F475356

General Info

Members Datasets Scaffolds Average Seq Length
688 494 404 342

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2802429606|2805932902
Length 393
Sequence DISISHIGFLTPGNYSGDDPLSGLEQALQELHYGEKLGFDSAWVRQRHLEPGISSASAFLAAATQRTSRIELGTAVIPIGYESPYRLAEDLATVDVLSRGRLNIGVSAGRPLHAELIGPLAFDGDWTSYDFSHDRVLRFADNLRGTYLGDDETFIKTPFGPQRPRLQPYAKGLIDRIWYGGGSQRSAGWAGRNGFNLLTGNVITGEGTDDFFVAQSRLIKTYRDSGTQRRVALGRVIVPFDSADAATRRRYRDYADGRHQRTLSPQGERRTLFARDIVGTSEEILERLFADPILPDVSELRLELPYEFEHEEYRQILHDFVTRIAPGARMESAAGNSGRFLRGRRQTTSPIRHQTIILAGAFVSDQIGGIFLFDRLALVPHRLRCLYRTGGEE

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
5 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
6 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
7 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
8 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
9 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
10 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
11 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
12 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
13 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
14 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
15 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
16 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
17 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
18 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
19 2519899620 Rhizobium sp. Pop5 Isolate Nodule
20 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
21 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
22 2547132424 Nocardia nova SH22a Isolate Unclassified
23 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
24 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
25 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
26 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
27 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
28 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
29 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
30 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
31 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
32 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
33 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
34 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
35 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
36 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
37 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
38 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
39 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
40 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
41 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
42 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
43 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
44 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
45 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
46 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
47 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
48 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
49 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
50 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
51 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
52 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
53 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
54 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
55 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
56 2643221582 Rhizobium sp. Root651 Isolate Unclassified
57 2643221618 Ensifer sp. Root231 Isolate Unclassified
58 2643221626 Ensifer sp. Root31 Isolate Unclassified
59 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
60 2643221655 Ensifer sp. Root1252 Isolate Unclassified
61 2643221659 Ensifer sp. Root127 Isolate Unclassified
62 2643221672 Variovorax sp. Root434 Isolate Unclassified
63 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
64 2643221692 Nocardia sp. Root136 Isolate Unclassified
65 2643221693 Rhizobium sp. Root491 Isolate Unclassified
66 2643221698 Ensifer sp. Root142 Isolate Unclassified
67 2643221712 Ensifer sp. Root258 Isolate Unclassified
68 2643221718 Rhizobium sp. Root268 Isolate Unclassified
69 2643221723 Ensifer sp. Root278 Isolate Unclassified
70 2643221736 Bosea sp. Root483D1 Isolate Unclassified
71 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
72 2718217882 Rhizobium sp. N741 Isolate Nodule
73 2718217927 Rhizobium sp. N324 Isolate Nodule
74 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
75 2718218009 Rhizobium sp. N561 Isolate Nodule
76 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
77 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
78 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
79 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
80 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
81 2718218363 Rhizobium sp. N113 Isolate Nodule
82 2718218365 Rhizobium sp. N731 Isolate Nodule
83 2718218366 Rhizobium sp. N621 Isolate Nodule
84 2718218423 Rhizobium sp. N941 Isolate Nodule
85 2721755514 Rhizobium sp. N6212 Isolate Nodule
86 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
87 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
88 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
89 2721755809 Rhizobium sp. N541 Isolate Nodule
90 2721755810 Rhizobium sp. N871 Isolate Nodule
91 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
92 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
93 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
94 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
95 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
96 2728369365 Rhizobium sp. N1341 Isolate Nodule
97 2728369397 Rhizobium sp. N1314 Isolate Nodule
98 2738541307 Variovorax sp. GV008 Isolate Unclassified
99 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
100 2751185800 Brucella pituitosa AA2 Isolate Unclassified
101 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
102 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
103 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
104 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
105 2791355256 Rhizobium sp. M10 Isolate Nodule
106 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
107 2791355260 Rhizobium sp. L9 Isolate Nodule
108 2791355262 Rhizobium sp. M1 Isolate Nodule
109 2791355263 Rhizobium chutanense C5 Isolate Nodule
110 2791355264 Rhizobium sp. S9 Isolate Nodule
111 2791355267 Rhizobium sp. L18 Isolate Nodule
112 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
113 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
114 2802429633 Rhizobium anhuiense J3 Isolate Nodule
115 2802429634 Rhizobium anhuiense S10 Isolate Nodule
116 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
117 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
118 2802429637 Rhizobium anhuiense C15 Isolate Nodule
119 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
120 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
121 2818991446 Variovorax sp. 1180 Isolate Unclassified
122 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
123 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
124 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
125 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
126 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
127 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
128 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
129 2838061910 Rhizobium phaseoli L15 Isolate Nodule
130 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
131 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
132 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
133 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
134 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
135 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
136 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
137 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
138 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
139 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
140 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
141 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
142 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
143 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
144 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
145 2841760612 Bosea sp. Tri-49 Isolate Nodule
146 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
147 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
148 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
149 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
150 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
151 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
152 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
153 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
154 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
155 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
156 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
157 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
158 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
159 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
160 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
161 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
162 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
163 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
164 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
165 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
166 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
167 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
168 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
169 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
170 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
171 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
172 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
173 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
174 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
175 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
176 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
177 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
178 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
179 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
180 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
181 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
182 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
183 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
184 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
185 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
186 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
187 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
188 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
189 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
190 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
191 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
192 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
193 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
194 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
195 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
196 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
197 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
198 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
199 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
200 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
201 2844104063 Bosea sp. Tri-39 Isolate Nodule
202 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
203 2851182111 Bosea sp. Tri-44 Isolate Nodule
204 2851246043 Bosea sp. Tri-54 Isolate Nodule
205 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
206 2854911287 Brucella lupini LUP21 Isolate Unclassified
207 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
208 2885198086 Variovorax sp. 679 Isolate Unclassified
209 2885211737 Variovorax sp. 553 Isolate Unclassified
210 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
211 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
212 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
213 2899924645 Variovorax sp. 369 Isolate Unclassified
214 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
215 2909042592 Labrys sp. LIt4 Isolate Nodule
216 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
217 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
218 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
219 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
220 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
221 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
222 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
223 2928037797 Variovorax sp. 1126 Isolate Unclassified
224 2928044640 Variovorax sp. 1128 Isolate Unclassified
225 2928051484 Variovorax sp. 1133 Isolate Unclassified
226 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
227 2928070936 Variovorax gossypii 1167 Isolate Unclassified
228 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
229 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
230 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
231 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
232 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
233 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
234 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
235 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
236 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
237 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
238 2936381700 Rhizobium chutanense C16 Isolate Unclassified
239 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
240 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
241 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
242 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
243 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
244 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
245 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
246 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
247 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
248 2996893221 Rhizobium sp. R635 Isolate Nodule
249 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
250 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
251 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
252 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
253 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
254 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
255 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
256 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
257 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
258 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
259 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
260 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
261 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
262 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
263 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
264 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
265 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
266 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
267 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
268 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
269 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
270 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
271 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
272 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
273 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
274 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
275 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
276 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
277 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
278 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
279 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
280 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
281 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
282 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
283 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
284 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
285 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
286 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
287 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
288 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
289 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
290 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
291 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
292 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
293 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
294 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
295 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
296 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
297 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
298 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
299 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
300 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
301 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
302 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
303 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
304 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
305 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
306 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
307 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
308 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
309 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
310 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
311 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
312 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
313 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
314 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
315 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
316 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
317 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
318 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
319 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
320 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
321 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
322 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
323 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
324 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
325 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
326 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
327 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
328 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
329 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
330 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
331 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
332 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
333 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
334 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
335 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
336 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
337 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
338 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
339 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
340 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
341 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
342 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
343 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
344 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
345 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
346 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
347 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
348 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
349 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
360 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
361 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
362 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
365 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
366 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
367 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
368 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
369 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
370 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
371 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
372 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
373 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
374 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
375 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
376 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
377 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
378 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
379 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
380 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
381 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
382 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
383 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
384 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
385 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
386 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
387 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
388 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
389 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
390 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
391 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
392 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
393 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
394 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
395 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
396 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
397 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
398 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
399 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
400 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
401 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
402 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
403 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
404 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
405 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
406 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
407 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
408 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
409 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
410 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
411 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
412 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
413 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
414 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
415 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
416 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
417 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
418 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
419 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
420 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
421 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
422 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
423 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
424 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
425 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
426 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
427 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
428 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
429 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
431 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
432 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
433 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
434 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
435 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
436 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
437 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
438 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
439 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
440 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
441 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
442 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
443 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
444 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
445 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
446 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
447 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
448 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
449 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
450 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
451 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
452 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
453 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
454 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
455 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
456 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
457 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
458 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
459 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
460 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
461 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
462 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
463 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
464 8005258706 Rhizobium sp. R693 Isolate Nodule
465 8005275841 Rhizobium sp. N4311 Isolate Nodule
466 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
467 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
468 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
469 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
470 8005382845 Rhizobium sp. R634 Isolate Nodule
471 8005395548 Rhizobium sp. R339 Isolate Nodule
472 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
473 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
474 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
475 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
476 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
477 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
478 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
479 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
480 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
481 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
482 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
483 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
484 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
485 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
486 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
487 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
488 8018176218 Rhizobium sp. N122 Isolate Nodule
489 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
490 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
491 8024501048 Rhizobium sp. H4 Isolate Nodule
492 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
493 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
494 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 58.87
Metatranscriptomes 0
Isolates 41.13

Biome Distribution

Category Percentage (%)
Aerial Root 0.58
Bulb 0
Endosphere 28.05
Nodule 26.16
Rhizoplane 2.62
Rhizosphere 24.13
Stem 0
Stem Tuber 0
Unclassified 18.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10004429 3300001979 Bacteria 6040
2 JGI25155J39150_1000015 3300002704 Bacteria 178839
3 JGI25156J39149_1000007 3300002705 Bacteria 252108
4 JGI25162J39368_1000285 3300002737 Bacteria 47453
5 JGI25154J39366_1000051 3300002738 Bacteria 123608
6 JGI25157J39369_1000012 3300002741 Bacteria 205167
7 JGI25152J39213_1001255 3300002773 Bacteria 11515
8 JGI25150J39212_1001782 3300002774 Bacteria 5731
9 JGI25159J45721_1000012 3300002987 Bacteria 149808
10 JGI25159J45721_1000354 3300002987 Bacteria 21222
11 JGI25159J45721_1001088 3300002987 Bacteria 11584
12 JGI25159J45721_1008601 3300002987 Bacteria 2786
13 JGI25151J46595_10000341 3300003187 Bacteria 50002
14 JGI25151J46595_10000540 3300003187 Bacteria 35010
15 JGI25151J46595_10002343 3300003187 Bacteria 11515
16 JGI25165J46597_1000102 3300003214 Bacteria 155002
17 JGI25165J46597_1000198 3300003214 Bacteria 88888
18 JGI25165J46597_1006636 3300003214 Bacteria 2027
19 JGI25153J46596_10002155 3300003215 Bacteria 11515
20 rootH1_10072180 3300003316 Bacteria 4888
21 rootH1_10077486 3300003316 Bacteria 2557
22 rootL2_10016804 3300003322 Bacteria 37660
23 rootH1_10035402 3300003323 Bacteria 10091
24 rootH1_10097577 3300003323 Bacteria 5324
25 JGI25160J50197_1000026 3300003354 Bacteria 184693
26 JGI25160J50197_1000042 3300003354 Bacteria 149808
27 JGI25160J50197_1001503 3300003354 Bacteria 11584
28 JGI25160J50197_1001783 3300003354 Bacteria 10417
29 JGI25161J50226_1000014 3300003374 Bacteria 191109
30 JGI25161J50226_1000210 3300003374 Bacteria 37233
31 JGI25161J50226_1001923 3300003374 Bacteria 5742
32 JGI25161J50226_1004520 3300003374 Bacteria 2897
33 Ga0055535_1000348 3300003761 Bacteria 45946
34 Ga0055542_1000021 3300003762 Bacteria 331499
35 Ga0055526_1000400 3300003771 Bacteria 35032
36 Ga0055526_1000834 3300003771 Bacteria 23036
37 Ga0055526_1002782 3300003771 Bacteria 11584
38 Ga0055526_1005132 3300003771 Bacteria 7635
39 Ga0055537_1000538 3300003773 Bacteria 21974
40 Ga0055524_1000470 3300003775 Bacteria 32352
41 Ga0055524_1001852 3300003775 Bacteria 11584
42 Ga0055524_1002050 3300003775 Bacteria 10712
43 Ga0055524_1002393 3300003775 Bacteria 9723
44 Ga0055524_1013055 3300003775 Bacteria 3155
45 Ga0055536_1000740 3300003781 Bacteria 21867
46 Ga0055536_1003099 3300003781 Bacteria 9041
47 Ga0055536_1005332 3300003781 Bacteria 6316
48 Ga0055534_1005516 3300003784 Bacteria 3369
49 Ga0055534_1006100 3300003784 Bacteria 3095
50 Ga0055528_1000034 3300003790 Bacteria 118577
51 Ga0055528_1000273 3300003790 Bacteria 43784
52 Ga0055528_1000790 3300003790 Bacteria 21974
53 Ga0055528_1001168 3300003790 Bacteria 16988
54 Ga0055528_1004274 3300003790 Bacteria 6910
55 Ga0055530_10007026 3300003791 Bacteria 4846
56 Ga0055530_10013473 3300003791 Bacteria 2790
57 Ga0055540_1001205 3300003792 Bacteria 15914
58 Ga0055540_1002741 3300003792 Bacteria 9057
59 Ga0055531_10000815 3300003794 Bacteria 25853
60 Ga0055531_10036331 3300003794 Bacteria 1522
61 Ga0058692_1004276 3300003856 Bacteria 4253
62 Ga0055543_1000052 3300004625 Bacteria 104887
63 Ga0055543_1000123 3300004625 Bacteria 64977
64 Ga0055543_1001022 3300004625 Bacteria 12438
65 Ga0055543_1004437 3300004625 Bacteria 3832
66 Ga0065165_1000073 3300005262 Bacteria 164910
67 Ga0065165_1000174 3300005262 Bacteria 113769
68 Ga0065165_1000545 3300005262 Bacteria 56973
69 Ga0065165_1008598 3300005262 Bacteria 4743
70 Ga0070668_100043111 3300005347 Bacteria 3460
71 Ga0070659_100041562 3300005366 Bacteria 3595
72 Ga0070662_100023355 3300005457 Bacteria 4246
73 Ga0068853_100008938 3300005539 Bacteria 8066
74 Ga0070665_100261653 3300005548 Bacteria 1731
75 Ga0070664_100132737 3300005564 Bacteria 2188
76 Ga0068857_100284354 3300005577 Bacteria 1522
77 Ga0068854_100300572 3300005578 Bacteria 1298
78 Ga0068856_100058153 3300005614 Bacteria 3818
79 Ga0068852_100158459 3300005616 Bacteria 2111
80 Ga0075365_10000709 3300006038 Bacteria 13425
81 Ga0075368_10004779 3300006042 Bacteria 4614
82 Ga0075368_10057065 3300006042 Bacteria 1558
83 Ga0075363_100121218 3300006048 Bacteria 1461
84 Ga0075367_10001059 3300006178 Bacteria 11353
85 Ga0075369_10015733 3300006186 Bacteria 3041
86 Ga0075369_10128655 3300006186 Bacteria 1149
87 Ga0075366_10009687 3300006195 Bacteria 5384
88 Ga0075370_10000218 3300006353 Bacteria 20437
89 Ga0075370_10005596 3300006353 Bacteria 6265
90 Ga0075370_10014569 3300006353 Bacteria 4197
91 Ga0075370_10077712 3300006353 Bacteria 1905
92 Ga0099826_10000080 3300006948 Bacteria 48855
93 Ga0099826_10010722 3300006948 Bacteria 6875
94 Ga0105244_10004015 3300009036 Bacteria 10290
95 Ga0105240_10000216 3300009093 Bacteria 115800
96 Ga0105240_10261387 3300009093 Bacteria 1997
97 Ga0105243_10000385 3300009148 Bacteria 47177
98 Ga0105243_10000645 3300009148 Bacteria 34585
99 Ga0105241_10089999 3300009174 Bacteria 2419
100 Ga0105237_10000536 3300009545 Bacteria 53573
101 Ga0105238_10390887 3300009551 Bacteria 1383
102 Ga0123341_1000031 3300009765 Bacteria 64454
103 Ga0123341_1009876 3300009765 Bacteria 8726
104 Ga0123342_1026367 3300009766 Bacteria 3384
105 Ga0105239_10076989 3300010375 Bacteria 3670
106 Ga0105246_10002250 3300011119 Bacteria 11646
107 Ga0157347_1002166 3300012502 Bacteria 1650
108 Ga0157373_10014068 3300013100 Bacteria 5866
109 Ga0157371_10000002 3300013102 Bacteria 665040
110 Ga0157370_10000143 3300013104 Bacteria 87289
111 Ga0157370_10000183 3300013104 Bacteria 78649
112 Ga0157370_10011289 3300013104 Bacteria 9364
113 Ga0157370_10354823 3300013104 Bacteria 1351
114 Ga0171463_1002 3300013249 Bacteria 1274851
115 Ga0182008_10001837 3300014497 Bacteria 13822
116 Ga0182008_10004807 3300014497 Bacteria 7814
117 Ga0182008_10013241 3300014497 Bacteria 4336
118 Ga0182008_10137145 3300014497 Bacteria 1222
119 Ga0182006_1003343 3300015261 Bacteria 8260
120 Ga0182007_10000335 3300015262 Bacteria 29829
121 Ga0182007_10005641 3300015262 Bacteria 5463
122 Ga0182005_1006674 3300015265 Bacteria 3505
123 Ga0183365_10483 3300015684 Bacteria 1306
124 Ga0183363_1341 3300015690 Bacteria 5644
125 Ga0163161_10000117 3300017792 Bacteria 75699
126 Ga0163161_10011330 3300017792 Bacteria 6181
127 Ga0213872_10000097 3300021361 Bacteria 80834
128 Ga0209435_100006 3300025206 Bacteria 542459
129 Ga0209436_100140 3300025208 Bacteria 35032
130 Ga0209436_101914 3300025208 Bacteria 6706
131 Ga0209672_107446 3300025228 Bacteria 1686
132 Ga0209147_103930 3300025229 Bacteria 2658
133 Ga0209437_100042 3300025233 Bacteria 444095
134 Ga0209437_100062 3300025233 Bacteria 336900
135 Ga0209258_100058 3300025242 Bacteria 331567
136 Ga0207425_1000142 3300025245 Bacteria 63527
137 Ga0207425_1015426 3300025245 Bacteria 1715
138 Ga0209646_1000015 3300025246 Bacteria 542459
139 Ga0209026_1000046 3300025250 Bacteria 262031
140 Ga0209677_100216 3300025253 Bacteria 42627
141 Ga0209148_1000071 3300025254 Bacteria 331551
142 Ga0209759_1000005 3300025256 Bacteria 542459
143 Ga0209129_1000007 3300025258 Bacteria 771325
144 Ga0209129_1000182 3300025258 Bacteria 87739
145 Ga0209129_1000618 3300025258 Bacteria 23861
146 Ga0209129_1006107 3300025258 Bacteria 4019
147 Ga0209129_1013201 3300025258 Bacteria 1835
148 Ga0209233_1000082 3300025261 Bacteria 336320
149 Ga0209233_1000103 3300025261 Bacteria 284123
150 Ga0209233_1000428 3300025261 Bacteria 30724
151 Ga0209565_1000038 3300025263 Bacteria 286433
152 Ga0209673_1000020 3300025273 Bacteria 430653
153 Ga0209673_1000080 3300025273 Bacteria 223503
154 Ga0209673_1000607 3300025273 Bacteria 55095
155 Ga0209673_1000691 3300025273 Bacteria 48251
156 Ga0209130_1000075 3300025284 Bacteria 171698
157 Ga0209130_1000076 3300025284 Bacteria 170259
158 Ga0209130_1000121 3300025284 Bacteria 127462
159 Ga0209130_1000702 3300025284 Bacteria 29997
160 Ga0209675_1000256 3300025291 Bacteria 52565
161 Ga0209675_1008818 3300025291 Bacteria 3645
162 Ga0209676_1000139 3300025292 Bacteria 177886
163 Ga0209676_1000383 3300025292 Bacteria 81259
164 Ga0209676_1003221 3300025292 Bacteria 10310
165 Ga0209676_1003965 3300025292 Bacteria 8556
166 Ga0209025_1000056 3300025294 Bacteria 316188
167 Ga0209025_1000081 3300025294 Bacteria 265899
168 Ga0209025_1000104 3300025294 Bacteria 226895
169 Ga0209025_1000461 3300025294 Bacteria 79418
170 Ga0209025_1000478 3300025294 Bacteria 77516
171 Ga0209025_1003803 3300025294 Bacteria 13796
172 Ga0209025_1006981 3300025294 Bacteria 8577
173 Ga0209564_1000073 3300025295 Bacteria 288080
174 Ga0209564_1000205 3300025295 Bacteria 135901
175 Ga0209564_1000278 3300025295 Bacteria 105405
176 Ga0209564_1001643 3300025295 Bacteria 21576
177 Ga0209564_1018835 3300025295 Bacteria 2608
178 Ga0209564_1030840 3300025295 Bacteria 1653
179 Ga0209758_1000044 3300025297 Bacteria 398448
180 Ga0209758_1000076 3300025297 Bacteria 270615
181 Ga0209758_1011122 3300025297 Bacteria 5258
182 Ga0209758_1028095 3300025297 Bacteria 2388
183 Ga0209050_1000811 3300025298 Bacteria 43739
184 Ga0209050_1003053 3300025298 Bacteria 12906
185 Ga0209050_1028805 3300025298 Bacteria 1793
186 Ga0209256_1000020 3300025299 Bacteria 542402
187 Ga0209256_1000411 3300025299 Bacteria 67351
188 Ga0209256_1000524 3300025299 Bacteria 55735
189 Ga0209256_1000648 3300025299 Bacteria 47343
190 Ga0209256_1001460 3300025299 Bacteria 24301
191 Ga0209256_1002307 3300025299 Bacteria 15985
192 Ga0209256_1009419 3300025299 Bacteria 4287
193 Ga0207426_1000001 3300025302 Bacteria 1341301
194 Ga0207426_1000075 3300025302 Bacteria 321337
195 Ga0207426_1000163 3300025302 Bacteria 171698
196 Ga0207426_1000169 3300025302 Bacteria 164859
197 Ga0209051_1000257 3300025303 Bacteria 88842
198 Ga0209051_1000259 3300025303 Bacteria 88311
199 Ga0209051_1002814 3300025303 Bacteria 12001
200 Ga0209051_1015330 3300025303 Bacteria 3530
201 Ga0209051_1015562 3300025303 Bacteria 3491
202 Ga0209051_1016535 3300025303 Bacteria 3331
203 Ga0209257_1000116 3300025304 Bacteria 228733
204 Ga0209257_1000222 3300025304 Bacteria 134717
205 Ga0209257_1008629 3300025304 Bacteria 5720
206 Ga0209257_1008754 3300025304 Bacteria 5632
207 Ga0207655_1001237 3300025728 Bacteria 24472
208 Ga0207695_10000319 3300025913 Bacteria 116116
209 Ga0207695_10222602 3300025913 Bacteria 1794
210 Ga0207671_10000078 3300025914 Bacteria 150705
211 Ga0207681_10061607 3300025923 Bacteria 2580
212 Ga0207706_10089438 3300025933 Bacteria 2707
213 Ga0207709_10000292 3300025935 Bacteria 56565
214 Ga0207709_10000908 3300025935 Bacteria 22289
215 Ga0207709_10010496 3300025935 Bacteria 5099
216 Ga0207679_10126919 3300025945 Bacteria 2040
217 Ga0207668_10030029 3300025972 Bacteria 3569
218 Ga0207702_10039041 3300026078 Bacteria 3977
219 Ga0207674_10047029 3300026116 Bacteria 4426
220 Ga0207698_10019559 3300026142 Bacteria 4639
221 Ga0207698_10183092 3300026142 Bacteria 1858
222 Ga0209371_1000003 3300027312 Bacteria 1122971
223 Ga0209371_1000373 3300027312 Bacteria 48218
224 Ga0209371_1016200 3300027312 Bacteria 1975
225 Ga0209813_10012638 3300027866 Bacteria 2237
226 Ga0268266_10366498 3300028379 Bacteria 1356
227 Ga0268265_10065104 3300028380 Bacteria 2811
228 Ga0268256_1000004 3300030500 Bacteria 1122967
229 Ga0268256_1005781 3300030500 Bacteria 4761
230 Ga0268256_1017999 3300030500 Bacteria 1975
231 Ga0307512_10118118 3300030522 Bacteria 1716
232 Ga0316181_1210191 3300030744 Bacteria 3410
233 Ga0265327_10063261 3300031251 Bacteria 1879
234 Ga0307405_10007654 3300031731 Bacteria 5421
235 Ga0307412_10009952 3300031911 Bacteria 5470
236 Ga0307510_10000171 3300033180 Bacteria 54868
237 Ga0436361_0212275 3300039447 Bacteria 78927
238 Ga0439465_0051964 3300041413 Bacteria 1344
239 Ga0451806_490553 3300041462 Bacteria 1732
240 Ga0451845_0112994 3300041501 Bacteria 3125
241 Ga0451845_0374148 3300041501 Bacteria 1283
242 Ga0451849_0167718 3300041505 Bacteria 2361
243 Ga0451843_0095872 3300041509 Bacteria 2160
244 Ga0466970_0000711 3300044765 Bacteria 16299
245 Ga0466957_0050682 3300044842 Bacteria 2526
246 Ga0466959_0228926 3300045049 Bacteria 1287
247 Ga0466958_0148566 3300045836 Bacteria 1478
248 Ga0495617_042195 3300046452 Bacteria 1525
249 Ga0495638_0000524 3300046460 Bacteria 44781
250 Ga0495605_0004431 3300046474 Bacteria 8254
251 Ga0495585_0013223 3300046492 Bacteria 4835
252 Ga0495606_0079201 3300046507 Bacteria 2047
253 Ga0495610_0000609 3300046512 Bacteria 35431
254 Ga0495610_0006809 3300046512 Bacteria 7754
255 Ga0495610_0014900 3300046512 Bacteria 4545
256 Ga0495616_0000211 3300046513 Bacteria 48566
257 Ga0495616_0014728 3300046513 Bacteria 4368
258 Ga0495620_0006400 3300046515 Bacteria 6474
259 Ga0495631_0000311 3300046518 Bacteria 33638
260 Ga0495631_0002715 3300046518 Bacteria 9816
261 Ga0495632_0013724 3300046519 Bacteria 4611
262 Ga0495632_0014403 3300046519 Bacteria 4476
263 Ga0495637_0002590 3300046520 Bacteria 9933
264 Ga0495637_0049679 3300046520 Bacteria 1761
265 Ga0495643_0020176 3300046522 Bacteria 3848
266 Ga0495643_0024854 3300046522 Bacteria 3395
267 Ga0495643_0108644 3300046522 Bacteria 1413
268 Ga0495654_0005909 3300046530 Bacteria 7038
269 Ga0495609_0050926 3300046538 Bacteria 1845
270 Ga0495633_0093390 3300046558 Bacteria 1398
271 Ga0495611_0064445 3300046648 Bacteria 1669
272 Ga0495625_0005601 3300046660 Bacteria 11386
273 Ga0495625_0014508 3300046660 Bacteria 6280
274 Ga0495625_0030156 3300046660 Bacteria 4049
275 Ga0495625_0051290 3300046660 Bacteria 2958
276 Ga0495625_0120279 3300046660 Bacteria 1788
277 Ga0495588_0012368 3300046674 Bacteria 4033
278 Ga0495670_0090357 3300046691 Bacteria 1567
279 Ga0495670_0094926 3300046691 Bacteria 1530
280 Ga0495671_0002554 3300046692 Bacteria 11443
281 Ga0495671_0012624 3300046692 Bacteria 4608
282 Ga0495649_0011291 3300046694 Bacteria 5246
283 Ga0495649_0021010 3300046694 Bacteria 3660
284 Ga0495660_0047752 3300046810 Bacteria 2343
285 Ga0495672_0005527 3300047320 Bacteria 10004
286 Ga0495683_0009349 3300047323 Bacteria 5222
287 Ga0495687_003982 3300047443 Bacteria 10291
288 Ga0495681_0000990 3300047470 Bacteria 21739
289 Ga0495686_0023447 3300047472 Bacteria 4070
290 Ga0495686_0030746 3300047472 Bacteria 3486
291 Ga0495686_0094143 3300047472 Bacteria 1816
292 Ga0496100_0002935 3300048903 Bacteria 8766
293 Ga0496101_0052753 3300048904 Bacteria 2933
294 Ga0496102_0004495 3300048905 Bacteria 11774
295 Ga0496103_0005804 3300048906 Bacteria 7372
296 Ga0496104_0177504 3300048907 Bacteria 2040
297 Ga0496106_0000494 3300048909 Bacteria 27913
298 Ga0496112_0369113 3300048915 Bacteria 1377
299 Ga0496113_0078983 3300048916 Bacteria 2518
300 Ga0496113_0086832 3300048916 Bacteria 2404
301 Ga0496116_0023178 3300048919 Bacteria 4630
302 Ga0496116_0025116 3300048919 Bacteria 4388
303 Ga0496116_0156849 3300048919 Bacteria 1255
304 Ga0496117_0000016 3300048920 Bacteria 523642
305 Ga0496117_0001125 3300048920 Bacteria 40300
306 Ga0496117_0012189 3300048920 Bacteria 7607
307 Ga0496117_0014509 3300048920 Bacteria 6782
308 Ga0496117_0087756 3300048920 Bacteria 2015
309 Ga0496117_0159557 3300048920 Bacteria 1323
310 Ga0496118_0000153 3300048921 Bacteria 122419
311 Ga0496118_0000844 3300048921 Bacteria 48654
312 Ga0496118_0001526 3300048921 Bacteria 34471
313 Ga0496118_0009414 3300048921 Bacteria 9866
314 Ga0496118_0020755 3300048921 Bacteria 5816
315 Ga0496118_0029894 3300048921 Bacteria 4559
316 Ga0496118_0053851 3300048921 Bacteria 3053
317 Ga0496118_0089181 3300048921 Bacteria 2130
318 Ga0496119_0005626 3300048922 Bacteria 11914
319 Ga0496119_0008309 3300048922 Bacteria 9150
320 Ga0496119_0010000 3300048922 Bacteria 8033
321 Ga0496120_0000423 3300048923 Bacteria 67509
322 Ga0496121_0014507 3300048924 Bacteria 8354
323 Ga0496121_0015484 3300048924 Bacteria 7986
324 Ga0496121_0025037 3300048924 Bacteria 5681
325 Ga0496121_0034848 3300048924 Bacteria 4521
326 Ga0496121_0209183 3300048924 Bacteria 1383
327 Ga0496122_0000002 3300048925 Bacteria 905834
328 Ga0496122_0004823 3300048925 Bacteria 16442
329 Ga0496122_0010739 3300048925 Bacteria 9393
330 Ga0496122_0016190 3300048925 Bacteria 7081
331 Ga0496122_0017147 3300048925 Bacteria 6791
332 Ga0496122_0019188 3300048925 Bacteria 6262
333 Ga0496123_0000002 3300048926 Bacteria 1811682
334 Ga0496123_0004010 3300048926 Bacteria 15918
335 Ga0496123_0040552 3300048926 Bacteria 3240
336 Ga0496123_0101770 3300048926 Bacteria 1669
337 Ga0496124_0000094 3300048927 Bacteria 189147
338 Ga0496124_0012132 3300048927 Bacteria 8538
339 Ga0496124_0019012 3300048927 Bacteria 6412
340 Ga0496124_0029697 3300048927 Bacteria 4864
341 Ga0496124_0065890 3300048927 Bacteria 3018
342 Ga0496124_0071040 3300048927 Bacteria 2887
343 Ga0496124_0146533 3300048927 Bacteria 1857
344 Ga0496124_0160886 3300048927 Bacteria 1750
345 Ga0496125_0007773 3300048928 Bacteria 11344
346 Ga0496125_0008081 3300048928 Bacteria 11088
347 Ga0496125_0031955 3300048928 Bacteria 4682
348 Ga0496125_0037969 3300048928 Bacteria 4179
349 Ga0496125_0042810 3300048928 Bacteria 3851
350 Ga0496125_0069242 3300048928 Bacteria 2770
351 Ga0496125_0136285 3300048928 Bacteria 1716
352 Ga0496126_0045887 3300048929 Bacteria 4013
353 Ga0496126_0063807 3300048929 Bacteria 3301
354 Ga0495678_050005 3300049459 Bacteria 1622
355 Ga0495682_0068237 3300049460 Bacteria 1281
356 Ga0501033_0075350 3300049570 Bacteria 2476
357 Ga0501042_0000073 3300049578 Bacteria 37226
358 Ga0501083_0000028 3300049744 Bacteria 115481
359 nmdc:mga03683_41174_c1 3300050489 Bacteria 1897
360 nmdc:mga00v17_53_c1 3300050491 Bacteria 72424
361 nmdc:mga0yw44_3659_c1 3300050492 Bacteria 6872
362 nmdc:mga0yw44_943_c1 3300050492 Bacteria 11041
363 nmdc:mga0k408_32434_c2 3300050493 Bacteria 2606
364 nmdc:mga0k408_6618_c1 3300050493 Bacteria 6176
365 nmdc:mga06z11_162720_c1 3300050494 Bacteria 1276
366 nmdc:mga04h51_25802_c1 3300050495 Bacteria 1812
367 nmdc:mga07m45_2880_c1 3300050496 Bacteria 8153
368 nmdc:mga07m45_506_c1 3300050496 Bacteria 16504
369 nmdc:mga07m45_57117_c1 3300050496 Bacteria 2207
370 nmdc:mga0sz30_7069_c1 3300050516 Bacteria 4197
371 Ga0500610_0010501 3300053079 Bacteria 4168
372 Ga0500610_0091649 3300053079 Bacteria 1578
373 Ga0500578_0044322 3300053086 Bacteria 2855
374 Ga0500651_0000015 3300053093 Bacteria 161416
375 Ga0500651_0055977 3300053093 Bacteria 2470
376 Ga0500560_000090 3300053107 Bacteria 9077
377 Ga0500572_000986 3300053111 Bacteria 8624
378 Ga0500593_009847 3300053117 Bacteria 3986
379 Ga0500594_0000799 3300053118 Bacteria 6706
380 Ga0500594_0001286 3300053118 Bacteria 5452
381 Ga0500607_000393 3300053121 Bacteria 41936
382 Ga0500607_014088 3300053121 Bacteria 4649
383 Ga0500618_003647 3300053125 Bacteria 5209
384 Ga0500618_008662 3300053125 Bacteria 2823
385 Ga0500655_000179 3300053133 Bacteria 15339
386 Ga0500658_0000371 3300053134 Bacteria 19748
387 Ga0500658_0000395 3300053134 Bacteria 18986
388 Ga0500658_0001219 3300053134 Bacteria 10450
389 Ga0500658_0010513 3300053134 Bacteria 3413
390 Ga0500561_0000022 3300053137 Bacteria 35723
391 Ga0500568_0001291 3300053139 Bacteria 16442
392 Ga0500568_0001498 3300053139 Bacteria 14919
393 Ga0500568_0004887 3300053139 Bacteria 7061
394 Ga0500588_0023402 3300053146 Bacteria 1693
395 Ga0500616_0002543 3300053153 Bacteria 15044
396 Ga0500616_0009127 3300053153 Bacteria 6060
397 Ga0500622_0000343 3300053156 Bacteria 45668
398 Ga0500624_001002 3300053157 Bacteria 5690
399 Ga0500627_0000241 3300053158 Bacteria 15573
400 Ga0500627_0035563 3300053158 Bacteria 2117
401 Ga0500633_0023428 3300053160 Bacteria 1905
402 Ga0500634_0019993 3300053161 Bacteria 3615
403 Ga0500636_0000113 3300053177 Bacteria 41913
404 Ga0500636_0109816 3300053177 Bacteria 1560

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003214 JGI25165J46597_1006636 JGI25165J46597_10066362 273
2 3300025253 Ga0209677_100216 Ga0209677_10021612 273
3 3300025261 Ga0209233_1000428 Ga0209233_100042821 273
4 3300049570 Ga0501033_0075350 Ga0501033_0075350_860_1864 273
5 3300049744 Ga0501083_0000028 Ga0501083_0000028_86481_87482 285
6 3300049578 Ga0501042_0000073 Ga0501042_0000073_7770_8777 287
7 iso_pu_bacteria 2513020051 2513228632 287
8 iso_pu_bacteria 2643221672 2644400429 287
9 iso_pu_bacteria 2738541307 2738879504 287
10 iso_pu_bacteria 2928084124 2928084492 287
11 iso_pu_bacteria 2818991446 2819597361 289
12 iso_pu_bacteria 2821123053 2821129046 289
13 iso_pu_bacteria 2838736955 2838741369 289
14 iso_pu_bacteria 2841840854 2841845227 289
15 iso_pu_bacteria 2842140634 2842144930 289
16 iso_pu_bacteria 2899924645 2899924869 289
17 iso_pu_bacteria 2928037797 2928039007 289
18 iso_pu_bacteria 2928044640 2928045388 289
19 iso_pu_bacteria 2928051484 2928058285 289
20 iso_pu_bacteria 2928064002 2928064134 289
21 iso_pu_bacteria 2599185214 2599623891 290
22 iso_pu_bacteria 2599185226 2599671490 290
23 iso_pu_bacteria 2599185227 2599681497 290
24 iso_pu_bacteria 2599185229 2599693100 290
25 iso_pu_bacteria 2885198086 2885204623 290
26 iso_pu_bacteria 2885211737 2885218276 290
27 iso_pu_bacteria 2928070936 2928071551 290
28 3300003781 Ga0055536_1003099 Ga0055536_10030992 291
29 3300003791 Ga0055530_10007026 Ga0055530_100070264 291
30 3300003792 Ga0055540_1001205 Ga0055540_10012056 291
31 3300003794 Ga0055531_10000815 Ga0055531_100008152 291
32 3300005366 Ga0070659_100041562 Ga0070659_1000415622 291
33 3300005457 Ga0070662_100023355 Ga0070662_1000233554 291
34 3300005564 Ga0070664_100132737 Ga0070664_1001327372 291
35 3300005577 Ga0068857_100284354 Ga0068857_1002843542 291
36 3300005578 Ga0068854_100300572 Ga0068854_1003005721 291
37 3300006353 Ga0075370_10005596 Ga0075370_100055964 291
38 3300009036 Ga0105244_10004015 Ga0105244_100040157 291
39 3300009148 Ga0105243_10000385 Ga0105243_1000038530 291
40 3300009174 Ga0105241_10089999 Ga0105241_100899992 291
41 3300011119 Ga0105246_10002250 Ga0105246_1000225010 291
42 3300014497 Ga0182008_10001837 Ga0182008_100018378 291
43 3300015261 Ga0182006_1003343 Ga0182006_10033435 291
44 3300015262 Ga0182007_10000335 Ga0182007_1000033522 291
45 3300017792 Ga0163161_10011330 Ga0163161_100113304 291
46 3300025292 Ga0209676_1000383 Ga0209676_100038314 291
47 3300025298 Ga0209050_1000811 Ga0209050_100081132 291
48 3300025303 Ga0209051_1000259 Ga0209051_100025915 291
49 3300025304 Ga0209257_1000116 Ga0209257_1000116139 291
50 3300025728 Ga0207655_1001237 Ga0207655_100123717 291
51 3300025933 Ga0207706_10089438 Ga0207706_100894383 291
52 3300025935 Ga0207709_10000908 Ga0207709_1000090811 291
53 3300025945 Ga0207679_10126919 Ga0207679_101269192 291
54 3300026116 Ga0207674_10047029 Ga0207674_100470293 291
55 3300026142 Ga0207698_10183092 Ga0207698_101830922 291
56 3300031251 Ga0265327_10063261 Ga0265327_100632612 291
57 3300046512 Ga0495610_0006809 Ga0495610_0006809_2153_3160 291
58 3300046513 Ga0495616_0000211 Ga0495616_0000211_22418_23425 291
59 3300046518 Ga0495631_0000311 Ga0495631_0000311_32161_33168 291
60 3300046530 Ga0495654_0005909 Ga0495654_0005909_2532_3539 291
61 3300046660 Ga0495625_0014508 Ga0495625_0014508_170_1177 291
62 3300046674 Ga0495588_0012368 Ga0495588_0012368_403_1410 291
63 3300046691 Ga0495670_0094926 Ga0495670_0094926_255_1262 291
64 3300048919 Ga0496116_0025116 Ga0496116_0025116_3026_4033 291
65 3300048920 Ga0496117_0014509 Ga0496117_0014509_2794_3801 291
66 3300048921 Ga0496118_0009414 Ga0496118_0009414_2109_3116 291
67 3300048924 Ga0496121_0025037 Ga0496121_0025037_218_1225 291
68 3300048924 Ga0496121_0209183 Ga0496121_0209183_246_1253 291
69 3300048925 Ga0496122_0019188 Ga0496122_0019188_4778_5785 291
70 3300048927 Ga0496124_0146533 Ga0496124_0146533_488_1495 291
71 3300048928 Ga0496125_0037969 Ga0496125_0037969_2985_3992 291
72 3300053093 Ga0500651_0000015 Ga0500651_0000015_63662_64669 291
73 3300053118 Ga0500594_0000799 Ga0500594_0000799_220_1227 291
74 3300053121 Ga0500607_014088 Ga0500607_014088_591_1598 291
75 3300053133 Ga0500655_000179 Ga0500655_000179_8661_9668 291
76 3300053134 Ga0500658_0000395 Ga0500658_0000395_3952_4959 291
77 3300053134 Ga0500658_0010513 Ga0500658_0010513_503_1510 291
78 3300053139 Ga0500568_0001498 Ga0500568_0001498_8643_9650 291
79 iso_pu_bacteria 2537561587 2537877534 291
80 iso_pu_bacteria 2554235003 2554245439 291
81 iso_pu_bacteria 2558860242 2559296731 291
82 iso_pu_bacteria 2599185210 2599602777 291
83 iso_pu_bacteria 2600255279 2601610398 291
84 iso_pu_bacteria 2600255308 2601747272 291
85 iso_pu_bacteria 2643221582 2643917287 291
86 iso_pu_bacteria 2643221693 2644520859 291
87 iso_pu_bacteria 2751185800 2753358316 291
88 iso_pu_bacteria 2758568016 2758638914 291
89 iso_pu_bacteria 2808606387 2808987184 291
90 iso_pu_bacteria 2818991439 2819557478 291
91 iso_pu_bacteria 2838675328 2838678015 291
92 iso_pu_bacteria 2838714209 2838717079 291
93 iso_pu_bacteria 2838719591 2838722310 291
94 iso_pu_bacteria 2838724970 2838727828 291
95 iso_pu_bacteria 2841846520 2841849485 291
96 iso_pu_bacteria 2841859092 2841861472 291
97 iso_pu_bacteria 2842124991 2842127766 291
98 iso_pu_bacteria 2842130223 2842132908 291
99 iso_pu_bacteria 2842152218 2842154901 291
100 iso_pu_bacteria 2842170452 2842173400 291
101 iso_pu_bacteria 2842175837 2842178522 291
102 iso_pu_bacteria 2842187318 2842190187 291
103 iso_pu_bacteria 2842211629 2842214501 291
104 iso_pu_bacteria 2842224351 2842227220 291
105 iso_pu_bacteria 2842515876 2842518261 291
106 iso_pu_bacteria 2854911287 2854915669 291
107 iso_pu_bacteria 2899792073 2899796515 291
108 iso_pu_bacteria 2899845264 2899850039 291
109 iso_pu_bacteria 2919114240 2919117337 291
110 iso_pu_bacteria 2926754445 2926758784 291
111 iso_pu_bacteria 2926760298 2926763685 291
112 iso_pu_bacteria 2933006813 2933009716 291
113 iso_pu_bacteria 2933011516 2933013890 291
114 iso_pu_bacteria 2933594066 2933595703 291
115 iso_pu_bacteria 2979089926 2979091274 291
116 iso_pu_bacteria 2979095461 2979096798 291
117 iso_pu_bacteria 2979100975 2979102519 291
118 iso_pu_bacteria 2984509177 2984509596 291
119 iso_pu_bacteria 2984518228 2984519706 291
120 iso_pu_bacteria 2984537506 2984537933 291
121 iso_pu_bacteria 2984601300 2984604676 291
122 iso_pu_bacteria 8003570095 8003572733 291
123 3300003784 Ga0055534_1006100 Ga0055534_10061003 292
124 3300005539 Ga0068853_100008938 Ga0068853_1000089384 292
125 3300009093 Ga0105240_10261387 Ga0105240_102613872 292
126 3300009551 Ga0105238_10390887 Ga0105238_103908872 292
127 3300013104 Ga0157370_10354823 Ga0157370_103548231 292
128 3300025291 Ga0209675_1008818 Ga0209675_10088183 292
129 3300025913 Ga0207695_10222602 Ga0207695_102226021 292
130 3300048920 Ga0496117_0012189 Ga0496117_0012189_5829_6839 292
131 3300048921 Ga0496118_0020755 Ga0496118_0020755_3037_4047 292
132 3300048928 Ga0496125_0007773 Ga0496125_0007773_7245_8255 292
133 iso_pu_bacteria 2919713450 2919717358 292
134 3300003316 rootH1_10077486 rootH1_100774862 293
135 3300003761 Ga0055535_1000348 Ga0055535_10003489 293
136 3300003762 Ga0055542_1000021 Ga0055542_10000219 293
137 3300025229 Ga0209147_103930 Ga0209147_1039302 293
138 3300025242 Ga0209258_100058 Ga0209258_10005810 293
139 3300025254 Ga0209148_1000071 Ga0209148_100007110 293
140 3300025294 Ga0209025_1000478 Ga0209025_100047835 293
141 3300048927 Ga0496124_0000094 Ga0496124_0000094_64852_65934 293
142 iso_pu_bacteria 2585427593 2585836852 293
143 iso_pu_bacteria 2908669403 2908673389 293
144 3300021361 Ga0213872_10000097 Ga0213872_100000974 294
145 3300039447 Ga0436361_0212275 Ga0436361_0212275_6799_7815 294
146 iso_pu_bacteria 2513237159 2513998687 294
147 iso_pu_bacteria 2643221689 2644501443 294
148 iso_pu_bacteria 2842521101 2842523903 294
149 iso_pu_bacteria 650716007 650843153 294
150 3300003856 Ga0058692_1004276 Ga0058692_10042765 295
151 3300005548 Ga0070665_100261653 Ga0070665_1002616532 295
152 3300006042 Ga0075368_10057065 Ga0075368_100570652 295
153 3300006186 Ga0075369_10015733 Ga0075369_100157332 295
154 3300006948 Ga0099826_10000080 Ga0099826_100000802 295
155 3300006948 Ga0099826_10010722 Ga0099826_100107226 295
156 3300009765 Ga0123341_1009876 Ga0123341_10098769 295
157 3300013100 Ga0157373_10014068 Ga0157373_100140682 295
158 3300013102 Ga0157371_10000002 Ga0157371_10000002316 295
159 3300013104 Ga0157370_10000143 Ga0157370_1000014370 295
160 3300014497 Ga0182008_10004807 Ga0182008_100048074 295
161 3300014497 Ga0182008_10137145 Ga0182008_101371451 295
162 3300027312 Ga0209371_1000003 Ga0209371_1000003497 295
163 3300027312 Ga0209371_1000373 Ga0209371_100037332 295
164 3300028379 Ga0268266_10366498 Ga0268266_103664981 295
165 3300030500 Ga0268256_1000004 Ga0268256_1000004554 295
166 3300030500 Ga0268256_1005781 Ga0268256_10057814 295
167 3300030744 Ga0316181_1210191 Ga0316181_12101912 295
168 3300046692 Ga0495671_0012624 Ga0495671_0012624_2353_3393 295
169 3300047470 Ga0495681_0000990 Ga0495681_0000990_14029_15069 295
170 3300048907 Ga0496104_0177504 Ga0496104_0177504_601_1629 295
171 3300048915 Ga0496112_0369113 Ga0496112_0369113_18_1055 295
172 3300048916 Ga0496113_0086832 Ga0496113_0086832_1118_2155 295
173 3300048919 Ga0496116_0156849 Ga0496116_0156849_38_1075 295
174 3300048920 Ga0496117_0000016 Ga0496117_0000016_178927_179964 295
175 3300048921 Ga0496118_0000153 Ga0496118_0000153_80461_81498 295
176 3300048922 Ga0496119_0008309 Ga0496119_0008309_3474_4502 295
177 3300048922 Ga0496119_0010000 Ga0496119_0010000_6050_7078 295
178 3300048923 Ga0496120_0000423 Ga0496120_0000423_34195_35232 295
179 3300048925 Ga0496122_0000002 Ga0496122_0000002_179588_180625 295
180 3300048926 Ga0496123_0000002 Ga0496123_0000002_1631058_1632095 295
181 3300048926 Ga0496123_0000002 Ga0496123_0000002_179588_180625 295
182 3300048927 Ga0496124_0065890 Ga0496124_0065890_572_1609 295
183 3300048928 Ga0496125_0069242 Ga0496125_0069242_1284_2312 295
184 3300048928 Ga0496125_0136285 Ga0496125_0136285_100_1137 295
185 3300050491 nmdc:mga00v17_53_c1 nmdc:mga00v17_53_c1_9222_10259 295
186 3300050492 nmdc:mga0yw44_943_c1 nmdc:mga0yw44_943_c1_4253_5290 295
187 3300050493 nmdc:mga0k408_32434_c2 nmdc:mga0k408_32434_c2_971_2008 295
188 3300050496 nmdc:mga07m45_57117_c1 nmdc:mga07m45_57117_c1_843_1880 295
189 3300050516 nmdc:mga0sz30_7069_c1 nmdc:mga0sz30_7069_c1_1762_2799 295
190 3300053107 Ga0500560_000090 Ga0500560_000090_3288_4316 295
191 3300053111 Ga0500572_000986 Ga0500572_000986_4612_5640 295
192 3300053137 Ga0500561_0000022 Ga0500561_0000022_7925_8962 295
193 3300053157 Ga0500624_001002 Ga0500624_001002_660_1688 295
194 3300053161 Ga0500634_0019993 Ga0500634_0019993_595_1623 295
195 3300053177 Ga0500636_0000113 Ga0500636_0000113_16697_17725 295
196 3300002773 JGI25152J39213_1001255 JGI25152J39213_10012552 296
197 3300002774 JGI25150J39212_1001782 JGI25150J39212_10017822 296
198 3300002987 JGI25159J45721_1001088 JGI25159J45721_10010882 296
199 3300003187 JGI25151J46595_10002343 JGI25151J46595_100023432 296
200 3300003215 JGI25153J46596_10002155 JGI25153J46596_100021552 296
201 3300003354 JGI25160J50197_1001503 JGI25160J50197_10015032 296
202 3300003374 JGI25161J50226_1001923 JGI25161J50226_10019233 296
203 3300003771 Ga0055526_1002782 Ga0055526_10027822 296
204 3300003773 Ga0055537_1000538 Ga0055537_10005382 296
205 3300003775 Ga0055524_1001852 Ga0055524_10018522 296
206 3300003784 Ga0055534_1005516 Ga0055534_10055162 296
207 3300003790 Ga0055528_1000790 Ga0055528_10007902 296
208 3300004625 Ga0055543_1001022 Ga0055543_100102211 296
209 3300005262 Ga0065165_1008598 Ga0065165_10085982 296
210 3300025208 Ga0209436_101914 Ga0209436_1019145 296
211 3300025245 Ga0207425_1000142 Ga0207425_100014244 296
212 3300025258 Ga0209129_1000007 Ga0209129_1000007598 296
213 3300025263 Ga0209565_1000038 Ga0209565_1000038201 296
214 3300025273 Ga0209673_1000080 Ga0209673_100008060 296
215 3300025284 Ga0209130_1000076 Ga0209130_100007643 296
216 3300025291 Ga0209675_1000256 Ga0209675_100025644 296
217 3300025292 Ga0209676_1003965 Ga0209676_10039656 296
218 3300025294 Ga0209025_1000056 Ga0209025_100005684 296
219 3300025295 Ga0209564_1000073 Ga0209564_1000073120 296
220 3300025297 Ga0209758_1000044 Ga0209758_100004471 296
221 3300025299 Ga0209256_1000020 Ga0209256_100002074 296
222 3300025302 Ga0207426_1000001 Ga0207426_1000001709 296
223 3300025303 Ga0209051_1015330 Ga0209051_10153303 296
224 3300025304 Ga0209257_1000222 Ga0209257_100022210 296
225 3300045836 Ga0466958_0148566 Ga0466958_0148566_305_1327 296
226 iso_pu_bacteria 2510065019 2510137405 296
227 iso_pu_bacteria 2510461076 2510893798 296
228 iso_pu_bacteria 2513237084 2513572021 296
229 iso_pu_bacteria 2513237085 2513575799 296
230 iso_pu_bacteria 2513237093 2513633500 296
231 iso_pu_bacteria 2513237103 2513712348 296
232 iso_pu_bacteria 2513237162 2514024482 296
233 iso_pu_bacteria 2515154114 2515644157 296
234 iso_pu_bacteria 2515154116 2515657794 296
235 iso_pu_bacteria 2515154134 2515743813 296
236 iso_pu_bacteria 2516653085 2517081254 296
237 iso_pu_bacteria 2517093000 2517100357 296
238 iso_pu_bacteria 2529292951 2530648891 296
239 iso_pu_bacteria 2585427526 2585526346 296
240 iso_pu_bacteria 2585427528 2585538901 296
241 iso_pu_bacteria 2599185352 2600194539 296
242 iso_pu_bacteria 2643221723 2644672430 296
243 iso_pu_bacteria 2724679232 2725951848 296
244 iso_pu_bacteria 2738541333 2739034320 296
245 iso_pu_bacteria 2765235942 2766068072 296
246 iso_pu_bacteria 2791355263 2793340591 296
247 iso_pu_bacteria 2791355267 2793367483 296
248 iso_pu_bacteria 2802429633 2806043120 296
249 iso_pu_bacteria 2802429634 2806051072 296
250 iso_pu_bacteria 2802429635 2806057756 296
251 iso_pu_bacteria 2802429636 2806065526 296
252 iso_pu_bacteria 2802429637 2806075236 296
253 iso_pu_bacteria 2838680041 2838686394 296
254 iso_pu_bacteria 2838686498 2838688273 296
255 iso_pu_bacteria 2838694306 2838700813 296
256 iso_pu_bacteria 2838707686 2838714029 296
257 iso_pu_bacteria 2838729681 2838732452 296
258 iso_pu_bacteria 2838742623 2838745130 296
259 iso_pu_bacteria 2841851746 2841852013 296
260 iso_pu_bacteria 2842077413 2842083501 296
261 iso_pu_bacteria 2842110456 2842111741 296
262 iso_pu_bacteria 2842118031 2842124463 296
263 iso_pu_bacteria 2842156927 2842158911 296
264 iso_pu_bacteria 2842163707 2842166342 296
265 iso_pu_bacteria 2842180545 2842182525 296
266 iso_pu_bacteria 2842229732 2842232888 296
267 iso_pu_bacteria 2842237096 2842243442 296
268 iso_pu_bacteria 2842243621 2842247304 296
269 iso_pu_bacteria 2842257432 2842261605 296
270 iso_pu_bacteria 2842271015 2842272777 296
271 iso_pu_bacteria 2842291075 2842297682 296
272 iso_pu_bacteria 2842304105 2842307780 296
273 iso_pu_bacteria 2842370503 2842376954 296
274 iso_pu_bacteria 2842377471 2842384018 296
275 iso_pu_bacteria 2842384541 2842391235 296
276 iso_pu_bacteria 2844454524 2844461675 296
277 iso_pu_bacteria 2857516855 2857520759 296
278 iso_pu_bacteria 2933570622 2933574231 296
279 iso_pu_bacteria 2933586486 2933590947 296
280 iso_pu_bacteria 2935894831 2935901142 296
281 iso_pu_bacteria 2935901341 2935908292 296
282 iso_pu_bacteria 2936381700 2936382621 296
283 iso_pu_bacteria 639633055 639650825 296
284 iso_pu_bacteria 8005307578 8005311854 296
285 iso_pu_bacteria 8005556819 8005563206 296
286 iso_pu_bacteria 8005570704 8005575977 296
287 iso_pu_bacteria 8018163183 8018169839 296
288 iso_pu_bacteria 8023680758 8023685861 296
289 iso_pu_bacteria 8056375014 8056381703 296
290 iso_pu_bacteria 2582581867 2585405243 297
291 iso_pu_bacteria 2585427590 2585823449 297
292 iso_pu_bacteria 2842311132 2842313283 297
293 iso_pu_bacteria 2917699015 2917699199 297
294 iso_pu_bacteria 8005382845 8005389236 297
295 iso_pu_bacteria 8005395548 8005396668 297
296 3300048927 Ga0496124_0029697 Ga0496124_0029697_2604_3653 298
297 3300048927 Ga0496124_0160886 Ga0496124_0160886_663_1697 298
298 iso_pu_bacteria 2509276021 2509390792 298
299 iso_pu_bacteria 2509276033 2509442027 298
300 iso_pu_bacteria 2519899620 2520375426 298
301 iso_pu_bacteria 2615840624 2616294237 298
302 iso_pu_bacteria 2718217882 2719183983 298
303 iso_pu_bacteria 2718217927 2719389728 298
304 iso_pu_bacteria 2718217997 2719669283 298
305 iso_pu_bacteria 2718218009 2719729556 298
306 iso_pu_bacteria 2718218199 2720494299 298
307 iso_pu_bacteria 2718218232 2720610633 298
308 iso_pu_bacteria 2718218233 2720616521 298
309 iso_pu_bacteria 2718218235 2720627866 298
310 iso_pu_bacteria 2718218269 2720771449 298
311 iso_pu_bacteria 2718218363 2721143806 298
312 iso_pu_bacteria 2718218365 2721156481 298
313 iso_pu_bacteria 2718218366 2721161181 298
314 iso_pu_bacteria 2718218423 2721403371 298
315 iso_pu_bacteria 2721755514 2722837134 298
316 iso_pu_bacteria 2721755556 2723030710 298
317 iso_pu_bacteria 2721755684 2723563209 298
318 iso_pu_bacteria 2721755685 2723571203 298
319 iso_pu_bacteria 2721755809 2724034947 298
320 iso_pu_bacteria 2721755810 2724040710 298
321 iso_pu_bacteria 2721755819 2724086998 298
322 iso_pu_bacteria 2721755822 2724100709 298
323 iso_pu_bacteria 2721755823 2724107961 298
324 iso_pu_bacteria 2728369352 2730105176 298
325 iso_pu_bacteria 2728369365 2730162123 298
326 iso_pu_bacteria 2728369397 2730295242 298
327 iso_pu_bacteria 2791355256 2793295949 298
328 iso_pu_bacteria 2791355259 2793312638 298
329 iso_pu_bacteria 2791355260 2793321820 298
330 iso_pu_bacteria 2791355262 2793336336 298
331 iso_pu_bacteria 2791355264 2793348519 298
332 iso_pu_bacteria 2802429605 2805930870 298
333 iso_pu_bacteria 2838016132 2838019692 298
334 iso_pu_bacteria 2838022645 2838027100 298
335 iso_pu_bacteria 2838068647 2838072560 298
336 iso_pu_bacteria 2838668709 2838669137 298
337 iso_pu_bacteria 2838701080 2838701202 298
338 iso_pu_bacteria 2841864319 2841865894 298
339 iso_pu_bacteria 2842146304 2842146733 298
340 iso_pu_bacteria 2842198810 2842200574 298
341 iso_pu_bacteria 2842205361 2842208450 298
342 iso_pu_bacteria 2842250916 2842251037 298
343 iso_pu_bacteria 2842278818 2842282204 298
344 iso_pu_bacteria 2842285085 2842289234 298
345 iso_pu_bacteria 2842317721 2842323163 298
346 iso_pu_bacteria 2842341865 2842347746 298
347 iso_pu_bacteria 2842363717 2842364137 298
348 iso_pu_bacteria 2842402390 2842407440 298
349 iso_pu_bacteria 2842409023 2842413311 298
350 iso_pu_bacteria 2842415677 2842419954 298
351 iso_pu_bacteria 2842422224 2842426342 298
352 iso_pu_bacteria 2842428310 2842430138 298
353 iso_pu_bacteria 2842441272 2842442910 298
354 iso_pu_bacteria 2842447887 2842453566 298
355 iso_pu_bacteria 2842462802 2842464497 298
356 iso_pu_bacteria 2842469257 2842471135 298
357 iso_pu_bacteria 2842495871 2842498957 298
358 iso_pu_bacteria 2852387548 2852395234 298
359 iso_pu_bacteria 2933016740 2933017774 298
360 iso_pu_bacteria 2936367885 2936370654 298
361 iso_pu_bacteria 2996893221 2996894762 298
362 iso_pu_bacteria 8005258706 8005260528 298
363 iso_pu_bacteria 8005275841 8005275850 298
364 iso_pu_bacteria 8005282627 8005287384 298
365 iso_pu_bacteria 8005301065 8005307428 298
366 iso_pu_bacteria 8005430974 8005435781 298
367 iso_pu_bacteria 8005497431 8005503525 298
368 iso_pu_bacteria 8005563573 8005564755 298
369 iso_pu_bacteria 8005619151 8005625828 298
370 iso_pu_bacteria 8005626139 8005632083 298
371 iso_pu_bacteria 8005668836 8005675403 298
372 iso_pu_bacteria 8005688590 8005688717 298
373 iso_pu_bacteria 8018127388 8018134549 298
374 iso_pu_bacteria 8018176218 8018180733 298
375 iso_pu_bacteria 8024501048 8024506926 298
376 3300006353 Ga0075370_10000218 Ga0075370_100002184 299
377 iso_pu_bacteria 2510917030 2511199464 299
378 iso_pu_bacteria 2582581866 2585396338 299
379 iso_pu_bacteria 2643221692 2644511969 299
380 iso_pu_bacteria 2835312727 2835313160 299
381 iso_pu_bacteria 2838061910 2838067033 299
382 iso_pu_bacteria 2838661181 2838662427 299
383 iso_pu_bacteria 2919100787 2919102867 299
384 iso_pu_bacteria 2945909444 2945912074 299
385 iso_pu_bacteria 2945984333 2945985645 299
386 iso_pu_bacteria 8018150411 8018154570 299
387 3300002987 JGI25159J45721_1000012 JGI25159J45721_1000012101 300
388 3300003354 JGI25160J50197_1000042 JGI25160J50197_100004252 300
389 3300003374 JGI25161J50226_1000210 JGI25161J50226_100021023 300
390 3300003771 Ga0055526_1000834 Ga0055526_10008346 300
391 3300003775 Ga0055524_1000470 Ga0055524_100047024 300
392 3300003781 Ga0055536_1005332 Ga0055536_10053326 300
393 3300003791 Ga0055530_10013473 Ga0055530_100134732 300
394 3300003794 Ga0055531_10036331 Ga0055531_100363312 300
395 3300004625 Ga0055543_1000123 Ga0055543_100012352 300
396 3300005262 Ga0065165_1000174 Ga0065165_1000174101 300
397 3300006186 Ga0075369_10128655 Ga0075369_101286551 300
398 3300009765 Ga0123341_1000031 Ga0123341_10000314 300
399 3300009766 Ga0123342_1026367 Ga0123342_10263673 300
400 3300013249 Ga0171463_1002 Ga0171463_1002482 300
401 3300015684 Ga0183365_10483 Ga0183365_104831 300
402 3300015690 Ga0183363_1341 Ga0183363_13415 300
403 3300025208 Ga0209436_100140 Ga0209436_10014036 300
404 3300025284 Ga0209130_1000075 Ga0209130_100007555 300
405 3300025292 Ga0209676_1003221 Ga0209676_10032213 300
406 3300025295 Ga0209564_1000278 Ga0209564_100027847 300
407 3300025297 Ga0209758_1028095 Ga0209758_10280952 300
408 3300025298 Ga0209050_1003053 Ga0209050_10030537 300
409 3300025299 Ga0209256_1000411 Ga0209256_100041125 300
410 3300025299 Ga0209256_1000524 Ga0209256_100052442 300
411 3300025302 Ga0207426_1000163 Ga0207426_100016355 300
412 3300025303 Ga0209051_1015562 Ga0209051_10155621 300
413 3300025304 Ga0209257_1008629 Ga0209257_10086292 300
414 3300048921 Ga0496118_0053851 Ga0496118_0053851_64_1098 300
415 iso_pu_bacteria 2510917022 2511135671 300
416 iso_pu_bacteria 2582581306 2585269573 300
417 iso_pu_bacteria 2582581307 2585272746 300
418 iso_pu_bacteria 2582581308 2585281396 300
419 iso_pu_bacteria 2582581315 2585327713 300
420 iso_pu_bacteria 2582581316 2585332418 300
421 iso_pu_bacteria 2585427527 2585535618 300
422 iso_pu_bacteria 2585427530 2585556021 300
423 iso_pu_bacteria 2585427531 2585562414 300
424 iso_pu_bacteria 2585427608 2585896860 300
425 iso_pu_bacteria 2585427609 2585906419 300
426 iso_pu_bacteria 2585428125 2587981841 300
427 iso_pu_bacteria 2615840626 2616310508 300
428 iso_pu_bacteria 2615840698 2616552003 300
429 iso_pu_bacteria 2617270742 2617386604 300
430 iso_pu_bacteria 2667528174 2671114495 300
431 iso_pu_bacteria 2775507266 2778175205 300
432 iso_pu_bacteria 2818991448 2819607630 300
433 iso_pu_bacteria 2818991453 2819641631 300
434 iso_pu_bacteria 2838029111 2838032119 300
435 iso_pu_bacteria 2842475841 2842478851 300
436 iso_pu_bacteria 2842482326 2842486919 300
437 iso_pu_bacteria 2842502639 2842505830 300
438 iso_pu_bacteria 2894232714 2894237493 300
439 iso_pu_bacteria 2919408235 2919413218 300
440 iso_pu_bacteria 3005416602 3005422038 300
441 iso_pu_bacteria 8005314921 8005321319 300
442 iso_pu_bacteria 8005484373 8005489917 300
443 iso_pu_bacteria 8005645114 8005650801 300
444 iso_pu_bacteria 8005682033 8005684438 300
445 iso_pu_bacteria 8024486573 8024492874 300
446 iso_pu_bacteria 8057575449 8057576503 300
447 3300003187 JGI25151J46595_10000341 JGI25151J46595_1000034137 301
448 3300003354 JGI25160J50197_1001783 JGI25160J50197_10017837 301
449 3300003374 JGI25161J50226_1004520 JGI25161J50226_10045202 301
450 3300003771 Ga0055526_1000400 Ga0055526_100040035 301
451 3300003771 Ga0055526_1005132 Ga0055526_100513212 301
452 3300003775 Ga0055524_1002393 Ga0055524_10023936 301
453 3300003775 Ga0055524_1013055 Ga0055524_10130553 301
454 3300003790 Ga0055528_1000034 Ga0055528_100003450 301
455 3300003790 Ga0055528_1001168 Ga0055528_100116814 301
456 3300003790 Ga0055528_1004274 Ga0055528_10042745 301
457 3300004625 Ga0055543_1004437 Ga0055543_10044374 301
458 3300005347 Ga0070668_100043111 Ga0070668_1000431113 301
459 3300006038 Ga0075365_10000709 Ga0075365_100007093 301
460 3300006042 Ga0075368_10004779 Ga0075368_100047794 301
461 3300006178 Ga0075367_10001059 Ga0075367_100010595 301
462 3300006195 Ga0075366_10009687 Ga0075366_100096874 301
463 3300025245 Ga0207425_1015426 Ga0207425_10154261 301
464 3300025258 Ga0209129_1000618 Ga0209129_10006185 301
465 3300025258 Ga0209129_1013201 Ga0209129_10132012 301
466 3300025273 Ga0209673_1000020 Ga0209673_1000020148 301
467 3300025273 Ga0209673_1000607 Ga0209673_10006075 301
468 3300025294 Ga0209025_1000081 Ga0209025_1000081136 301
469 3300025295 Ga0209564_1000205 Ga0209564_100020549 301
470 3300025295 Ga0209564_1001643 Ga0209564_100164317 301
471 3300025295 Ga0209564_1030840 Ga0209564_10308402 301
472 3300025297 Ga0209758_1000076 Ga0209758_1000076118 301
473 3300025297 Ga0209758_1011122 Ga0209758_10111224 301
474 3300025299 Ga0209256_1001460 Ga0209256_10014608 301
475 3300025299 Ga0209256_1002307 Ga0209256_10023074 301
476 3300025299 Ga0209256_1009419 Ga0209256_10094194 301
477 3300025302 Ga0207426_1000169 Ga0207426_100016918 301
478 3300025303 Ga0209051_1002814 Ga0209051_10028149 301
479 3300025303 Ga0209051_1016535 Ga0209051_10165353 301
480 3300025972 Ga0207668_10030029 Ga0207668_100300293 301
481 3300027866 Ga0209813_10012638 Ga0209813_100126382 301
482 3300041501 Ga0451845_0112994 Ga0451845_0112994_1923_2960 301
483 3300041501 Ga0451845_0374148 Ga0451845_0374148_116_1153 301
484 3300041505 Ga0451849_0167718 Ga0451849_0167718_426_1463 301
485 3300041509 Ga0451843_0095872 Ga0451843_0095872_1029_2066 301
486 3300046512 Ga0495610_0014900 Ga0495610_0014900_999_2036 301
487 3300046513 Ga0495616_0014728 Ga0495616_0014728_1563_2600 301
488 3300046515 Ga0495620_0006400 Ga0495620_0006400_2692_3729 301
489 3300046519 Ga0495632_0013724 Ga0495632_0013724_1834_2871 301
490 3300046520 Ga0495637_0049679 Ga0495637_0049679_514_1551 301
491 3300046522 Ga0495643_0020176 Ga0495643_0020176_769_1806 301
492 3300046538 Ga0495609_0050926 Ga0495609_0050926_708_1745 301
493 3300046660 Ga0495625_0030156 Ga0495625_0030156_1728_2765 301
494 3300046660 Ga0495625_0051290 Ga0495625_0051290_85_1122 301
495 3300046694 Ga0495649_0011291 Ga0495649_0011291_894_1931 301
496 3300046810 Ga0495660_0047752 Ga0495660_0047752_201_1238 301
497 3300047323 Ga0495683_0009349 Ga0495683_0009349_3816_4853 301
498 3300047443 Ga0495687_003982 Ga0495687_003982_1505_2542 301
499 3300047472 Ga0495686_0023447 Ga0495686_0023447_992_2029 301
500 3300048909 Ga0496106_0000494 Ga0496106_0000494_9563_10594 301
501 3300048921 Ga0496118_0001526 Ga0496118_0001526_2569_3606 301
502 3300048925 Ga0496122_0016190 Ga0496122_0016190_3579_4592 301
503 3300048929 Ga0496126_0045887 Ga0496126_0045887_831_1892 301
504 3300050489 nmdc:mga03683_41174_c1 nmdc:mga03683_41174_c1_189_1226 301
505 3300050492 nmdc:mga0yw44_3659_c1 nmdc:mga0yw44_3659_c1_2064_3101 301
506 3300050493 nmdc:mga0k408_6618_c1 nmdc:mga0k408_6618_c1_2334_3371 301
507 3300050495 nmdc:mga04h51_25802_c1 nmdc:mga04h51_25802_c1_592_1629 301
508 3300050496 nmdc:mga07m45_506_c1 nmdc:mga07m45_506_c1_2343_3380 301
509 3300053086 Ga0500578_0044322 Ga0500578_0044322_168_1205 301
510 3300053093 Ga0500651_0055977 Ga0500651_0055977_1184_2215 301
511 3300053134 Ga0500658_0000371 Ga0500658_0000371_3791_4828 301
512 3300053134 Ga0500658_0001219 Ga0500658_0001219_7175_8206 301
513 3300053139 Ga0500568_0004887 Ga0500568_0004887_2377_3408 301
514 3300053153 Ga0500616_0009127 Ga0500616_0009127_1396_2433 301
515 3300053158 Ga0500627_0035563 Ga0500627_0035563_637_1674 301
516 3300053160 Ga0500633_0023428 Ga0500633_0023428_487_1518 301
517 iso_pu_bacteria 2582581298 2585222301 301
518 iso_pu_bacteria 2585427529 2585544746 301
519 iso_pu_bacteria 2643221637 2644210125 301
520 iso_pu_bacteria 2643221718 2644653677 301
521 iso_pu_bacteria 2643221736 2644744015 301
522 iso_pu_bacteria 2802429606 2805932902 301
523 iso_pu_bacteria 2841760612 2841764306 301
524 iso_pu_bacteria 2844104063 2844108239 301
525 iso_pu_bacteria 2851182111 2851185583 301
526 iso_pu_bacteria 2851246043 2851250741 301
527 iso_pu_bacteria 8057529695 8057533631 301
528 3300003781 Ga0055536_1000740 Ga0055536_100074011 302
529 3300003792 Ga0055540_1002741 Ga0055540_10027413 302
530 3300009148 Ga0105243_10000645 Ga0105243_1000064510 302
531 3300025292 Ga0209676_1000139 Ga0209676_100013994 302
532 3300025294 Ga0209025_1006981 Ga0209025_10069812 302
533 3300025298 Ga0209050_1028805 Ga0209050_10288052 302
534 3300025303 Ga0209051_1000257 Ga0209051_100025736 302
535 3300025304 Ga0209257_1008754 Ga0209257_10087543 302
536 3300025935 Ga0207709_10000292 Ga0207709_1000029246 302
537 3300046512 Ga0495610_0000609 Ga0495610_0000609_16875_17915 302
538 3300046522 Ga0495643_0024854 Ga0495643_0024854_334_1374 302
539 3300047472 Ga0495686_0030746 Ga0495686_0030746_237_1277 302
540 iso_pu_bacteria 2547132424 2548696982 302
541 iso_pu_bacteria 2909042592 2909048119 302
542 iso_pu_bacteria 8005695170 8005695256 302
543 3300003187 JGI25151J46595_10000540 JGI25151J46595_100005405 303
544 3300006048 Ga0075363_100121218 Ga0075363_1001212181 303
545 3300006353 Ga0075370_10014569 Ga0075370_100145694 303
546 3300012502 Ga0157347_1002166 Ga0157347_10021661 303
547 3300013104 Ga0157370_10011289 Ga0157370_100112894 303
548 3300014497 Ga0182008_10013241 Ga0182008_100132412 303
549 3300017792 Ga0163161_10000117 Ga0163161_1000011731 303
550 3300025258 Ga0209129_1006107 Ga0209129_10061073 303
551 3300025294 Ga0209025_1000104 Ga0209025_1000104107 303
552 3300025923 Ga0207681_10061607 Ga0207681_100616071 303
553 3300025935 Ga0207709_10010496 Ga0207709_100104963 303
554 3300028380 Ga0268265_10065104 Ga0268265_100651042 303
555 3300030522 Ga0307512_10118118 Ga0307512_101181181 303
556 3300031731 Ga0307405_10007654 Ga0307405_100076543 303
557 3300031911 Ga0307412_10009952 Ga0307412_100099524 303
558 3300033180 Ga0307510_10000171 Ga0307510_1000017125 303
559 3300041413 Ga0439465_0051964 Ga0439465_0051964_17_1054 303
560 3300046452 Ga0495617_042195 Ga0495617_042195_399_1436 303
561 3300046460 Ga0495638_0000524 Ga0495638_0000524_9580_10617 303
562 3300046474 Ga0495605_0004431 Ga0495605_0004431_5651_6688 303
563 3300046492 Ga0495585_0013223 Ga0495585_0013223_1712_2749 303
564 3300046518 Ga0495631_0002715 Ga0495631_0002715_1774_2811 303
565 3300046519 Ga0495632_0014403 Ga0495632_0014403_782_1819 303
566 3300046520 Ga0495637_0002590 Ga0495637_0002590_6629_7675 303
567 3300046522 Ga0495643_0108644 Ga0495643_0108644_192_1229 303
568 3300046648 Ga0495611_0064445 Ga0495611_0064445_370_1407 303
569 3300046660 Ga0495625_0005601 Ga0495625_0005601_2398_3435 303
570 3300046692 Ga0495671_0002554 Ga0495671_0002554_7607_8653 303
571 3300046694 Ga0495649_0021010 Ga0495649_0021010_2454_3491 303
572 3300047320 Ga0495672_0005527 Ga0495672_0005527_6823_7860 303
573 3300048919 Ga0496116_0023178 Ga0496116_0023178_2760_3797 303
574 3300048920 Ga0496117_0159557 Ga0496117_0159557_211_1248 303
575 3300048921 Ga0496118_0089181 Ga0496118_0089181_328_1365 303
576 3300048924 Ga0496121_0034848 Ga0496121_0034848_3383_4420 303
577 3300048926 Ga0496123_0101770 Ga0496123_0101770_364_1401 303
578 3300048927 Ga0496124_0019012 Ga0496124_0019012_4921_5958 303
579 3300048928 Ga0496125_0042810 Ga0496125_0042810_2469_3506 303
580 3300049459 Ga0495678_050005 Ga0495678_050005_410_1447 303
581 3300049460 Ga0495682_0068237 Ga0495682_0068237_78_1115 303
582 3300050494 nmdc:mga06z11_162720_c1 nmdc:mga06z11_162720_c1_154_1200 303
583 3300050496 nmdc:mga07m45_2880_c1 nmdc:mga07m45_2880_c1_2446_3492 303
584 3300053079 Ga0500610_0010501 Ga0500610_0010501_813_1850 303
585 3300053079 Ga0500610_0091649 Ga0500610_0091649_225_1271 303
586 3300053117 Ga0500593_009847 Ga0500593_009847_2303_3349 303
587 3300053118 Ga0500594_0001286 Ga0500594_0001286_1293_2330 303
588 3300053121 Ga0500607_000393 Ga0500607_000393_5023_6069 303
589 3300053125 Ga0500618_008662 Ga0500618_008662_1008_2075 303
590 3300053139 Ga0500568_0001291 Ga0500568_0001291_11716_12753 303
591 3300053146 Ga0500588_0023402 Ga0500588_0023402_296_1333 303
592 3300053153 Ga0500616_0002543 Ga0500616_0002543_8777_9814 303
593 3300053156 Ga0500622_0000343 Ga0500622_0000343_30633_31670 303
594 3300053158 Ga0500627_0000241 Ga0500627_0000241_1872_2918 303
595 3300002704 JGI25155J39150_1000015 JGI25155J39150_1000015120 304
596 3300002705 JGI25156J39149_1000007 JGI25156J39149_1000007120 304
597 3300002737 JGI25162J39368_1000285 JGI25162J39368_100028530 304
598 3300002738 JGI25154J39366_1000051 JGI25154J39366_100005152 304
599 3300002741 JGI25157J39369_1000012 JGI25157J39369_100001280 304
600 3300002987 JGI25159J45721_1000354 JGI25159J45721_10003547 304
601 3300003214 JGI25165J46597_1000102 JGI25165J46597_100010277 304
602 3300003214 JGI25165J46597_1000198 JGI25165J46597_100019850 304
603 3300003316 rootH1_10072180 rootH1_100721802 304
604 3300003322 rootL2_10016804 rootL2_1001680423 304
605 3300003323 rootH1_10035402 rootH1_100354023 304
606 3300003323 rootH1_10097577 rootH1_100975773 304
607 3300003354 JGI25160J50197_1000026 JGI25160J50197_1000026104 304
608 3300003374 JGI25161J50226_1000014 JGI25161J50226_100001486 304
609 3300004625 Ga0055543_1000052 Ga0055543_100005231 304
610 3300005262 Ga0065165_1000073 Ga0065165_100007363 304
611 3300005614 Ga0068856_100058153 Ga0068856_1000581532 304
612 3300005616 Ga0068852_100158459 Ga0068852_1001584591 304
613 3300009093 Ga0105240_10000216 Ga0105240_1000021624 304
614 3300009545 Ga0105237_10000536 Ga0105237_1000053630 304
615 3300010375 Ga0105239_10076989 Ga0105239_100769892 304
616 3300013104 Ga0157370_10000183 Ga0157370_1000018318 304
617 3300015262 Ga0182007_10005641 Ga0182007_100056414 304
618 3300015265 Ga0182005_1006674 Ga0182005_10066742 304
619 3300025206 Ga0209435_100006 Ga0209435_100006404 304
620 3300025228 Ga0209672_107446 Ga0209672_1074462 304
621 3300025233 Ga0209437_100042 Ga0209437_100042206 304
622 3300025233 Ga0209437_100062 Ga0209437_100062182 304
623 3300025246 Ga0209646_1000015 Ga0209646_1000015130 304
624 3300025250 Ga0209026_1000046 Ga0209026_1000046130 304
625 3300025256 Ga0209759_1000005 Ga0209759_1000005404 304
626 3300025261 Ga0209233_1000082 Ga0209233_1000082182 304
627 3300025261 Ga0209233_1000103 Ga0209233_1000103206 304
628 3300025284 Ga0209130_1000121 Ga0209130_1000121103 304
629 3300025302 Ga0207426_1000075 Ga0207426_1000075103 304
630 3300025913 Ga0207695_10000319 Ga0207695_1000031979 304
631 3300025914 Ga0207671_10000078 Ga0207671_1000007879 304
632 3300026078 Ga0207702_10039041 Ga0207702_100390412 304
633 3300026142 Ga0207698_10019559 Ga0207698_100195593 304
634 3300027312 Ga0209371_1016200 Ga0209371_10162002 304
635 3300030500 Ga0268256_1017999 Ga0268256_10179993 304
636 3300044765 Ga0466970_0000711 Ga0466970_0000711_8645_9685 304
637 3300044842 Ga0466957_0050682 Ga0466957_0050682_409_1449 304
638 3300045049 Ga0466959_0228926 Ga0466959_0228926_40_1080 304
639 3300046558 Ga0495633_0093390 Ga0495633_0093390_52_1143 304
640 3300046660 Ga0495625_0120279 Ga0495625_0120279_207_1295 304
641 3300046691 Ga0495670_0090357 Ga0495670_0090357_457_1548 304
642 3300048903 Ga0496100_0002935 Ga0496100_0002935_7450_8490 304
643 3300048904 Ga0496101_0052753 Ga0496101_0052753_188_1228 304
644 3300048905 Ga0496102_0004495 Ga0496102_0004495_4909_5949 304
645 3300048906 Ga0496103_0005804 Ga0496103_0005804_4225_5265 304
646 3300048916 Ga0496113_0078983 Ga0496113_0078983_950_1990 304
647 3300048920 Ga0496117_0001125 Ga0496117_0001125_17634_18674 304
648 3300048921 Ga0496118_0000844 Ga0496118_0000844_27612_28652 304
649 3300048921 Ga0496118_0029894 Ga0496118_0029894_3181_4221 304
650 3300048922 Ga0496119_0005626 Ga0496119_0005626_9090_10130 304
651 3300048924 Ga0496121_0015484 Ga0496121_0015484_4583_5623 304
652 3300048925 Ga0496122_0010739 Ga0496122_0010739_6420_7460 304
653 3300048925 Ga0496122_0017147 Ga0496122_0017147_4419_5459 304
654 3300048926 Ga0496123_0040552 Ga0496123_0040552_47_1087 304
655 3300048927 Ga0496124_0071040 Ga0496124_0071040_569_1609 304
656 3300048928 Ga0496125_0008081 Ga0496125_0008081_3734_4774 304
657 3300048928 Ga0496125_0031955 Ga0496125_0031955_3313_4353 304
658 3300053125 Ga0500618_003647 Ga0500618_003647_4029_5069 304
659 3300053177 Ga0500636_0109816 Ga0500636_0109816_313_1353 304
660 iso_pu_bacteria 2643221618 2644104377 304
661 iso_pu_bacteria 2643221626 2644147527 304
662 iso_pu_bacteria 2643221655 2644313370 304
663 iso_pu_bacteria 2643221659 2644331625 304
664 iso_pu_bacteria 2643221698 2644541788 304
665 iso_pu_bacteria 2643221712 2644612995 304
666 iso_pu_bacteria 2751185821 2753459216 304
667 3300002987 JGI25159J45721_1008601 JGI25159J45721_10086013 305
668 3300005262 Ga0065165_1000545 Ga0065165_100054529 305
669 3300025284 Ga0209130_1000702 Ga0209130_100070223 305
670 3300025294 Ga0209025_1003803 Ga0209025_10038037 305
671 3300003775 Ga0055524_1002050 Ga0055524_10020508 306
672 3300003790 Ga0055528_1000273 Ga0055528_100027338 306
673 3300006353 Ga0075370_10077712 Ga0075370_100777122 306
674 3300025258 Ga0209129_1000182 Ga0209129_100018225 306
675 3300025273 Ga0209673_1000691 Ga0209673_10006918 306
676 3300025294 Ga0209025_1000461 Ga0209025_100046125 306
677 3300025295 Ga0209564_1018835 Ga0209564_10188352 306
678 3300025299 Ga0209256_1000648 Ga0209256_100064810 306
679 3300041462 Ga0451806_490553 Ga0451806_490553_365_1417 306
680 3300048924 Ga0496121_0014507 Ga0496121_0014507_2442_3515 306
681 3300048925 Ga0496122_0004823 Ga0496122_0004823_13967_15040 306
682 3300048926 Ga0496123_0004010 Ga0496123_0004010_1492_2565 306
683 3300048927 Ga0496124_0012132 Ga0496124_0012132_6530_7603 306
684 3300048929 Ga0496126_0063807 Ga0496126_0063807_1834_2907 306
685 3300047472 Ga0495686_0094143 Ga0495686_0094143_412_1467 307
686 3300046507 Ga0495606_0079201 Ga0495606_0079201_389_1483 309
687 3300048920 Ga0496117_0087756 Ga0496117_0087756_39_1154 309
688 3300001979 JGI24740J21852_10004429 JGI24740J21852_100044293 325

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

5

292

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ket-assembly1.cif.gz_B flavin-utilizing monooxygenase (ox) domain of hybrid polyketide/non-ribosomal peptide synthetase 0.8024 10 229
4us5-assembly2.cif.gz_C crystal structure of apo-msno8 0.7842 10 238
1luc-assembly1.cif.gz_A bacterial luciferase 0.7789 10 230
4us5-assembly2.cif.gz_D crystal structure of apo-msno8 0.7788 10 238
3fgc-assembly2.cif.gz_C crystal structure of the bacterial luciferase:flavin complex reveals the basis of intersubunit communication 0.7756 10 238
ID Description Score Start End Superfamily
af_Q2G151_1_332_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8359 10 238 3.20.20.30
af_Q2FXV3_1_329_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.7857 10 238 3.20.20.30
af_P0ADV5_3_330_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.782 10 238 3.20.20.30
3fgcC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.7756 10 238 3.20.20.30
4us5A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.7664 10 238 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A420ZVA5-F1-model_v4 deleted 0.9767 6 239
AF-G8SIV2-F1-model_v4 Alkanal monooxygenase beta chain (EC 1.14.14.3) 0.9602 74 239 GO:0047646
AF-A0A7H8XIK0-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.949 10 239 GO:0005829
GO:0016705
AF-A0A259S580-F1-model_v4 Luciferase-like domain-containing protein 0.9421 29 238 GO:0005829
GO:0016705
AF-A0A3S3JAU4-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9229 116 239 GO:0016705

Feature Viewer

pLDDT pTM Quality
75.9 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map