | 319 |
| 137 | 3300048910 | Ga0496107_0081722 | Ga0496107_0081722_278_1243 | 319 |
| 138 | 3300048911 | Ga0496108_0286702 | Ga0496108_0286702_107_1072 | 319 |
| 139 | 3300048912 | Ga0496109_0026514 | Ga0496109_0026514_1782_2747 | 319 |
| 140 | 3300048913 | Ga0496110_0019558 | Ga0496110_0019558_2739_3704 | 319 |
| 141 | 3300048914 | Ga0496111_0002845 | Ga0496111_0002845_8633_9598 | 319 |
| 142 | 3300048915 | Ga0496112_0008947 | Ga0496112_0008947_6000_6965 | 319 |
| 143 | 3300048916 | Ga0496113_0013278 | Ga0496113_0013278_2611_3576 | 319 |
| 144 | 3300048917 | Ga0496114_0026245 | Ga0496114_0026245_1065_2030 | 319 |
| 145 | 3300048918 | Ga0496115_0029809 | Ga0496115_0029809_2739_3704 | 319 |
| 146 | 3300050507 | nmdc:mga05p37_157530_c1 | nmdc:mga05p37_157530_c1_140_1105 | 319 |
| 147 | 3300050510 | nmdc:mga06r32_269012_c1 | nmdc:mga06r32_269012_c1_686_1651 | 319 |
| 148 | 3300050511 | nmdc:mga08y16_7637_c1 | nmdc:mga08y16_7637_c1_8584_9549 | 319 |
| 149 | 3300050512 | nmdc:mga0n895_3912_c1 | nmdc:mga0n895_3912_c1_6294_7259 | 319 |
| 150 | 3300050513 | nmdc:mga0rr50_8560_c1 | nmdc:mga0rr50_8560_c1_4650_5615 | 319 |
| 151 | 3300050514 | nmdc:mga08x19_87064_c1 | nmdc:mga08x19_87064_c1_1052_2017 | 319 |
| 152 | 3300050515 | nmdc:mga0a205_7475_c1 | nmdc:mga0a205_7475_c1_6505_7470 | 319 |
| 153 | iso_pu_bacteria | 2856328259 | 2856333533 | 319 |
| 154 | iso_pu_bacteria | 2856334872 | 2856337938 | 319 |
| 155 | iso_pu_bacteria | 2857367948 | 2857368951 | 319 |
| 156 | iso_pu_bacteria | 2869271264 | 2869277960 | 319 |
| 157 | iso_pu_bacteria | 2871451962 | 2871459546 | 319 |
| 158 | iso_pu_bacteria | 2874162495 | 2874165359 | 319 |
| 159 | iso_pu_bacteria | 2876399893 | 2876402895 | 319 |
| 160 | iso_pu_bacteria | 2876406927 | 2876408750 | 319 |
| 161 | iso_pu_bacteria | 2878774303 | 2878776219 | 319 |
| 162 | iso_pu_bacteria | 2878781027 | 2878786684 | 319 |
| 163 | iso_pu_bacteria | 2906386501 | 2906392040 | 319 |
| 164 | iso_pu_bacteria | 2906408224 | 2906412516 | 319 |
| 165 | iso_pu_bacteria | 2922151315 | 2922152031 | 319 |
| 166 | iso_pu_bacteria | 2922172374 | 2922175858 | 319 |
| 167 | iso_pu_bacteria | 2924748358 | 2924752684 | 319 |
| 168 | iso_pu_bacteria | 2958122699 | 2958124134 | 319 |
| 169 | iso_pu_bacteria | 2958137437 | 2958138658 | 319 |
| 170 | iso_pu_bacteria | 2958158011 | 2958163668 | 319 |
| 171 | iso_pu_bacteria | 2961136820 | 2961139831 | 319 |
| 172 | iso_pu_bacteria | 2965025482 | 2965025826 | 319 |
| 173 | iso_pu_bacteria | 2965032056 | 2965036790 | 319 |
| 174 | iso_pu_bacteria | 2965047637 | 2965052032 | 319 |
| 175 | iso_pu_bacteria | 2965102966 | 2965105123 | 319 |
| 176 | iso_pu_bacteria | 2965110997 | 2965116232 | 319 |
| 177 | iso_pu_bacteria | 2968138860 | 2968142513 | 319 |
| 178 | iso_pu_bacteria | 2970510686 | 2970511183 | 319 |
| 179 | iso_pu_bacteria | 2970547951 | 2970551519 | 319 |
| 180 | iso_pu_bacteria | 2977872689 | 2977874281 | 319 |
| 181 | iso_pu_bacteria | 2977935797 | 2977939065 | 319 |
| 182 | iso_pu_bacteria | 2977957713 | 2977963823 | 319 |
| 183 | iso_pu_bacteria | 2979793036 | 2979793335 | 319 |
| 184 | iso_pu_bacteria | 2987645492 | 2987645650 | 319 |
| 185 | iso_pu_bacteria | 2987673487 | 2987674327 | 319 |
| 186 | iso_pu_bacteria | 3000135777 | 3000139998 | 319 |
| 187 | iso_pu_bacteria | 3004239961 | 3004247225 | 319 |
| 188 | iso_pu_bacteria | 649633066 | 649872179 | 319 |
| 189 | iso_pu_bacteria | 8004300914 | 8004306548 | 319 |
| 190 | iso_pu_bacteria | 8004695233 | 8004702057 | 319 |
| 191 | 3300006186 | Ga0075369_10002867 | Ga0075369_100028675 | 320 |
| 192 | 3300009093 | Ga0105240_10244742 | Ga0105240_102447422 | 320 |
| 193 | 3300026121 | Ga0207683_10054109 | Ga0207683_100541093 | 320 |
| 194 | 3300048929 | Ga0496126_0301467 | Ga0496126_0301467_305_1276 | 320 |
| 195 | 3300050492 | nmdc:mga0yw44_218701_c1 | nmdc:mga0yw44_218701_c1_137_1108 | 320 |
| 196 | 3300053125 | Ga0500618_002143 | Ga0500618_002143_574_1644 | 320 |
| 197 | iso_pu_bacteria | 2508501123 | 2509117953 | 320 |
| 198 | iso_pu_bacteria | 2509276022 | 2509395254 | 320 |
| 199 | iso_pu_bacteria | 2519899620 | 2520378297 | 320 |
| 200 | iso_pu_bacteria | 2615840624 | 2616297312 | 320 |
| 201 | iso_pu_bacteria | 2643221595 | 2643987992 | 320 |
| 202 | iso_pu_bacteria | 2643221627 | 2644158162 | 320 |
| 203 | iso_pu_bacteria | 2718217997 | 2719663204 | 320 |
| 204 | iso_pu_bacteria | 2718218199 | 2720488608 | 320 |
| 205 | iso_pu_bacteria | 2718218365 | 2721155201 | 320 |
| 206 | iso_pu_bacteria | 2721755684 | 2723563623 | 320 |
| 207 | iso_pu_bacteria | 2721755685 | 2723570491 | 320 |
| 208 | iso_pu_bacteria | 2721755822 | 2724102038 | 320 |
| 209 | iso_pu_bacteria | 2721755823 | 2724107227 | 320 |
| 210 | iso_pu_bacteria | 2728369397 | 2730296083 | 320 |
| 211 | iso_pu_bacteria | 2756170246 | 2756671920 | 320 |
| 212 | iso_pu_bacteria | 2791355260 | 2793325274 | 320 |
| 213 | iso_pu_bacteria | 2791355265 | 2793356345 | 320 |
| 214 | iso_pu_bacteria | 2791355267 | 2793370206 | 320 |
| 215 | iso_pu_bacteria | 2802429633 | 2806048762 | 320 |
| 216 | iso_pu_bacteria | 2802429635 | 2806063600 | 320 |
| 217 | iso_pu_bacteria | 2802429636 | 2806070547 | 320 |
| 218 | iso_pu_bacteria | 2844002411 | 2844008136 | 320 |
| 219 | iso_pu_bacteria | 2856320880 | 2856326729 | 320 |
| 220 | iso_pu_bacteria | 2869278585 | 2869283718 | 320 |
| 221 | iso_pu_bacteria | 2871466892 | 2871468306 | 320 |
| 222 | iso_pu_bacteria | 2874139085 | 2874140175 | 320 |
| 223 | iso_pu_bacteria | 2878738818 | 2878738852 | 320 |
| 224 | iso_pu_bacteria | 2881853255 | 2881860029 | 320 |
| 225 | iso_pu_bacteria | 2885342637 | 2885349557 | 320 |
| 226 | iso_pu_bacteria | 2885350715 | 2885350843 | 320 |
| 227 | iso_pu_bacteria | 2888337043 | 2888338696 | 320 |
| 228 | iso_pu_bacteria | 2906378014 | 2906378889 | 320 |
| 229 | iso_pu_bacteria | 2924718760 | 2924722401 | 320 |
| 230 | iso_pu_bacteria | 2924733363 | 2924740208 | 320 |
| 231 | iso_pu_bacteria | 2924776078 | 2924776214 | 320 |
| 232 | iso_pu_bacteria | 2936381700 | 2936385624 | 320 |
| 233 | iso_pu_bacteria | 2937877337 | 2937884327 | 320 |
| 234 | iso_pu_bacteria | 2937972304 | 2937979570 | 320 |
| 235 | iso_pu_bacteria | 2958034702 | 2958040230 | 320 |
| 236 | iso_pu_bacteria | 2958041894 | 2958054574 | 320 |
| 237 | iso_pu_bacteria | 2958064165 | 2958069308 | 320 |
| 238 | iso_pu_bacteria | 2958084443 | 2958091638 | 320 |
| 239 | iso_pu_bacteria | 2958092219 | 2958097771 | 320 |
| 240 | iso_pu_bacteria | 2968016561 | 2968019072 | 320 |
| 241 | iso_pu_bacteria | 2970469710 | 2970470755 | 320 |
| 242 | iso_pu_bacteria | 2970593180 | 2970597857 | 320 |
| 243 | iso_pu_bacteria | 2977828996 | 2977837073 | 320 |
| 244 | iso_pu_bacteria | 2996348954 | 2996356708 | 320 |
| 245 | iso_pu_bacteria | 3004275668 | 3004283011 | 320 |
| 246 | 3300003187 | JGI25151J46595_10000582 | JGI25151J46595_1000058241 | 321 |
| 247 | 3300025258 | Ga0209129_1000070 | Ga0209129_1000070226 | 321 |
| 248 | 3300025294 | Ga0209025_1000239 | Ga0209025_100023959 | 321 |
| 249 | 3300025297 | Ga0209758_1016180 | Ga0209758_10161802 | 321 |
| 250 | 3300025303 | Ga0209051_1014356 | Ga0209051_10143561 | 321 |
| 251 | 3300025972 | Ga0207668_10142162 | Ga0207668_101421622 | 321 |
| 252 | 3300050491 | nmdc:mga00v17_277550_c1 | nmdc:mga00v17_277550_c1_90_1064 | 321 |
| 253 | iso_pu_bacteria | 2718217882 | 2719178841 | 321 |
| 254 | iso_pu_bacteria | 2718218009 | 2719729206 | 321 |
| 255 | iso_pu_bacteria | 2718218363 | 2721143453 | 321 |
| 256 | iso_pu_bacteria | 2718218366 | 2721166546 | 321 |
| 257 | iso_pu_bacteria | 2721755514 | 2722837524 | 321 |
| 258 | iso_pu_bacteria | 2721755810 | 2724041099 | 321 |
| 259 | iso_pu_bacteria | 2728369365 | 2730161302 | 321 |
| 260 | iso_pu_bacteria | 2791355123 | 2792752116 | 321 |
| 261 | iso_pu_bacteria | 2842489311 | 2842495278 | 321 |
| 262 | iso_pu_bacteria | 2842495871 | 2842501629 | 321 |
| 263 | iso_pu_bacteria | 8005619151 | 8005624929 | 321 |
| 264 | iso_pu_bacteria | 8005695170 | 8005698072 | 321 |
| 265 | 3300002774 | JGI25150J39212_1000028 | JGI25150J39212_100002819 | 322 |
| 266 | 3300003187 | JGI25151J46595_10000123 | JGI25151J46595_1000012378 | 322 |
| 267 | 3300006353 | Ga0075370_10020400 | Ga0075370_100204002 | 322 |
| 268 | 3300013296 | Ga0157374_10409901 | Ga0157374_104099012 | 322 |
| 269 | 3300025245 | Ga0207425_1000077 | Ga0207425_100007776 | 322 |
| 270 | 3300025258 | Ga0209129_1000036 | Ga0209129_1000036241 | 322 |
| 271 | 3300025273 | Ga0209673_1015706 | Ga0209673_10157063 | 322 |
| 272 | 3300025294 | Ga0209025_1000329 | Ga0209025_100032976 | 322 |
| 273 | 3300025297 | Ga0209758_1000259 | Ga0209758_100025916 | 322 |
| 274 | 3300047320 | Ga0495672_0166712 | Ga0495672_0166712_68_1057 | 322 |
| 275 | 3300048904 | Ga0496101_0035429 | Ga0496101_0035429_394_1386 | 322 |
| 276 | 3300048907 | Ga0496104_0239025 | Ga0496104_0239025_576_1583 | 322 |
| 277 | 3300048911 | Ga0496108_0273499 | Ga0496108_0273499_361_1368 | 322 |
| 278 | 3300048912 | Ga0496109_0086019 | Ga0496109_0086019_737_1744 | 322 |
| 279 | 3300048915 | Ga0496112_0027784 | Ga0496112_0027784_260_1267 | 322 |
| 280 | 3300048919 | Ga0496116_0064260 | Ga0496116_0064260_1123_2115 | 322 |
| 281 | 3300048919 | Ga0496116_0120519 | Ga0496116_0120519_283_1275 | 322 |
| 282 | 3300048920 | Ga0496117_0009121 | Ga0496117_0009121_2652_3644 | 322 |
| 283 | 3300048921 | Ga0496118_0122435 | Ga0496118_0122435_168_1160 | 322 |
| 284 | 3300048924 | Ga0496121_0087387 | Ga0496121_0087387_129_1121 | 322 |
| 285 | 3300048927 | Ga0496124_0093995 | Ga0496124_0093995_497_1489 | 322 |
| 286 | 3300049587 | Ga0501071_0216932 | Ga0501071_0216932_138_1118 | 322 |
| 287 | 3300049741 | Ga0501079_0096992 | Ga0501079_0096992_287_1267 | 322 |
| 288 | 3300050496 | nmdc:mga07m45_76491_c1 | nmdc:mga07m45_76491_c1_478_1470 | 322 |
| 289 | 3300050507 | nmdc:mga05p37_413446_c1 | nmdc:mga05p37_413446_c1_441_1475 | 322 |
| 290 | iso_pu_bacteria | 2878753008 | 2878753100 | 322 |
| 291 | iso_pu_bacteria | 2881861095 | 2881866480 | 322 |
| 292 | iso_pu_bacteria | 2885318864 | 2885319775 | 322 |
| 293 | iso_pu_bacteria | 2924784321 | 2924786249 | 322 |
| 294 | iso_pu_bacteria | 2961127735 | 2961136622 | 322 |
| 295 | iso_pu_bacteria | 2961170736 | 2961171100 | 322 |
| 296 | iso_pu_bacteria | 2970503327 | 2970503694 | 322 |
| 297 | iso_pu_bacteria | 2977821940 | 2977822032 | 322 |
| 298 | iso_pu_bacteria | 2979808191 | 2979808330 | 322 |
| 299 | iso_pu_bacteria | 8004374579 | 8004374672 | 322 |
| 300 | 3300005366 | Ga0070659_100003500 | Ga0070659_10000350010 | 323 |
| 301 | 3300005455 | Ga0070663_100014193 | Ga0070663_1000141934 | 323 |
| 302 | 3300005457 | Ga0070662_100002562 | Ga0070662_1000025624 | 323 |
| 303 | 3300005536 | Ga0070697_100235397 | Ga0070697_1002353972 | 323 |
| 304 | 3300005539 | Ga0068853_100521709 | Ga0068853_1005217091 | 323 |
| 305 | 3300005545 | Ga0070695_100337804 | Ga0070695_1003378041 | 323 |
| 306 | 3300005546 | Ga0070696_100280550 | Ga0070696_1002805502 | 323 |
| 307 | 3300005548 | Ga0070665_100117858 | Ga0070665_1001178582 | 323 |
| 308 | 3300005549 | Ga0070704_100023332 | Ga0070704_1000233321 | 323 |
| 309 | 3300005577 | Ga0068857_100023552 | Ga0068857_1000235525 | 323 |
| 310 | 3300005614 | Ga0068856_100248267 | Ga0068856_1002482672 | 323 |
| 311 | 3300005842 | Ga0068858_100479678 | Ga0068858_1004796781 | 323 |
| 312 | 3300006175 | Ga0070712_100005373 | Ga0070712_1000053737 | 323 |
| 313 | 3300006844 | Ga0075428_100045321 | Ga0075428_1000453214 | 323 |
| 314 | 3300006847 | Ga0075431_100144562 | Ga0075431_1001445622 | 323 |
| 315 | 3300006852 | Ga0075433_10003583 | Ga0075433_1000358311 | 323 |
| 316 | 3300006871 | Ga0075434_100003765 | Ga0075434_1000037654 | 323 |
| 317 | 3300006914 | Ga0075436_100021371 | Ga0075436_1000213713 | 323 |
| 318 | 3300007076 | Ga0075435_100007194 | Ga0075435_1000071947 | 323 |
| 319 | 3300009766 | Ga0123342_1019876 | Ga0123342_10198765 | 323 |
| 320 | 3300025915 | Ga0207693_10025573 | Ga0207693_100255733 | 323 |
| 321 | 3300025923 | Ga0207681_10297578 | Ga0207681_102975782 | 323 |
| 322 | 3300025932 | Ga0207690_10012744 | Ga0207690_100127444 | 323 |
| 323 | 3300025933 | Ga0207706_10005948 | Ga0207706_100059485 | 323 |
| 324 | 3300025945 | Ga0207679_10021491 | Ga0207679_100214913 | 323 |
| 325 | 3300025972 | Ga0207668_10042642 | Ga0207668_100426423 | 323 |
| 326 | 3300026067 | Ga0207678_10005382 | Ga0207678_100053825 | 323 |
| 327 | 3300026116 | Ga0207674_10031304 | Ga0207674_100313045 | 323 |
| 328 | 3300027907 | Ga0207428_10005960 | Ga0207428_1000596010 | 323 |
| 329 | 3300035111 | Ga0373923_0010872 | Ga0373923_0010872_2193_3173 | 323 |
| 330 | 3300035172 | Ga0373955_0013111 | Ga0373955_0013111_2573_3553 | 323 |
| 331 | 3300035410 | Ga0373924_0015934 | Ga0373924_0015934_1779_2759 | 323 |
| 332 | 3300035724 | Ga0373933_0019279 | Ga0373933_0019279_2754_3734 | 323 |
| 333 | 3300036401 | Ga0373937_0029258 | Ga0373937_0029258_2385_3365 | 323 |
| 334 | 3300037068 | Ga0373925_0041213 | Ga0373925_0041213_1515_2495 | 323 |
| 335 | 3300046454 | Ga0495592_0005999 | Ga0495592_0005999_7747_8727 | 323 |
| 336 | 3300046459 | Ga0495629_0019054 | Ga0495629_0019054_2735_3715 | 323 |
| 337 | 3300046462 | Ga0495651_0003482 | Ga0495651_0003482_2716_3696 | 323 |
| 338 | 3300046475 | Ga0495639_0051043 | Ga0495639_0051043_310_1290 | 323 |
| 339 | 3300046514 | Ga0495618_0001008 | Ga0495618_0001008_2655_3635 | 323 |
| 340 | 3300046516 | Ga0495628_0086013 | Ga0495628_0086013_1419_2399 | 323 |
| 341 | 3300046529 | Ga0495652_0018566 | Ga0495652_0018566_2483_3463 | 323 |
| 342 | 3300046533 | Ga0495640_0013082 | Ga0495640_0013082_2620_3600 | 323 |
| 343 | 3300046559 | Ga0495667_0011350 | Ga0495667_0011350_4035_5015 | 323 |
| 344 | 3300046642 | Ga0495634_0028224 | Ga0495634_0028224_2874_3854 | 323 |
| 345 | 3300046675 | Ga0495657_0042675 | Ga0495657_0042675_1835_2815 | 323 |
| 346 | 3300046679 | Ga0495623_0001454 | Ga0495623_0001454_1332_2312 | 323 |
| 347 | 3300046680 | Ga0495646_0097961 | Ga0495646_0097961_587_1567 | 323 |
| 348 | 3300046690 | Ga0495624_0099694 | Ga0495624_0099694_36_1016 | 323 |
| 349 | 3300046809 | Ga0495600_0026453 | Ga0495600_0026453_41_1021 | 323 |
| 350 | 3300047317 | Ga0495604_0001548 | Ga0495604_0001548_15313_16293 | 323 |
| 351 | 3300047319 | Ga0495674_0004555 | Ga0495674_0004555_2670_3650 | 323 |
| 352 | 3300047322 | Ga0495680_0007192 | Ga0495680_0007192_6537_7517 | 323 |
| 353 | 3300047444 | Ga0495675_0046477 | Ga0495675_0046477_1669_2649 | 323 |
| 354 | 3300048088 | Ga0495602_0018335 | Ga0495602_0018335_3223_4203 | 323 |
| 355 | 3300053078 | Ga0495612_0008778 | Ga0495612_0008778_2643_3623 | 323 |
| 356 | 3300053084 | Ga0495595_0000901 | Ga0495595_0000901_2726_3706 | 323 |
| 357 | iso_pu_bacteria | 2529292951 | 2530648899 | 323 |
| 358 | iso_pu_bacteria | 8056681323 | 8056681885 | 323 |
| 359 | 3300003771 | Ga0055526_1012112 | Ga0055526_10121123 | 324 |
| 360 | 3300003790 | Ga0055528_1000266 | Ga0055528_100026642 | 324 |
| 361 | 3300025273 | Ga0209673_1000005 | Ga0209673_100000565 | 324 |
| 362 | 3300025294 | Ga0209025_1015999 | Ga0209025_10159992 | 324 |
| 363 | 3300025295 | Ga0209564_1008492 | Ga0209564_10084922 | 324 |
| 364 | 3300025299 | Ga0209256_1001252 | Ga0209256_100125219 | 324 |
| 365 | 3300031595 | Ga0265313_10017938 | Ga0265313_100179382 | 324 |
| 366 | 3300045976 | Ga0466967_0180644 | Ga0466967_0180644_112_1200 | 324 |
| 367 | 3300048929 | Ga0496126_0197392 | Ga0496126_0197392_151_1134 | 324 |
| 368 | 3300049823 | Ga0501044_0052784 | Ga0501044_0052784_973_1968 | 324 |
| 369 | iso_pu_bacteria | 2503198000 | 2503200471 | 324 |
| 370 | iso_pu_bacteria | 2508501128 | 2509148646 | 324 |
| 371 | iso_pu_bacteria | 2582581316 | 2585335466 | 324 |
| 372 | iso_pu_bacteria | 2775507266 | 2778176932 | 324 |
| 373 | iso_pu_bacteria | 2842482326 | 2842484285 | 324 |
| 374 | iso_pu_bacteria | 2958144490 | 2958148214 | 324 |
| 375 | 3300009174 | Ga0105241_10056102 | Ga0105241_100561021 | 325 |
| 376 | 3300042008 | Ga0439450_009916 | Ga0439450_009916_127_1113 | 325 |
| 377 | 3300048906 | Ga0496103_0271853 | Ga0496103_0271853_43_1029 | 325 |
| 378 | 3300048908 | Ga0496105_0047601 | Ga0496105_0047601_777_1763 | 325 |
| 379 | 3300048915 | Ga0496112_0107322 | Ga0496112_0107322_55_1041 | 325 |
| 380 | 3300048916 | Ga0496113_0187729 | Ga0496113_0187729_369_1355 | 325 |
| 381 | 3300048922 | Ga0496119_0056763 | Ga0496119_0056763_1049_2032 | 325 |
| 382 | 3300048927 | Ga0496124_0167086 | Ga0496124_0167086_151_1134 | 325 |
| 383 | 3300053125 | Ga0500618_000190 | Ga0500618_000190_40076_41092 | 325 |
| 384 | 3300060353 | Ga0501082_0300851 | Ga0501082_0300851_265_1338 | 325 |
| 385 | iso_pu_bacteria | 2512875016 | 2512932166 | 325 |
| 386 | iso_pu_bacteria | 2585427633 | 2585993344 | 325 |
| 387 | iso_pu_bacteria | 2588253730 | 2588518216 | 325 |
| 388 | iso_pu_bacteria | 2847686936 | 2847691501 | 325 |
| 389 | iso_pu_bacteria | 2874102143 | 2874102774 | 325 |
| 390 | iso_pu_bacteria | 2876363079 | 2876367805 | 325 |
| 391 | iso_pu_bacteria | 2891373044 | 2891378060 | 325 |
| 392 | iso_pu_bacteria | 2903448605 | 2903450584 | 325 |
| 393 | iso_pu_bacteria | 2903521522 | 2903521677 | 325 |
| 394 | iso_pu_bacteria | 2903528002 | 2903528055 | 325 |
| 395 | iso_pu_bacteria | 2906328253 | 2906330318 | 325 |
| 396 | iso_pu_bacteria | 2909042592 | 2909045358 | 325 |
| 397 | iso_pu_bacteria | 2937848649 | 2937849950 | 325 |
| 398 | iso_pu_bacteria | 2937891427 | 2937892108 | 325 |
| 399 | iso_pu_bacteria | 2958115193 | 2958116351 | 325 |
| 400 | iso_pu_bacteria | 2963644680 | 2963647041 | 325 |
| 401 | iso_pu_bacteria | 2965062239 | 2965065768 | 325 |
| 402 | iso_pu_bacteria | 2968083720 | 2968088157 | 325 |
| 403 | iso_pu_bacteria | 2968091066 | 2968095137 | 325 |
| 404 | iso_pu_bacteria | 2968097103 | 2968101864 | 325 |
| 405 | iso_pu_bacteria | 2968128360 | 2968130693 | 325 |
| 406 | iso_pu_bacteria | 2977858184 | 2977864775 | 325 |
| 407 | iso_pu_bacteria | 2977922695 | 2977928564 | 325 |
| 408 | iso_pu_bacteria | 2977986579 | 2977992788 | 325 |
| 409 | iso_pu_bacteria | 2979779861 | 2979781488 | 325 |
| 410 | iso_pu_bacteria | 2996893221 | 2996895456 | 325 |
| 411 | iso_pu_bacteria | 3004211236 | 3004215433 | 325 |
| 412 | iso_pu_bacteria | 3004218560 | 3004225724 | 325 |
| 413 | iso_pu_bacteria | 637000159 | 637075262 | 325 |
| 414 | iso_pu_bacteria | 8004445564 | 8004448862 | 325 |
| 415 | iso_pu_bacteria | 8004703790 | 8004708957 | 325 |
| 416 | iso_pu_bacteria | 8005382845 | 8005384315 | 325 |
| 417 | iso_pu_bacteria | 8005395548 | 8005401488 | 325 |
| 418 | 3300005365 | Ga0070688_100130504 | Ga0070688_1001305042 | 326 |
| 419 | 3300005456 | Ga0070678_100131626 | Ga0070678_1001316262 | 326 |
| 420 | 3300005548 | Ga0070665_100182921 | Ga0070665_1001829212 | 326 |
| 421 | 3300005842 | Ga0068858_100132096 | Ga0068858_1001320962 | 326 |
| 422 | 3300009101 | Ga0105247_10012304 | Ga0105247_100123044 | 326 |
| 423 | 3300013297 | Ga0157378_10010443 | Ga0157378_100104434 | 326 |
| 424 | 3300013308 | Ga0157375_10002209 | Ga0157375_1000220927 | 326 |
| 425 | 3300014968 | Ga0157379_10100811 | Ga0157379_101008113 | 326 |
| 426 | 3300025900 | Ga0207710_10020432 | Ga0207710_100204322 | 326 |
| 427 | 3300026121 | Ga0207683_10251259 | Ga0207683_102512592 | 326 |
| 428 | 3300028379 | Ga0268266_10389957 | Ga0268266_103899571 | 326 |
| 429 | 3300028381 | Ga0268264_10056786 | Ga0268264_100567863 | 326 |
| 430 | 3300048903 | Ga0496100_0025159 | Ga0496100_0025159_371_1369 | 326 |
| 431 | 3300048904 | Ga0496101_0091530 | Ga0496101_0091530_486_1484 | 326 |
| 432 | 3300048907 | Ga0496104_0010694 | Ga0496104_0010694_4712_5710 | 326 |
| 433 | 3300048910 | Ga0496107_0008334 | Ga0496107_0008334_2274_3272 | 326 |
| 434 | 3300048911 | Ga0496108_0041407 | Ga0496108_0041407_366_1364 | 326 |
| 435 | 3300048912 | Ga0496109_0078680 | Ga0496109_0078680_1337_2335 | 326 |
| 436 | 3300048912 | Ga0496109_0081879 | Ga0496109_0081879_548_1546 | 326 |
| 437 | 3300048916 | Ga0496113_0098800 | Ga0496113_0098800_176_1174 | 326 |
| 438 | 3300048917 | Ga0496114_0003929 | Ga0496114_0003929_1142_2140 | 326 |
| 439 | 3300048918 | Ga0496115_0006307 | Ga0496115_0006307_2947_3945 | 326 |
| 440 | 3300053158 | Ga0500627_0063583 | Ga0500627_0063583_71_1060 | 326 |
| 441 | iso_pu_bacteria | 2871495908 | 2871502634 | 326 |
| 442 | iso_pu_bacteria | 2874168670 | 2874169063 | 326 |
| 443 | iso_pu_bacteria | 2878760144 | 2878766526 | 326 |
| 444 | iso_pu_bacteria | 2878767105 | 2878773722 | 326 |
| 445 | iso_pu_bacteria | 2885305155 | 2885308681 | 326 |
| 446 | iso_pu_bacteria | 2885326080 | 2885328799 | 326 |
| 447 | iso_pu_bacteria | 2903540706 | 2903547675 | 326 |
| 448 | iso_pu_bacteria | 2937994558 | 2938001550 | 326 |
| 449 | iso_pu_bacteria | 2958165035 | 2958171704 | 326 |
| 450 | iso_pu_bacteria | 2961163497 | 2961170145 | 326 |
| 451 | iso_pu_bacteria | 2965018300 | 2965024896 | 326 |
| 452 | iso_pu_bacteria | 2968171901 | 2968178537 | 326 |
| 453 | iso_pu_bacteria | 2970554993 | 2970561382 | 326 |
| 454 | iso_pu_bacteria | 2987659509 | 2987666386 | 326 |
| 455 | iso_pu_bacteria | 3002141150 | 3002142290 | 326 |
| 456 | iso_pu_bacteria | 3004188549 | 3004195392 | 326 |
| 457 | 3300025297 | Ga0209758_1039505 | Ga0209758_10395051 | 327 |
| 458 | 3300035695 | Ga0373927_0094172 | Ga0373927_0094172_743_1753 | 327 |
| 459 | 3300035725 | Ga0373947_0098696 | Ga0373947_0098696_475_1485 | 327 |
| 460 | 3300037068 | Ga0373925_0063577 | Ga0373925_0063577_94_1104 | 327 |
| 461 | 3300037471 | Ga0395905_0000453 | Ga0395905_0000453_46968_48026 | 327 |
| 462 | 3300038735 | Ga0400485_11087 | Ga0400485_11087_305_1366 | 327 |
| 463 | 3300038742 | Ga0400486_14522 | Ga0400486_14522_362_1423 | 327 |
| 464 | 3300046455 | Ga0495603_0012906 | Ga0495603_0012906_3720_4730 | 327 |
| 465 | 3300046459 | Ga0495629_0009718 | Ga0495629_0009718_4081_5091 | 327 |
| 466 | 3300046472 | Ga0495580_0006645 | Ga0495580_0006645_321_1331 | 327 |
| 467 | 3300046473 | Ga0495582_0065990 | Ga0495582_0065990_254_1264 | 327 |
| 468 | 3300046475 | Ga0495639_0014679 | Ga0495639_0014679_1850_2860 | 327 |
| 469 | 3300046499 | Ga0495594_0045275 | Ga0495594_0045275_412_1422 | 327 |
| 470 | 3300046526 | Ga0495666_0106087 | Ga0495666_0106087_114_1124 | 327 |
| 471 | 3300046557 | Ga0495622_0048038 | Ga0495622_0048038_419_1429 | 327 |
| 472 | 3300046674 | Ga0495588_0058275 | Ga0495588_0058275_577_1587 | 327 |
| 473 | 3300046689 | Ga0495613_0012706 | Ga0495613_0012706_1433_2443 | 327 |
| 474 | 3300047315 | Ga0495581_0011585 | Ga0495581_0011585_459_1469 | 327 |
| 475 | 3300047322 | Ga0495680_0172685 | Ga0495680_0172685_348_1358 | 327 |
| 476 | 3300047673 | Ga0495593_0020131 | Ga0495593_0020131_1993_3003 | 327 |
| 477 | 3300048922 | Ga0496119_0030687 | Ga0496119_0030687_766_1818 | 327 |
| 478 | 3300048923 | Ga0496120_0084150 | Ga0496120_0084150_178_1233 | 327 |
| 479 | 3300049568 | Ga0501031_0000202 | Ga0501031_0000202_11231_12220 | 327 |
| 480 | 3300049569 | Ga0501032_0000443 | Ga0501032_0000443_21728_22717 | 327 |
| 481 | 3300049570 | Ga0501033_0000097 | Ga0501033_0000097_11231_12220 | 327 |
| 482 | 3300049571 | Ga0501034_0000186 | Ga0501034_0000186_104279_105268 | 327 |
| 483 | 3300049572 | Ga0501036_0000002 | Ga0501036_0000002_280889_281878 | 327 |
| 484 | 3300049573 | Ga0501037_0000443 | Ga0501037_0000443_11224_12213 | 327 |
| 485 | 3300049574 | Ga0501038_0000867 | Ga0501038_0000867_14548_15537 | 327 |
| 486 | 3300049575 | Ga0501039_0000002 | Ga0501039_0000002_362933_363922 | 327 |
| 487 | 3300049576 | Ga0501040_0001925 | Ga0501040_0001925_5914_6903 | 327 |
| 488 | 3300049579 | Ga0501043_0000543 | Ga0501043_0000543_21707_22696 | 327 |
| 489 | 3300049581 | Ga0501047_0002364 | Ga0501047_0002364_11162_12151 | 327 |
| 490 | 3300049586 | Ga0501070_0012803 | Ga0501070_0012803_4362_5351 | 327 |
| 491 | 3300049822 | Ga0501035_0000100 | Ga0501035_0000100_95102_96091 | 327 |
| 492 | 3300049823 | Ga0501044_0000002 | Ga0501044_0000002_11231_12220 | 327 |
| 493 | 3300050492 | nmdc:mga0yw44_235089_c1 | nmdc:mga0yw44_235089_c1_104_1093 | 327 |
| 494 | 3300053085 | Ga0495619_0014841 | Ga0495619_0014841_2727_3737 | 327 |
| 495 | iso_pu_bacteria | 2617270742 | 2617386716 | 327 |
| 496 | iso_pu_bacteria | 2818991461 | 2819685303 | 327 |
| 497 | iso_pu_bacteria | 2869162929 | 2869167496 | 327 |
| 498 | iso_pu_bacteria | 8056681323 | 8056689409 | 327 |
| 499 | 3300002737 | JGI25162J39368_1000111 | JGI25162J39368_100011125 | 328 |
| 500 | 3300003214 | JGI25165J46597_1000440 | JGI25165J46597_100044013 | 328 |
| 501 | 3300006028 | Ga0070717_10035625 | Ga0070717_100356252 | 328 |
| 502 | 3300006941 | Ga0099825_1026238 | Ga0099825_10262381 | 328 |
| 503 | 3300006943 | Ga0099822_1036162 | Ga0099822_10361624 | 328 |
| 504 | 3300025233 | Ga0209437_100064 | Ga0209437_10006490 | 328 |
| 505 | 3300025261 | Ga0209233_1000081 | Ga0209233_1000081211 | 328 |
| 506 | 3300027357 | Ga0209589_1006990 | Ga0209589_100699010 | 328 |
| 507 | 3300027361 | Ga0209489_106620 | Ga0209489_1066209 | 328 |
| 508 | 3300027363 | Ga0209700_106374 | Ga0209700_10637410 | 328 |
| 509 | 3300031235 | Ga0265330_10006943 | Ga0265330_100069433 | 328 |
| 510 | 3300046455 | Ga0495603_0056315 | Ga0495603_0056315_130_1125 | 328 |
| 511 | iso_pu_bacteria | 2510917022 | 2511131290 | 328 |
| 512 | iso_pu_bacteria | 2513237090 | 2513611968 | 328 |
| 513 | iso_pu_bacteria | 2582581307 | 2585274499 | 328 |
| 514 | iso_pu_bacteria | 2585427531 | 2585561857 | 328 |
| 515 | iso_pu_bacteria | 2585427608 | 2585902457 | 328 |
| 516 | iso_pu_bacteria | 2585427609 | 2585907588 | 328 |
| 517 | iso_pu_bacteria | 2585428125 | 2587983009 | 328 |
| 518 | iso_pu_bacteria | 2599185301 | 2599936098 | 328 |
| 519 | iso_pu_bacteria | 2615840698 | 2616552678 | 328 |
| 520 | iso_pu_bacteria | 2667528174 | 2671113035 | 328 |
| 521 | iso_pu_bacteria | 2693429783 | 2694632403 | 328 |
| 522 | iso_pu_bacteria | 2693429784 | 2694639153 | 328 |
| 523 | iso_pu_bacteria | 2818991448 | 2819613588 | 328 |
| 524 | iso_pu_bacteria | 2838029111 | 2838031554 | 328 |
| 525 | iso_pu_bacteria | 2842475841 | 2842478286 | 328 |
| 526 | iso_pu_bacteria | 2842502639 | 2842505768 | 328 |
| 527 | iso_pu_bacteria | 2847670302 | 2847675317 | 328 |
| 528 | iso_pu_bacteria | 2856314179 | 2856314877 | 328 |
| 529 | iso_pu_bacteria | 2856364286 | 2856366247 | 328 |
| 530 | iso_pu_bacteria | 2857349434 | 2857351416 | 328 |
| 531 | iso_pu_bacteria | 2869285874 | 2869287282 | 328 |
| 532 | iso_pu_bacteria | 2871429161 | 2871430581 | 328 |
| 533 | iso_pu_bacteria | 2874146452 | 2874149140 | 328 |
| 534 | iso_pu_bacteria | 2874155637 | 2874156073 | 328 |
| 535 | iso_pu_bacteria | 2876392853 | 2876394061 | 328 |
| 536 | iso_pu_bacteria | 2876413966 | 2876415436 | 328 |
| 537 | iso_pu_bacteria | 2878035449 | 2878042120 | 328 |
| 538 | iso_pu_bacteria | 2878745973 | 2878747014 | 328 |
| 539 | iso_pu_bacteria | 2885383462 | 2885388735 | 328 |
| 540 | iso_pu_bacteria | 2888350351 | 2888355502 | 328 |
| 541 | iso_pu_bacteria | 2889016732 | 2889017859 | 328 |
| 542 | iso_pu_bacteria | 2903492973 | 2903500469 | 328 |
| 543 | iso_pu_bacteria | 2903768456 | 2903777793 | 328 |
| 544 | iso_pu_bacteria | 2904659560 | 2904660392 | 328 |
| 545 | iso_pu_bacteria | 2906308376 | 2906309827 | 328 |
| 546 | iso_pu_bacteria | 2906321335 | 2906322462 | 328 |
| 547 | iso_pu_bacteria | 2906414383 | 2906419521 | 328 |
| 548 | iso_pu_bacteria | 2919408235 | 2919412824 | 328 |
| 549 | iso_pu_bacteria | 2922130491 | 2922134202 | 328 |
| 550 | iso_pu_bacteria | 2937813078 | 2937814874 | 328 |
| 551 | iso_pu_bacteria | 2938014810 | 2938016038 | 328 |
| 552 | iso_pu_bacteria | 2958041894 | 2958046704 | 328 |
| 553 | iso_pu_bacteria | 2958100919 | 2958104819 | 328 |
| 554 | iso_pu_bacteria | 2958130278 | 2958131782 | 328 |
| 555 | iso_pu_bacteria | 2958172287 | 2958172894 | 328 |
| 556 | iso_pu_bacteria | 2958179912 | 2958180842 | 328 |
| 557 | iso_pu_bacteria | 2961077736 | 2961078680 | 328 |
| 558 | iso_pu_bacteria | 2961114664 | 2961115717 | 328 |
| 559 | iso_pu_bacteria | 2965119406 | 2965124033 | 328 |
| 560 | iso_pu_bacteria | 2968110612 | 2968111450 | 328 |
| 561 | iso_pu_bacteria | 2968117919 | 2968119720 | 328 |
| 562 | iso_pu_bacteria | 2977843712 | 2977845665 | 328 |
| 563 | iso_pu_bacteria | 2977942078 | 2977945236 | 328 |
| 564 | iso_pu_bacteria | 2979710463 | 2979716463 | 328 |
| 565 | iso_pu_bacteria | 2987636660 | 2987638600 | 328 |
| 566 | iso_pu_bacteria | 2987652177 | 2987659428 | 328 |
| 567 | iso_pu_bacteria | 3004203850 | 3004205157 | 328 |
| 568 | iso_pu_bacteria | 3005416602 | 3005420952 | 328 |
| 569 | iso_pu_bacteria | 8004387939 | 8004389119 | 328 |
| 570 | iso_pu_bacteria | 8004640170 | 8004641027 | 328 |
| 571 | iso_pu_bacteria | 8004714634 | 8004716182 | 328 |
| 572 | iso_pu_bacteria | 8005314921 | 8005319313 | 328 |
| 573 | iso_pu_bacteria | 8005484373 | 8005489348 | 328 |
| 574 | iso_pu_bacteria | 8005645114 | 8005650247 | 328 |
| 575 | iso_pu_bacteria | 8005682033 | 8005683886 | 328 |
| 576 | 3300003762 | Ga0055542_1000675 | Ga0055542_100067515 | 329 |
| 577 | 3300003763 | Ga0055529_1002284 | Ga0055529_10022842 | 329 |
| 578 | 3300005578 | Ga0068854_100043279 | Ga0068854_1000432794 | 329 |
| 579 | 3300005614 | Ga0068856_100123122 | Ga0068856_1001231223 | 329 |
| 580 | 3300005834 | Ga0068851_10071177 | Ga0068851_100711773 | 329 |
| 581 | 3300006042 | Ga0075368_10026371 | Ga0075368_100263712 | 329 |
| 582 | 3300006051 | Ga0075364_10043782 | Ga0075364_100437821 | 329 |
| 583 | 3300006178 | Ga0075367_10124175 | Ga0075367_101241752 | 329 |
| 584 | 3300009174 | Ga0105241_10038836 | Ga0105241_100388361 | 329 |
| 585 | 3300010375 | Ga0105239_10040094 | Ga0105239_100400947 | 329 |
| 586 | 3300010375 | Ga0105239_10100974 | Ga0105239_101009741 | 329 |
| 587 | 3300010375 | Ga0105239_10216133 | Ga0105239_102161332 | 329 |
| 588 | 3300013296 | Ga0157374_10052373 | Ga0157374_100523734 | 329 |
| 589 | 3300014497 | Ga0182008_10008376 | Ga0182008_100083763 | 329 |
| 590 | 3300025233 | Ga0209437_104235 | Ga0209437_1042353 | 329 |
| 591 | 3300025253 | Ga0209677_102562 | Ga0209677_1025623 | 329 |
| 592 | 3300025254 | Ga0209148_1000124 | Ga0209148_100012412 | 329 |
| 593 | 3300025261 | Ga0209233_1000203 | Ga0209233_100020318 | 329 |
| 594 | 3300025272 | Ga0209455_1000062 | Ga0209455_1000062239 | 329 |
| 595 | 3300025911 | Ga0207654_10054593 | Ga0207654_100545932 | 329 |
| 596 | 3300025913 | Ga0207695_10000118 | Ga0207695_10000118103 | 329 |
| 597 | 3300025914 | Ga0207671_10001634 | Ga0207671_100016347 | 329 |
| 598 | 3300025981 | Ga0207640_10070828 | Ga0207640_100708283 | 329 |
| 599 | 3300025981 | Ga0207640_10075654 | Ga0207640_100756541 | 329 |
| 600 | 3300026041 | Ga0207639_10335319 | Ga0207639_103353192 | 329 |
| 601 | 3300026078 | Ga0207702_10365015 | Ga0207702_103650151 | 329 |
| 602 | 3300026142 | Ga0207698_10242608 | Ga0207698_102426081 | 329 |
| 603 | 3300028379 | Ga0268266_10031949 | Ga0268266_100319494 | 329 |
| 604 | 3300028379 | Ga0268266_10055237 | Ga0268266_100552372 | 329 |
| 605 | 3300037466 | Ga0395898_0106615 | Ga0395898_0106615_573_1571 | 329 |
| 606 | 3300048915 | Ga0496112_0035556 | Ga0496112_0035556_2440_3498 | 329 |
| 607 | 3300053125 | Ga0500618_007745 | Ga0500618_007745_1918_2928 | 329 |
| 608 | iso_pu_bacteria | 3004334049 | 3004335269 | 329 |
| 609 | 3300009545 | Ga0105237_10012127 | Ga0105237_100121275 | 330 |
| 610 | 3300013105 | Ga0157369_10204921 | Ga0157369_102049211 | 330 |
| 611 | 3300027296 | Ga0209389_1000260 | Ga0209389_100026017 | 330 |
| 612 | 3300027361 | Ga0209489_104601 | Ga0209489_10460114 | 330 |
| 613 | 3300027363 | Ga0209700_102937 | Ga0209700_10293718 | 330 |
| 614 | 3300031712 | Ga0265342_10006640 | Ga0265342_100066407 | 330 |
| 615 | 3300038443 | Ga0395901_0613680 | Ga0395901_0613680_70_1071 | 330 |
| 616 | 3300039450 | Ga0436363_1586464 | Ga0436363_1586464_1479_2480 | 330 |
| 617 | 3300046507 | Ga0495606_0149738 | Ga0495606_0149738_49_1050 | 330 |
| 618 | 3300002705 | JGI25156J39149_1008154 | JGI25156J39149_10081542 | 331 |
| 619 | 3300002741 | JGI25157J39369_1000667 | JGI25157J39369_10006678 | 331 |
| 620 | 3300005548 | Ga0070665_100013224 | Ga0070665_1000132247 | 331 |
| 621 | 3300006175 | Ga0070712_100145639 | Ga0070712_1001456392 | 331 |
| 622 | 3300009176 | Ga0105242_10243320 | Ga0105242_102433201 | 331 |
| 623 | 3300025250 | Ga0209026_1000247 | Ga0209026_100024752 | 331 |
| 624 | 3300025256 | Ga0209759_1000585 | Ga0209759_100058521 | 331 |
| 625 | 3300025261 | Ga0209233_1012521 | Ga0209233_10125213 | 331 |
| 626 | 3300025915 | Ga0207693_10018579 | Ga0207693_100185791 | 331 |
| 627 | 3300028379 | Ga0268266_10050305 | Ga0268266_100503054 | 331 |
| 628 | 3300047472 | Ga0495686_0000547 | Ga0495686_0000547_5235_6239 | 331 |
| 629 | 3300048903 | Ga0496100_0135721 | Ga0496100_0135721_221_1285 | 331 |
| 630 | 3300002067 | JGI24735J21928_10057478 | JGI24735J21928_100574781 | 332 |
| 631 | 3300002704 | JGI25155J39150_1000183 | JGI25155J39150_100018322 | 332 |
| 632 | 3300002705 | JGI25156J39149_1000405 | JGI25156J39149_100040522 | 332 |
| 633 | 3300002738 | JGI25154J39366_1000342 | JGI25154J39366_10003423 | 332 |
| 634 | 3300002741 | JGI25157J39369_1000437 | JGI25157J39369_100043722 | 332 |
| 635 | 3300003214 | JGI25165J46597_1000006 | JGI25165J46597_1000006218 | 332 |
| 636 | 3300003214 | JGI25165J46597_1000018 | JGI25165J46597_1000018185 | 332 |
| 637 | 3300003322 | rootL2_10017530 | rootL2_100175308 | 332 |
| 638 | 3300003323 | rootH1_10007065 | rootH1_1000706518 | 332 |
| 639 | 3300003323 | rootH1_10102124 | rootH1_101021246 | 332 |
| 640 | 3300005331 | Ga0070670_100017672 | Ga0070670_1000176725 | 332 |
| 641 | 3300005539 | Ga0068853_100006123 | Ga0068853_1000061235 | 332 |
| 642 | 3300005577 | Ga0068857_100168348 | Ga0068857_1001683481 | 332 |
| 643 | 3300005614 | Ga0068856_100008489 | Ga0068856_1000084896 | 332 |
| 644 | 3300005614 | Ga0068856_100239981 | Ga0068856_1002399812 | 332 |
| 645 | 3300006178 | Ga0075367_10102900 | Ga0075367_101029002 | 332 |
| 646 | 3300006943 | Ga0099822_1008884 | Ga0099822_100888410 | 332 |
| 647 | 3300009545 | Ga0105237_10197811 | Ga0105237_101978112 | 332 |
| 648 | 3300010375 | Ga0105239_10318958 | Ga0105239_103189582 | 332 |
| 649 | 3300025206 | Ga0209435_100039 | Ga0209435_100039106 | 332 |
| 650 | 3300025228 | Ga0209672_103894 | Ga0209672_1038943 | 332 |
| 651 | 3300025233 | Ga0209437_100022 | Ga0209437_100022247 | 332 |
| 652 | 3300025246 | Ga0209646_1000137 | Ga0209646_10001375 | 332 |
| 653 | 3300025250 | Ga0209026_1000135 | Ga0209026_1000135106 | 332 |
| 654 | 3300025256 | Ga0209759_1000154 | Ga0209759_10001545 | 332 |
| 655 | 3300025261 | Ga0209233_1000010 | Ga0209233_1000010799 | 332 |
| 656 | 3300025261 | Ga0209233_1000031 | Ga0209233_1000031247 | 332 |
| 657 | 3300025297 | Ga0209758_1008525 | Ga0209758_10085255 | 332 |
| 658 | 3300025904 | Ga0207647_10004530 | Ga0207647_100045301 | 332 |
| 659 | 3300025924 | Ga0207694_10027043 | Ga0207694_100270432 | 332 |
| 660 | 3300025925 | Ga0207650_10011291 | Ga0207650_100112913 | 332 |
| 661 | 3300025939 | Ga0207665_10169100 | Ga0207665_101691001 | 332 |
| 662 | 3300025949 | Ga0207667_10280376 | Ga0207667_102803761 | 332 |
| 663 | 3300026041 | Ga0207639_10023099 | Ga0207639_100230993 | 332 |
| 664 | 3300026078 | Ga0207702_10026926 | Ga0207702_100269263 | 332 |
| 665 | 3300026116 | Ga0207674_10568160 | Ga0207674_105681601 | 332 |
| 666 | 3300027296 | Ga0209389_1000046 | Ga0209389_100004649 | 332 |
| 667 | 3300027312 | Ga0209371_1001381 | Ga0209371_100138112 | 332 |
| 668 | 3300027357 | Ga0209589_1000175 | Ga0209589_100017545 | 332 |
| 669 | 3300027361 | Ga0209489_100112 | Ga0209489_10011249 | 332 |
| 670 | 3300027363 | Ga0209700_100029 | Ga0209700_10002992 | 332 |
| 671 | 3300030500 | Ga0268256_1000851 | Ga0268256_100085112 | 332 |
| 672 | 3300035695 | Ga0373927_0102367 | Ga0373927_0102367_833_1840 | 332 |
| 673 | 3300037418 | Ga0395900_0046118 | Ga0395900_0046118_1110_2108 | 332 |
| 674 | 3300037471 | Ga0395905_0100559 | Ga0395905_0100559_1553_2551 | 332 |
| 675 | 3300037471 | Ga0395905_0128431 | Ga0395905_0128431_597_1595 | 332 |
| 676 | 3300038443 | Ga0395901_0218817 | Ga0395901_0218817_470_1468 | 332 |
| 677 | 3300044658 | Ga0466972_0043178 | Ga0466972_0043178_1028_2026 | 332 |
| 678 | 3300046507 | Ga0495606_0001553 | Ga0495606_0001553_24405_25460 | 332 |
| 679 | 3300048905 | Ga0496102_0051287 | Ga0496102_0051287_1164_2162 | 332 |
| 680 | 3300048906 | Ga0496103_0051952 | Ga0496103_0051952_584_1582 | 332 |
| 681 | 3300048910 | Ga0496107_0218641 | Ga0496107_0218641_53_1066 | 332 |
| 682 | 3300048915 | Ga0496112_0134220 | Ga0496112_0134220_973_1971 | 332 |
| 683 | 3300048922 | Ga0496119_0025321 | Ga0496119_0025321_578_1576 | 332 |
| 684 | 3300048923 | Ga0496120_0002639 | Ga0496120_0002639_14092_15090 | 332 |
| 685 | 3300048924 | Ga0496121_0037640 | Ga0496121_0037640_2765_3820 | 332 |
| 686 | 3300048926 | Ga0496123_0008448 | Ga0496123_0008448_5752_6984 | 332 |
| 687 | 3300050492 | nmdc:mga0yw44_241515_c1 | nmdc:mga0yw44_241515_c1_49_1047 | 332 |
| 688 | 3300050492 | nmdc:mga0yw44_38577_c1 | nmdc:mga0yw44_38577_c1_28_1077 | 332 |
| 689 | 3300053122 | Ga0500608_117869 | Ga0500608_117869_132_1136 | 332 |
| 690 | iso_pu_bacteria | 2585427634 | 2586003993 | 332 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4y4v-assembly1.cif.gz_B | structure of helicobacter pylori csd6 in the d-ala-bound state | 0.5747 | 75 | 263 |
| 7o21-assembly1.cif.gz_A | structure of bdellovibrio bacteriovorus bd1075 | 0.5659 | 98 | 263 |
| 1pn2-assembly2.cif.gz_C | crystal structure analysis of the selenomethionine labelled 2-enoyl-coa hydratase 2 domain of candida tropicalis multifunctional enzyme type 2 | 0.5207 | 146 | 179 |
| 1pn2-assembly1.cif.gz_B | crystal structure analysis of the selenomethionine labelled 2-enoyl-coa hydratase 2 domain of candida tropicalis multifunctional enzyme type 2 | 0.5118 | 146 | 179 |
| 4ml9-assembly1.cif.gz_A | crystal structure of uncharacterized tim barrel protein with the conserved phosphate binding site fromsebaldella termitidis | 0.4853 | 290 | 318 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9U2U6_567_691_3.30.1520.10 | Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain | 0.6795 | 152 | 197 | 3.30.1520.10 |
| af_Q8LSQ2_65_122_2.40.50.40 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); | 0.5729 | 154 | 181 | 2.40.50.40 |
| af_Q6MWW2_15_285_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.5369 | 148 | 179 | 3.10.129.10 |
| 1pn2C01 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.512 | 144 | 179 | 3.10.129.10 |
| 4h83D01 | Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain | 0.5037 | 145 | 180 | 3.30.390.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-G2E0M9-F1-model_v4 | ErfK/YbiS/YcfS/YnhG family protein | 0.9507 | 28 | 331 |
|
| AF-A0A435C132-F1-model_v4 | deleted | 0.9504 | 81 | 332 |
|
| AF-A0A0A8K4M9-F1-model_v4 | YkuD domain-containing protein | 0.9419 | 30 | 332 |
|
| AF-A0A435C132-F1-model_v4 | deleted | 0.9393 | 81 | 332 |
|
| AF-N6V0H3-F1-model_v4 | YkuD domain-containing protein | 0.9392 | 28 | 331 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar