F475108

General Info

Members Datasets Scaffolds Average Seq Length
685 268 1370 195

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100334466|Ga0070708_1003344662
Length 228
Sequence LPVRPSAKRGRRPEGFARRNRVDECVRRYVVRDGGVKLIVGLGNPGIEYQFTPHNLGFLAIDRIAGDLGIEVRNRQCRALTARAEIENVPVLLAKPETYMNLSGLSVGELVRKHDLKPESDLIVIQDELDFPLGTLRIHTRRSSAGHNGIESIIGALGRKDFLRIRIGVAPERKVEDGERYLLSPLRKAQLKVVDGMLDTAEEAVKMILKEGPAAAMNRFNRKEESSQ

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
109 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
110 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
111 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
113 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
177 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
178 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
179 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
180 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
181 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
182 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
183 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
184 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
185 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
186 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
187 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
188 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
189 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
191 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
193 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
194 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
195 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
196 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
197 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
198 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
199 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
200 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
201 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
202 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
204 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
206 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
207 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
208 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
209 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
212 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
213 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
214 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
215 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
216 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
217 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
218 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
219 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
220 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
221 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
222 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
223 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
224 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
225 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
226 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
227 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
228 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
229 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
230 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
231 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
232 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
233 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
234 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
235 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
236 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
237 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
238 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
239 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
240 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
241 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
242 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
243 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
244 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
245 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
246 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
247 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
248 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.66
Metatranscriptomes 2.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.4
Rhizosphere 93.87
Stem 0
Stem Tuber 0
Unclassified 20

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100334466 3300005445 Unclassified 1427
2 LJNas_1000260 3300000546 Bacteria 9129
3 JGI24752J21851_1003237 3300001976 Bacteria 2148
4 JGI24737J22298_10112947 3300001990 Bacteria 803
5 JGI24749J21850_1009599 3300002076 Unclassified 1352
6 JGI24751J29686_10000764 3300002459 Bacteria 7574
7 Ga0065712_10304804 3300005290 Bacteria 833
8 Ga0065715_10134981 3300005293 Bacteria 1945
9 Ga0065715_10158482 3300005293 Bacteria 1652
10 Ga0070658_10754492 3300005327 Unclassified 845
11 Ga0070676_10046894 3300005328 Bacteria 2521
12 Ga0070683_100005649 3300005329 Bacteria 10448
13 Ga0070683_100407720 3300005329 Bacteria 1296
14 Ga0070690_100061327 3300005330 Unclassified 2422
15 Ga0070690_100272973 3300005330 Bacteria 1203
16 Ga0070670_100194552 3300005331 Bacteria 1762
17 Ga0070670_100338078 3300005331 Bacteria 1321
18 Ga0070670_100380499 3300005331 Bacteria 1243
19 Ga0070677_10239818 3300005333 Unclassified 895
20 Ga0068869_100074119 3300005334 Bacteria 2526
21 Ga0068869_100624253 3300005334 Bacteria 912
22 Ga0068869_100689783 3300005334 Bacteria 870
23 Ga0070680_100506119 3300005336 Unclassified 1033
24 Ga0068868_100004556 3300005338 Bacteria 9730
25 Ga0068868_100096044 3300005338 Bacteria 2393
26 Ga0068868_100355108 3300005338 Bacteria 1256
27 Ga0068868_100743530 3300005338 Unclassified 881
28 Ga0070660_100067840 3300005339 Bacteria 2779
29 Ga0070660_100151726 3300005339 Bacteria 1863
30 Ga0070689_100010090 3300005340 Bacteria 6724
31 Ga0070689_100063235 3300005340 Bacteria 2880
32 Ga0070687_100317222 3300005343 Bacteria 994
33 Ga0070661_100012749 3300005344 Bacteria 5884
34 Ga0070661_100057378 3300005344 Bacteria 2853
35 Ga0070692_10472005 3300005345 Unclassified 807
36 Ga0070668_100005025 3300005347 Bacteria 9796
37 Ga0070668_100418056 3300005347 Unclassified 1147
38 Ga0070669_100511106 3300005353 Unclassified 997
39 Ga0070669_100651046 3300005353 Bacteria 886
40 Ga0070675_100059776 3300005354 Bacteria 3145
41 Ga0070675_100130904 3300005354 Bacteria 2138
42 Ga0070675_100584183 3300005354 Bacteria 1012
43 Ga0070675_100666770 3300005354 Bacteria 946
44 Ga0070674_100220028 3300005356 Bacteria 1477
45 Ga0070688_100187917 3300005365 Bacteria 1437
46 Ga0070659_100004220 3300005366 Bacteria 10260
47 Ga0070667_100011429 3300005367 Bacteria 7341
48 Ga0070667_100073367 3300005367 Bacteria 2918
49 Ga0070667_100730903 3300005367 Unclassified 917
50 Ga0070709_10007118 3300005434 Bacteria 6122
51 Ga0070709_10010494 3300005434 Bacteria 5133
52 Ga0070709_10010869 3300005434 Bacteria 5054
53 Ga0070709_10046772 3300005434 Bacteria 2692
54 Ga0070709_10049158 3300005434 Unclassified 2635
55 Ga0070709_10100077 3300005434 Unclassified 1930
56 Ga0070709_10455055 3300005434 Bacteria 965
57 Ga0070714_100000046 3300005435 Bacteria 113150
58 Ga0070714_100002862 3300005435 Bacteria 12763
59 Ga0070714_100010217 3300005435 Bacteria 7410
60 Ga0070714_100059470 3300005435 Unclassified 3277
61 Ga0070714_100746881 3300005435 Bacteria 946
62 Ga0070713_100000057 3300005436 Bacteria 70266
63 Ga0070713_100000583 3300005436 Bacteria 23153
64 Ga0070713_100003196 3300005436 Bacteria 10785
65 Ga0070713_100024512 3300005436 Bacteria 4700
66 Ga0070713_100025850 3300005436 Bacteria 4598
67 Ga0070713_100047430 3300005436 Bacteria 3531
68 Ga0070713_100152369 3300005436 Bacteria 2058
69 Ga0070713_100155028 3300005436 Bacteria 2041
70 Ga0070713_100332154 3300005436 Bacteria 1406
71 Ga0070713_100415804 3300005436 Unclassified 1258
72 Ga0070713_100715086 3300005436 Bacteria 957
73 Ga0070713_101351123 3300005436 Unclassified 691
74 Ga0070713_101401111 3300005436 Unclassified 678
75 Ga0070710_10004463 3300005437 Bacteria 6623
76 Ga0070710_10033046 3300005437 Unclassified 2807
77 Ga0070710_10209085 3300005437 Bacteria 1236
78 Ga0070711_100007062 3300005439 Bacteria 6813
79 Ga0070711_100021372 3300005439 Bacteria 4184
80 Ga0070711_100203206 3300005439 Bacteria 1530
81 Ga0070711_100273015 3300005439 Unclassified 1335
82 Ga0070711_100449068 3300005439 Bacteria 1055
83 Ga0070705_100125960 3300005440 Bacteria 1663
84 Ga0070705_100287051 3300005440 Unclassified 1173
85 Ga0070694_100091865 3300005444 Bacteria 2132
86 Ga0070708_100000437 3300005445 Bacteria 31114
87 Ga0070708_100015048 3300005445 Bacteria 6382
88 Ga0070708_100018463 3300005445 Bacteria 5837
89 Ga0070708_100033060 3300005445 Bacteria 4492
90 Ga0070708_100055671 3300005445 Bacteria 3517
91 Ga0070708_100062121 3300005445 Bacteria 3339
92 Ga0070708_100070749 3300005445 Bacteria 3139
93 Ga0070708_100162121 3300005445 Bacteria 2084
94 Ga0070708_100174578 3300005445 Unclassified 2007
95 Ga0070708_100333521 3300005445 Bacteria 1429
96 Ga0070663_100021022 3300005455 Bacteria 4332
97 Ga0070663_100257779 3300005455 Unclassified 1382
98 Ga0070678_100074534 3300005456 Bacteria 2551
99 Ga0070662_100128251 3300005457 Bacteria 1952
100 Ga0070662_100130123 3300005457 Bacteria 1939
101 Ga0070681_10006550 3300005458 Bacteria 11336
102 Ga0070681_10369159 3300005458 Bacteria 1345
103 Ga0068867_100053866 3300005459 Unclassified 2971
104 Ga0070706_100000935 3300005467 Bacteria 31937
105 Ga0070706_100003883 3300005467 Bacteria 14597
106 Ga0070706_100006968 3300005467 Bacteria 10660
107 Ga0070706_100064219 3300005467 Unclassified 3393
108 Ga0070706_100261281 3300005467 Bacteria 1616
109 Ga0070706_100577490 3300005467 Bacteria 1045
110 Ga0070706_100701326 3300005467 Unclassified 939
111 Ga0070706_101016775 3300005467 Unclassified 764
112 Ga0070707_100001244 3300005468 Bacteria 25018
113 Ga0070707_100002157 3300005468 Bacteria 18841
114 Ga0070707_100003649 3300005468 Bacteria 14508
115 Ga0070707_100030458 3300005468 Bacteria 5137
116 Ga0070707_100220881 3300005468 Bacteria 1845
117 Ga0070707_100395934 3300005468 Bacteria 1341
118 Ga0070698_100001005 3300005471 Bacteria 31065
119 Ga0070698_100002044 3300005471 Bacteria 22425
120 Ga0070698_100126852 3300005471 Bacteria 2509
121 Ga0070698_100159775 3300005471 Bacteria 2198
122 Ga0070698_101022260 3300005471 Unclassified 774
123 Ga0070699_100001100 3300005518 Bacteria 25172
124 Ga0070699_100002908 3300005518 Bacteria 15244
125 Ga0070699_100033580 3300005518 Bacteria 4432
126 Ga0070699_100037176 3300005518 Bacteria 4213
127 Ga0070699_100235755 3300005518 Bacteria 1632
128 Ga0070684_100030673 3300005535 Bacteria 4570
129 Ga0070684_100032221 3300005535 Bacteria 4466
130 Ga0070697_100000266 3300005536 Bacteria 42492
131 Ga0070697_100000701 3300005536 Bacteria 25059
132 Ga0070697_100016981 3300005536 Bacteria 5722
133 Ga0070697_100058991 3300005536 Bacteria 3123
134 Ga0070697_100061663 3300005536 Unclassified 3059
135 Ga0070697_100131111 3300005536 Bacteria 2102
136 Ga0070697_100668358 3300005536 Bacteria 915
137 Ga0068853_100341029 3300005539 Bacteria 1392
138 Ga0070672_100661908 3300005543 Bacteria 912
139 Ga0070686_100128055 3300005544 Bacteria 1752
140 Ga0070686_100146117 3300005544 Bacteria 1651
141 Ga0070695_100055008 3300005545 Unclassified 2564
142 Ga0070695_100103496 3300005545 Bacteria 1921
143 Ga0070695_100719205 3300005545 Bacteria 794
144 Ga0070693_100099957 3300005547 Bacteria 1765
145 Ga0070693_100192365 3300005547 Unclassified 1320
146 Ga0070693_100293454 3300005547 Unclassified 1093
147 Ga0070693_100777961 3300005547 Unclassified 707
148 Ga0070665_100025297 3300005548 Bacteria 5981
149 Ga0070665_100533677 3300005548 Bacteria 1185
150 Ga0070704_100074126 3300005549 Bacteria 2482
151 Ga0068855_100077184 3300005563 Bacteria 3864
152 Ga0068855_100568963 3300005563 Bacteria 1225
153 Ga0070664_100107745 3300005564 Bacteria 2429
154 Ga0070664_100222428 3300005564 Bacteria 1689
155 Ga0070664_100896424 3300005564 Unclassified 831
156 Ga0068857_100002168 3300005577 Bacteria 15958
157 Ga0068857_100044253 3300005577 Bacteria 3948
158 Ga0068857_100099360 3300005577 Bacteria 2610
159 Ga0068854_100093557 3300005578 Bacteria 2240
160 Ga0068854_100302063 3300005578 Unclassified 1295
161 Ga0068856_100018058 3300005614 Bacteria 6840
162 Ga0068856_100021804 3300005614 Bacteria 6226
163 Ga0068856_100044332 3300005614 Bacteria 4377
164 Ga0068856_100064873 3300005614 Bacteria 3608
165 Ga0068856_100104896 3300005614 Bacteria 2821
166 Ga0068856_100211510 3300005614 Bacteria 1955
167 Ga0068856_100256296 3300005614 Bacteria 1764
168 Ga0068852_100011844 3300005616 Bacteria 6591
169 Ga0068859_100021521 3300005617 Bacteria 6472
170 Ga0068864_100073221 3300005618 Bacteria 2986
171 Ga0068864_100163288 3300005618 Bacteria 2026
172 Ga0068866_10020794 3300005718 Unclassified 3012
173 Ga0068866_10109315 3300005718 Unclassified 1539
174 Ga0068861_100042481 3300005719 Bacteria 3407
175 Ga0068861_100428115 3300005719 Bacteria 1181
176 Ga0068851_10007547 3300005834 Bacteria 4998
177 Ga0068851_10311291 3300005834 Unclassified 907
178 Ga0068870_10010814 3300005840 Bacteria 4207
179 Ga0068863_100106501 3300005841 Bacteria 2668
180 Ga0068863_100292337 3300005841 Bacteria 1579
181 Ga0068858_100033597 3300005842 Bacteria 4758
182 Ga0068858_100068255 3300005842 Bacteria 3294
183 Ga0068858_101030596 3300005842 Bacteria 807
184 Ga0068860_100051564 3300005843 Bacteria 3915
185 Ga0068860_100098412 3300005843 Bacteria 2789
186 Ga0068860_100192215 3300005843 Bacteria 1975
187 Ga0068862_100010616 3300005844 Bacteria 7610
188 Ga0068862_100237907 3300005844 Bacteria 1654
189 Ga0070717_10001093 3300006028 Bacteria 18235
190 Ga0070717_10001658 3300006028 Bacteria 15470
191 Ga0070717_10012009 3300006028 Bacteria 6595
192 Ga0070717_10031513 3300006028 Bacteria 4266
193 Ga0070717_10046711 3300006028 Bacteria 3544
194 Ga0070717_10051907 3300006028 Bacteria 3376
195 Ga0070717_10054243 3300006028 Bacteria 3305
196 Ga0070717_10072990 3300006028 Bacteria 2867
197 Ga0070717_10155358 3300006028 Bacteria 1982
198 Ga0070717_10303444 3300006028 Bacteria 1420
199 Ga0070715_10026101 3300006163 Bacteria 2320
200 Ga0070716_100012854 3300006173 Bacteria 4255
201 Ga0070716_100029846 3300006173 Bacteria 2953
202 Ga0070716_100043545 3300006173 Bacteria 2511
203 Ga0070716_100060757 3300006173 Bacteria 2184
204 Ga0070716_100096582 3300006173 Bacteria 1801
205 Ga0070716_100123616 3300006173 Bacteria 1624
206 Ga0070716_100125871 3300006173 Bacteria 1612
207 Ga0070716_100240198 3300006173 Unclassified 1228
208 Ga0070716_100428372 3300006173 Bacteria 959
209 Ga0070712_100000130 3300006175 Bacteria 39526
210 Ga0070712_100002208 3300006175 Bacteria 11974
211 Ga0070712_100006015 3300006175 Bacteria 7508
212 Ga0070712_100036544 3300006175 Bacteria 3343
213 Ga0070712_100037951 3300006175 Bacteria 3287
214 Ga0070712_100083096 3300006175 Unclassified 2324
215 Ga0070712_100095851 3300006175 Bacteria 2184
216 Ga0070712_100205780 3300006175 Bacteria 1549
217 Ga0070712_100304398 3300006175 Unclassified 1291
218 Ga0097621_100144143 3300006237 Bacteria 2038
219 Ga0097621_100495087 3300006237 Bacteria 1106
220 Ga0068871_100067623 3300006358 Bacteria 2932
221 Ga0068871_100166672 3300006358 Unclassified 1886
222 Ga0068871_100261319 3300006358 Bacteria 1510
223 Ga0068871_100311734 3300006358 Bacteria 1383
224 Ga0068871_100317771 3300006358 Unclassified 1370
225 Ga0075433_10655289 3300006852 Unclassified 920
226 Ga0068865_100115694 3300006881 Bacteria 1985
227 Ga0075436_100001267 3300006914 Bacteria 17156
228 Ga0097620_100021523 3300006931 Bacteria 6472
229 Ga0075435_100010410 3300007076 Bacteria 6803
230 Ga0099794_10011693 3300007265 Bacteria 3765
231 Ga0099794_10302792 3300007265 Unclassified 828
232 Ga0105250_10069541 3300009092 Bacteria 1421
233 Ga0105240_10018684 3300009093 Bacteria 9288
234 Ga0105240_10037791 3300009093 Bacteria 6202
235 Ga0105240_10039687 3300009093 Bacteria 6026
236 Ga0105240_10216890 3300009093 Bacteria 2232
237 Ga0105240_10314497 3300009093 Bacteria 1787
238 Ga0105240_10385045 3300009093 Bacteria 1583
239 Ga0105240_10461079 3300009093 Bacteria 1420
240 Ga0105245_10010421 3300009098 Bacteria 8095
241 Ga0105245_10011580 3300009098 Bacteria 7685
242 Ga0105245_10034309 3300009098 Bacteria 4500
243 Ga0105245_10126039 3300009098 Bacteria 2397
244 Ga0105245_10397236 3300009098 Unclassified 1377
245 Ga0105245_10616474 3300009098 Bacteria 1113
246 Ga0105247_10020036 3300009101 Bacteria 4021
247 Ga0105247_10061130 3300009101 Bacteria 2335
248 Ga0105247_10186684 3300009101 Unclassified 1386
249 Ga0105241_10001638 3300009174 Bacteria 17067
250 Ga0105241_10014378 3300009174 Bacteria 5796
251 Ga0105241_10092985 3300009174 Bacteria 2382
252 Ga0105241_10201452 3300009174 Bacteria 1663
253 Ga0105242_10217703 3300009176 Bacteria 1705
254 Ga0105248_10024998 3300009177 Bacteria 6639
255 Ga0105248_10028234 3300009177 Bacteria 6250
256 Ga0105248_10477857 3300009177 Bacteria 1405
257 Ga0105237_10009832 3300009545 Bacteria 10228
258 Ga0105237_10039971 3300009545 Bacteria 4732
259 Ga0105237_10423771 3300009545 Unclassified 1336
260 Ga0105237_10643054 3300009545 Bacteria 1067
261 Ga0105238_10030176 3300009551 Bacteria 5518
262 Ga0105238_10137889 3300009551 Bacteria 2417
263 Ga0105238_10165197 3300009551 Bacteria 2189
264 Ga0105238_11074347 3300009551 Unclassified 827
265 Ga0105238_11329721 3300009551 Unclassified 745
266 Ga0105249_10032205 3300009553 Bacteria 4742
267 Ga0105249_10071939 3300009553 Bacteria 3196
268 Ga0105249_10089823 3300009553 Bacteria 2871
269 Ga0105246_10074648 3300011119 Bacteria 2398
270 Ga0105246_10202787 3300011119 Unclassified 1543
271 Ga0157373_10001299 3300013100 Bacteria 19063
272 Ga0157373_10004687 3300013100 Bacteria 10283
273 Ga0157373_10322939 3300013100 Unclassified 1098
274 Ga0157373_10535255 3300013100 Unclassified 848
275 Ga0157371_10008938 3300013102 Bacteria 7928
276 Ga0157371_10014882 3300013102 Bacteria 5855
277 Ga0157370_10016617 3300013104 Bacteria 7445
278 Ga0157370_10314105 3300013104 Bacteria 1446
279 Ga0157369_10031049 3300013105 Bacteria 5888
280 Ga0157369_10046588 3300013105 Bacteria 4711
281 Ga0157369_10060956 3300013105 Bacteria 4068
282 Ga0157369_10201939 3300013105 Unclassified 2086
283 Ga0157369_10323184 3300013105 Unclassified 1604
284 Ga0157374_10013788 3300013296 Bacteria 7060
285 Ga0157374_10030581 3300013296 Bacteria 4891
286 Ga0157374_10038624 3300013296 Bacteria 4389
287 Ga0157374_10062225 3300013296 Bacteria 3497
288 Ga0157374_10291834 3300013296 Bacteria 1612
289 Ga0157374_10403686 3300013296 Bacteria 1364
290 Ga0157378_10435188 3300013297 Bacteria 1299
291 Ga0157378_10983779 3300013297 Bacteria 877
292 Ga0163162_10001531 3300013306 Bacteria 21558
293 Ga0163162_10015654 3300013306 Bacteria 7412
294 Ga0163162_10373372 3300013306 Unclassified 1559
295 Ga0157372_10000825 3300013307 Bacteria 33540
296 Ga0157372_10015799 3300013307 Bacteria 8098
297 Ga0157372_10028645 3300013307 Bacteria 6081
298 Ga0157372_10039702 3300013307 Bacteria 5196
299 Ga0157372_10078707 3300013307 Bacteria 3726
300 Ga0157375_10110076 3300013308 Bacteria 2851
301 Ga0157375_10288099 3300013308 Bacteria 1805
302 Ga0157375_12098690 3300013308 Bacteria 672
303 Ga0163163_10010127 3300014325 Bacteria 8456
304 Ga0163163_10040139 3300014325 Bacteria 4569
305 Ga0163163_10112727 3300014325 Bacteria 2749
306 Ga0163163_10116898 3300014325 Unclassified 2698
307 Ga0163163_10152848 3300014325 Bacteria 2351
308 Ga0163163_10300583 3300014325 Bacteria 1657
309 Ga0163163_11031706 3300014325 Bacteria 886
310 Ga0157377_10021473 3300014745 Bacteria 3396
311 Ga0157379_10001261 3300014968 Bacteria 20577
312 Ga0157379_10007858 3300014968 Bacteria 9240
313 Ga0157379_10078446 3300014968 Bacteria 2958
314 Ga0157379_10241143 3300014968 Bacteria 1640
315 Ga0157376_10174796 3300014969 Bacteria 1958
316 Ga0157376_10180233 3300014969 Bacteria 1930
317 Ga0157376_10917042 3300014969 Bacteria 895
318 Ga0157376_11717763 3300014969 Unclassified 663
319 Ga0184601_104320 3300019183 Bacteria 848
320 Ga0213874_10063999 3300021377 Bacteria 1158
321 Ga0224570_100291 3300022730 Bacteria 3800
322 Ga0224571_100317 3300022734 Unclassified 2520
323 Ga0247553_100308 3300023672 Bacteria 1692
324 Ga0224572_1000408 3300024225 Bacteria 4894
325 Ga0224572_1004935 3300024225 Bacteria 2356
326 Ga0228598_1000383 3300024227 Bacteria 8859
327 Ga0228598_1002732 3300024227 Bacteria 3823
328 Ga0228598_1020970 3300024227 Unclassified 1286
329 Ga0207656_10024608 3300025321 Bacteria 2436
330 Ga0207692_10006024 3300025898 Bacteria 4902
331 Ga0207692_10025360 3300025898 Unclassified 2768
332 Ga0207692_10037896 3300025898 Bacteria 2361
333 Ga0207642_10030947 3300025899 Bacteria 2236
334 Ga0207710_10101690 3300025900 Bacteria 1356
335 Ga0207680_10324478 3300025903 Unclassified 1077
336 Ga0207647_10015589 3300025904 Bacteria 5205
337 Ga0207685_10069819 3300025905 Bacteria 1420
338 Ga0207699_10000528 3300025906 Bacteria 18865
339 Ga0207699_10003495 3300025906 Bacteria 7499
340 Ga0207699_10004846 3300025906 Bacteria 6438
341 Ga0207699_10012963 3300025906 Bacteria 4251
342 Ga0207699_10170108 3300025906 Unclassified 1457
343 Ga0207699_10246783 3300025906 Bacteria 1229
344 Ga0207699_10301663 3300025906 Bacteria 1119
345 Ga0207699_10452759 3300025906 Bacteria 921
346 Ga0207699_10489048 3300025906 Bacteria 887
347 Ga0207645_10004270 3300025907 Bacteria 10605
348 Ga0207684_10000274 3300025910 Bacteria 76497
349 Ga0207684_10003347 3300025910 Bacteria 15715
350 Ga0207684_10019671 3300025910 Bacteria 5775
351 Ga0207684_10096830 3300025910 Bacteria 2519
352 Ga0207684_10145762 3300025910 Unclassified 2036
353 Ga0207684_10207565 3300025910 Bacteria 1690
354 Ga0207684_10517208 3300025910 Bacteria 1022
355 Ga0207684_10723930 3300025910 Unclassified 844
356 Ga0207654_10139287 3300025911 Bacteria 1545
357 Ga0207654_10232786 3300025911 Unclassified 1228
358 Ga0207707_10009709 3300025912 Bacteria 8348
359 Ga0207707_10090077 3300025912 Bacteria 2681
360 Ga0207707_10196174 3300025912 Unclassified 1761
361 Ga0207695_10028405 3300025913 Bacteria 6204
362 Ga0207695_10047537 3300025913 Bacteria 4540
363 Ga0207695_10085345 3300025913 Bacteria 3186
364 Ga0207695_10271179 3300025913 Bacteria 1592
365 Ga0207671_10332065 3300025914 Unclassified 1204
366 Ga0207671_10453384 3300025914 Unclassified 1022
367 Ga0207693_10000013 3300025915 Bacteria 154365
368 Ga0207693_10000143 3300025915 Bacteria 65412
369 Ga0207693_10002309 3300025915 Bacteria 16587
370 Ga0207693_10004457 3300025915 Bacteria 11831
371 Ga0207693_10014717 3300025915 Bacteria 6285
372 Ga0207693_10062201 3300025915 Bacteria 2925
373 Ga0207693_10138156 3300025915 Bacteria 1916
374 Ga0207693_10275187 3300025915 Bacteria 1319
375 Ga0207693_10275488 3300025915 Unclassified 1318
376 Ga0207663_10001881 3300025916 Bacteria 9929
377 Ga0207663_10012032 3300025916 Bacteria 4665
378 Ga0207663_10154117 3300025916 Bacteria 1615
379 Ga0207663_10887446 3300025916 Bacteria 713
380 Ga0207660_10639312 3300025917 Unclassified 867
381 Ga0207657_10002502 3300025919 Bacteria 19880
382 Ga0207649_10032077 3300025920 Bacteria 3128
383 Ga0207652_10088156 3300025921 Bacteria 2722
384 Ga0207646_10000240 3300025922 Bacteria 75609
385 Ga0207646_10000341 3300025922 Bacteria 63056
386 Ga0207646_10113350 3300025922 Bacteria 2434
387 Ga0207646_10167820 3300025922 Unclassified 1982
388 Ga0207646_10294921 3300025922 Unclassified 1465
389 Ga0207646_10327932 3300025922 Bacteria 1383
390 Ga0207646_10411798 3300025922 Unclassified 1221
391 Ga0207646_10617367 3300025922 Bacteria 973
392 Ga0207694_10088049 3300025924 Bacteria 2447
393 Ga0207694_10391345 3300025924 Unclassified 1155
394 Ga0207694_10576520 3300025924 Unclassified 945
395 Ga0207650_10295167 3300025925 Bacteria 1322
396 Ga0207687_10032008 3300025927 Bacteria 3559
397 Ga0207687_10100734 3300025927 Bacteria 2125
398 Ga0207700_10000337 3300025928 Bacteria 27629
399 Ga0207700_10000346 3300025928 Bacteria 27177
400 Ga0207700_10012848 3300025928 Bacteria 5418
401 Ga0207700_10031073 3300025928 Bacteria 3790
402 Ga0207700_10066360 3300025928 Bacteria 2758
403 Ga0207700_10151549 3300025928 Unclassified 1916
404 Ga0207700_10219183 3300025928 Unclassified 1612
405 Ga0207700_10370578 3300025928 Bacteria 1250
406 Ga0207700_10392450 3300025928 Bacteria 1215
407 Ga0207700_10644168 3300025928 Bacteria 945
408 Ga0207664_10000201 3300025929 Bacteria 44962
409 Ga0207664_10013157 3300025929 Bacteria 5931
410 Ga0207664_10082306 3300025929 Bacteria 2621
411 Ga0207664_10089793 3300025929 Bacteria 2517
412 Ga0207664_10305247 3300025929 Bacteria 1401
413 Ga0207664_10373971 3300025929 Bacteria 1264
414 Ga0207664_10392487 3300025929 Bacteria 1233
415 Ga0207690_10080728 3300025932 Bacteria 2270
416 Ga0207706_10001321 3300025933 Bacteria 24837
417 Ga0207686_10770868 3300025934 Bacteria 769
418 Ga0207709_10047224 3300025935 Bacteria 2616
419 Ga0207669_10154973 3300025937 Unclassified 1610
420 Ga0207665_10003598 3300025939 Bacteria 10348
421 Ga0207665_10005780 3300025939 Bacteria 8227
422 Ga0207665_10014974 3300025939 Bacteria 5094
423 Ga0207665_10019820 3300025939 Bacteria 4420
424 Ga0207665_10046599 3300025939 Bacteria 2904
425 Ga0207665_10050393 3300025939 Bacteria 2800
426 Ga0207665_10068696 3300025939 Bacteria 2415
427 Ga0207665_10079100 3300025939 Bacteria 2260
428 Ga0207665_10140700 3300025939 Bacteria 1720
429 Ga0207665_10299628 3300025939 Unclassified 1201
430 Ga0207711_10005468 3300025941 Bacteria 10741
431 Ga0207711_10332417 3300025941 Bacteria 1405
432 Ga0207689_10021360 3300025942 Bacteria 5444
433 Ga0207689_10291861 3300025942 Bacteria 1351
434 Ga0207689_10745622 3300025942 Bacteria 826
435 Ga0207661_11523938 3300025944 Bacteria 612
436 Ga0207679_10778907 3300025945 Unclassified 871
437 Ga0207679_10822240 3300025945 Unclassified 848
438 Ga0207667_10353783 3300025949 Bacteria 1498
439 Ga0207667_10451906 3300025949 Bacteria 1305
440 Ga0207640_10391143 3300025981 Unclassified 1129
441 Ga0207640_11263669 3300025981 Unclassified 658
442 Ga0207658_10169082 3300025986 Unclassified 1799
443 Ga0207658_10625454 3300025986 Unclassified 969
444 Ga0207677_10052606 3300026023 Unclassified 2767
445 Ga0207677_10268477 3300026023 Unclassified 1394
446 Ga0207639_10439738 3300026041 Bacteria 1182
447 Ga0207678_10000277 3300026067 Bacteria 46368
448 Ga0207702_10010133 3300026078 Bacteria 7892
449 Ga0207702_10010742 3300026078 Bacteria 7646
450 Ga0207702_10076477 3300026078 Unclassified 2894
451 Ga0207702_10089073 3300026078 Bacteria 2698
452 Ga0207702_10505245 3300026078 Bacteria 1179
453 Ga0207641_10049231 3300026088 Bacteria 3560
454 Ga0207641_10331212 3300026088 Bacteria 1446
455 Ga0207641_10421987 3300026088 Bacteria 1284
456 Ga0207648_10017311 3300026089 Bacteria 6563
457 Ga0207676_10128670 3300026095 Bacteria 2149
458 Ga0207674_10012162 3300026116 Bacteria 9635
459 Ga0207674_10016566 3300026116 Bacteria 8062
460 Ga0207674_10181249 3300026116 Bacteria 2058
461 Ga0207675_100243973 3300026118 Bacteria 1736
462 Ga0207683_10160969 3300026121 Bacteria 2029
463 Ga0265356_1001162 3300028017 Bacteria 4045
464 Ga0265356_1002472 3300028017 Bacteria 2477
465 Ga0268266_10305898 3300028379 Bacteria 1484
466 Ga0268265_10066561 3300028380 Bacteria 2785
467 Ga0268264_10042134 3300028381 Bacteria 3778
468 Ga0268264_10058821 3300028381 Bacteria 3219
469 Ga0265326_10066592 3300028558 Unclassified 1018
470 Ga0265338_10024720 3300028800 Bacteria 6126
471 Ga0265338_10367482 3300028800 Bacteria 1031
472 Ga0265762_1001174 3300030760 Bacteria 4743
473 Ga0265767_100901 3300030836 Unclassified 1362
474 Ga0265777_101754 3300030877 Unclassified 1198
475 Ga0265765_1012605 3300030879 Bacteria 960
476 Ga0265764_103767 3300030882 Unclassified 802
477 Ga0265771_1011809 3300031010 Unclassified 659
478 Ga0265760_10000817 3300031090 Bacteria 8977
479 Ga0265760_10001979 3300031090 Bacteria 6017
480 Ga0265760_10003825 3300031090 Bacteria 4364
481 Ga0265760_10007880 3300031090 Bacteria 3043
482 Ga0265760_10022950 3300031090 Bacteria 1810
483 Ga0265760_10034347 3300031090 Bacteria 1500
484 Ga0265330_10009005 3300031235 Bacteria 4764
485 Ga0265340_10044209 3300031247 Bacteria 2180
486 Ga0265340_10095583 3300031247 Bacteria 1385
487 Ga0265339_10020315 3300031249 Bacteria 3883
488 Ga0265339_10030436 3300031249 Bacteria 3056
489 Ga0265339_10033158 3300031249 Bacteria 2910
490 Ga0265339_10149990 3300031249 Bacteria 1180
491 Ga0265316_10002054 3300031344 Bacteria 21202
492 Ga0265316_10027901 3300031344 Unclassified 4667
493 Ga0265316_10049817 3300031344 Unclassified 3297
494 Ga0265314_10000348 3300031711 Bacteria 64175
495 Ga0265314_10023827 3300031711 Bacteria 4655
496 Ga0265314_10074163 3300031711 Bacteria 2267
497 Ga0265314_10100093 3300031711 Bacteria 1865
498 Ga0265342_10048686 3300031712 Bacteria 2540
499 Ga0265342_10295034 3300031712 Bacteria 855
500 Ga0316053_100216 3300032120 Bacteria 2278
501 Ga0316212_1006664 3300033547 Bacteria 1671
502 Ga0316212_1019356 3300033547 Unclassified 955
503 Ga0373930_0047228 3300034816 Unclassified 931
504 Ga0373926_0005377 3300035083 Bacteria 4218
505 Ga0373926_0055670 3300035083 Bacteria 1434
506 Ga0373926_0168743 3300035083 Unclassified 837
507 Ga0373934_0038417 3300035086 Bacteria 1886
508 Ga0373940_0014887 3300035088 Bacteria 1905
509 Ga0373951_0025103 3300035091 Unclassified 1383
510 Ga0373923_0008953 3300035111 Bacteria 3593
511 Ga0373932_0015752 3300035112 Bacteria 1921
512 Ga0373936_0000275 3300035113 Bacteria 17102
513 Ga0373936_0018891 3300035113 Bacteria 2667
514 Ga0373936_0032100 3300035113 Bacteria 2076
515 Ga0373936_0107940 3300035113 Bacteria 1180
516 Ga0373939_0004499 3300035114 Bacteria 3302
517 Ga0373945_0053857 3300035116 Unclassified 1486
518 Ga0373953_0057031 3300035117 Bacteria 1589
519 Ga0373954_0029119 3300035118 Bacteria 2542
520 Ga0373956_0035693 3300035119 Bacteria 2193
521 Ga0373960_0007444 3300035121 Unclassified 2594
522 Ga0373943_0000011 3300035170 Bacteria 64439
523 Ga0373943_0018454 3300035170 Unclassified 3206
524 Ga0373943_0052333 3300035170 Bacteria 2013
525 Ga0373943_0135442 3300035170 Bacteria 1322
526 Ga0373943_0136882 3300035170 Bacteria 1316
527 Ga0373943_0237461 3300035170 Bacteria 1020
528 Ga0373943_0274154 3300035170 Bacteria 952
529 Ga0373946_0004868 3300035171 Bacteria 4834
530 Ga0373955_0419814 3300035172 Unclassified 813
531 Ga0373942_0077346 3300035207 Bacteria 982
532 Ga0373924_0015151 3300035410 Bacteria 2925
533 Ga0373924_0082057 3300035410 Unclassified 1372
534 Ga0373924_0085550 3300035410 Bacteria 1345
535 Ga0373931_0008821 3300035691 Bacteria 4798
536 Ga0373931_0444078 3300035691 Bacteria 828
537 Ga0373935_0001861 3300035692 Bacteria 11832
538 Ga0373935_0002744 3300035692 Bacteria 10136
539 Ga0373935_0064889 3300035692 Bacteria 2342
540 Ga0373935_0438278 3300035692 Bacteria 942
541 Ga0373927_0000604 3300035695 Bacteria 27351
542 Ga0373927_0003800 3300035695 Bacteria 10715
543 Ga0373927_0080802 3300035695 Bacteria 2106
544 Ga0373927_0199084 3300035695 Unclassified 1315
545 Ga0373927_0279037 3300035695 Bacteria 1099
546 Ga0373933_0021828 3300035724 Bacteria 3642
547 Ga0373933_0050277 3300035724 Bacteria 2488
548 Ga0373933_0200177 3300035724 Unclassified 1278
549 Ga0373947_0000784 3300035725 Bacteria 19102
550 Ga0373947_0010631 3300035725 Bacteria 5280
551 Ga0373947_0048835 3300035725 Bacteria 2540
552 Ga0373937_0096584 3300036401 Bacteria 2741
553 Ga0373937_0114777 3300036401 Bacteria 2507
554 Ga0373937_0373907 3300036401 Bacteria 1351
555 Ga0373937_0489643 3300036401 Unclassified 1168
556 Ga0265778_004477 3300036457 Unclassified 1447
557 Ga0373925_0001438 3300037068 Bacteria 20628
558 Ga0373925_0006773 3300037068 Bacteria 8398
559 Ga0373925_0009721 3300037068 Bacteria 6992
560 Ga0373925_0010976 3300037068 Bacteria 6576
561 Ga0373925_0012397 3300037068 Bacteria 6172
562 Ga0373925_0026046 3300037068 Bacteria 4276
563 Ga0373925_0081841 3300037068 Unclassified 2456
564 Ga0373925_0305927 3300037068 Unclassified 1284
565 Ga0373925_0328263 3300037068 Bacteria 1239
566 Ga0373925_0358106 3300037068 Unclassified 1186
567 Ga0395900_1237968 3300037418 Unclassified 661
568 Ga0436360_0358964 3300039438 Bacteria 1147
569 Ga0436363_0451864 3300039450 Unclassified 2065
570 Ga0451839_1277567 3300041496 Bacteria 734
571 Ga0451577_0000241 3300042876 Bacteria 108191
572 Ga0451577_0677628 3300042876 Bacteria 935
573 Ga0451577_0984051 3300042876 Unclassified 758
574 Ga0466963_0085737 3300044694 Unclassified 2139
575 Ga0466964_0033709 3300044706 Bacteria 2041
576 Ga0453684_0000366 3300044712 Bacteria 186117
577 Ga0453684_0738228 3300044712 Bacteria 1067
578 Ga0453684_1510077 3300044712 Bacteria 693
579 Ga0466959_0320400 3300045049 Unclassified 1060
580 Ga0451576_0005686 3300045051 Bacteria 15558
581 Ga0451576_0252655 3300045051 Unclassified 1843
582 Ga0451576_0641173 3300045051 Bacteria 1116
583 Ga0466967_0028583 3300045976 Bacteria 4657
584 Ga0466967_0028774 3300045976 Bacteria 4644
585 Ga0466967_0086055 3300045976 Bacteria 2847
586 Ga0495590_0025074 3300046457 Bacteria 2098
587 Ga0495653_0083918 3300046463 Bacteria 2348
588 Ga0495580_0001182 3300046472 Bacteria 22952
589 Ga0495580_0005708 3300046472 Bacteria 10237
590 Ga0495580_0008969 3300046472 Bacteria 7902
591 Ga0495580_0023555 3300046472 Bacteria 4519
592 Ga0495580_0029919 3300046472 Bacteria 3948
593 Ga0495580_0069661 3300046472 Bacteria 2457
594 Ga0495580_0263134 3300046472 Unclassified 1179
595 Ga0495580_0305002 3300046472 Bacteria 1084
596 Ga0495582_0001573 3300046473 Bacteria 12875
597 Ga0495582_0014062 3300046473 Bacteria 4405
598 Ga0495582_0230587 3300046473 Bacteria 1060
599 Ga0495582_0373567 3300046473 Bacteria 821
600 Ga0495664_0081079 3300046477 Bacteria 1945
601 Ga0495664_0220452 3300046477 Bacteria 1148
602 Ga0495608_0268191 3300046511 Bacteria 1062
603 Ga0495608_0494284 3300046511 Bacteria 741
604 Ga0495630_0122804 3300046517 Bacteria 1970
605 Ga0495630_0273204 3300046517 Bacteria 1291
606 Ga0495666_0021858 3300046526 Bacteria 3167
607 Ga0495666_0151103 3300046526 Bacteria 1080
608 Ga0495665_0011363 3300046531 Bacteria 4819
609 Ga0495665_0026731 3300046531 Bacteria 3099
610 Ga0495665_0148579 3300046531 Bacteria 1224
611 Ga0495665_0332171 3300046531 Bacteria 775
612 Ga0495640_0064350 3300046533 Bacteria 2480
613 Ga0495645_0264922 3300046543 Unclassified 1136
614 Ga0495645_0405866 3300046543 Unclassified 867
615 Ga0495667_0170990 3300046559 Bacteria 1396
616 Ga0495635_0029277 3300046663 Bacteria 3829
617 Ga0495657_0142812 3300046675 Bacteria 1491
618 Ga0495657_0287746 3300046675 Bacteria 982
619 Ga0495599_0184764 3300046678 Bacteria 1284
620 Ga0495658_0069689 3300046683 Bacteria 2039
621 Ga0495658_0303379 3300046683 Bacteria 1010
622 Ga0495669_0002318 3300046684 Bacteria 7799
623 Ga0495669_0029992 3300046684 Bacteria 2387
624 Ga0495581_0023298 3300047315 Unclassified 3588
625 Ga0495581_0088528 3300047315 Bacteria 1795
626 Ga0495604_0178863 3300047317 Bacteria 1485
627 Ga0495674_0010911 3300047319 Bacteria 8588
628 Ga0495674_0020609 3300047319 Bacteria 6103
629 Ga0495674_0196723 3300047319 Bacteria 1674
630 Ga0495674_0234772 3300047319 Bacteria 1513
631 Ga0495674_0343071 3300047319 Unclassified 1214
632 Ga0495674_0680826 3300047319 Unclassified 809
633 Ga0495680_0357459 3300047322 Bacteria 1016
634 Ga0495675_0247434 3300047444 Unclassified 1072
635 Ga0495677_0093393 3300047445 Bacteria 1135
636 Ga0495593_0208859 3300047673 Unclassified 980
637 Ga0495602_0156508 3300048088 Bacteria 1784
638 Ga0495602_0175584 3300048088 Bacteria 1658
639 Ga0495602_0213169 3300048088 Bacteria 1464
640 Ga0495602_0270263 3300048088 Unclassified 1257
641 Ga0495614_0315796 3300048089 Unclassified 724
642 Ga0496100_0060824 3300048903 Bacteria 2487
643 Ga0496101_0052231 3300048904 Bacteria 2947
644 Ga0496101_0318450 3300048904 Bacteria 1220
645 Ga0496102_0005937 3300048905 Bacteria 10396
646 Ga0496102_0052945 3300048905 Bacteria 3699
647 Ga0496102_0363101 3300048905 Unclassified 1363
648 Ga0496103_0008297 3300048906 Bacteria 6168
649 Ga0496104_0153745 3300048907 Bacteria 2208
650 Ga0496104_0308672 3300048907 Bacteria 1495
651 Ga0496105_0211209 3300048908 Unclassified 1582
652 Ga0496105_0247897 3300048908 Bacteria 1443
653 Ga0496105_0647316 3300048908 Unclassified 816
654 Ga0496105_0649248 3300048908 Bacteria 814
655 Ga0496106_0247080 3300048909 Bacteria 1426
656 Ga0496106_0571434 3300048909 Unclassified 907
657 Ga0496107_0042844 3300048910 Bacteria 3252
658 Ga0496107_0361623 3300048910 Bacteria 1080
659 Ga0496107_0599157 3300048910 Bacteria 814
660 Ga0496108_0124534 3300048911 Bacteria 2212
661 Ga0496108_0355645 3300048911 Unclassified 1278
662 Ga0496108_0391978 3300048911 Bacteria 1213
663 Ga0496109_0335280 3300048912 Unclassified 1428
664 Ga0496110_0552566 3300048913 Bacteria 1046
665 Ga0496110_1112353 3300048913 Bacteria 698
666 Ga0496112_0011087 3300048915 Bacteria 8215
667 Ga0496112_0058500 3300048915 Bacteria 3796
668 Ga0496112_0089568 3300048915 Bacteria 3045
669 Ga0496112_0094726 3300048915 Bacteria 2956
670 Ga0496112_0437180 3300048915 Bacteria 1246
671 Ga0496112_0619466 3300048915 Unclassified 1013
672 Ga0496113_0015649 3300048916 Bacteria 5223
673 Ga0496113_0504423 3300048916 Unclassified 971
674 Ga0496114_0056576 3300048917 Bacteria 3274
675 Ga0496114_0059045 3300048917 Bacteria 3204
676 Ga0496115_0017969 3300048918 Bacteria 5418
677 Ga0496115_0635984 3300048918 Bacteria 845
678 Ga0496115_0968686 3300048918 Bacteria 652
679 Ga0501083_0026123 3300049744 Bacteria 4040
680 Ga0501083_0085897 3300049744 Bacteria 2081
681 nmdc:mga0n895_224433_c1 3300050512 Unclassified 1907
682 nmdc:mga0rr50_45157_c1 3300050513 Bacteria 3236
683 nmdc:mga08x19_1063_c1 3300050514 Bacteria 17156
684 nmdc:mga0a205_617208_c1 3300050515 Unclassified 937
685 Ga0495601_0131310 3300053077 Bacteria 1631
686 Ga0070708_100334466
687 LJNas_1000260
688 JGI24752J21851_1003237
689 JGI24737J22298_10112947
690 JGI24749J21850_1009599
691 JGI24751J29686_10000764
692 Ga0065712_10304804
693 Ga0065715_10134981
694 Ga0065715_10158482
695 Ga0070658_10754492
696 Ga0070676_10046894
697 Ga0070683_100005649
698 Ga0070683_100407720
699 Ga0070690_100061327
700 Ga0070690_100272973
701 Ga0070670_100194552
702 Ga0070670_100338078
703 Ga0070670_100380499
704 Ga0070677_10239818
705 Ga0068869_100074119
706 Ga0068869_100624253
707 Ga0068869_100689783
708 Ga0070680_100506119
709 Ga0068868_100004556
710 Ga0068868_100096044
711 Ga0068868_100355108
712 Ga0068868_100743530
713 Ga0070660_100067840
714 Ga0070660_100151726
715 Ga0070689_100010090
716 Ga0070689_100063235
717 Ga0070687_100317222
718 Ga0070661_100012749
719 Ga0070661_100057378
720 Ga0070692_10472005
721 Ga0070668_100005025
722 Ga0070668_100418056
723 Ga0070669_100511106
724 Ga0070669_100651046
725 Ga0070675_100059776
726 Ga0070675_100130904
727 Ga0070675_100584183
728 Ga0070675_100666770
729 Ga0070674_100220028
730 Ga0070688_100187917
731 Ga0070659_100004220
732 Ga0070667_100011429
733 Ga0070667_100073367
734 Ga0070667_100730903
735 Ga0070709_10007118
736 Ga0070709_10010494
737 Ga0070709_10010869
738 Ga0070709_10046772
739 Ga0070709_10049158
740 Ga0070709_10100077
741 Ga0070709_10455055
742 Ga0070714_100000046
743 Ga0070714_100002862
744 Ga0070714_100010217
745 Ga0070714_100059470
746 Ga0070714_100746881
747 Ga0070713_100000057
748 Ga0070713_100000583
749 Ga0070713_100003196
750 Ga0070713_100024512
751 Ga0070713_100025850
752 Ga0070713_100047430
753 Ga0070713_100152369
754 Ga0070713_100155028
755 Ga0070713_100332154
756 Ga0070713_100415804
757 Ga0070713_100715086
758 Ga0070713_101351123
759 Ga0070713_101401111
760 Ga0070710_10004463
761 Ga0070710_10033046
762 Ga0070710_10209085
763 Ga0070711_100007062
764 Ga0070711_100021372
765 Ga0070711_100203206
766 Ga0070711_100273015
767 Ga0070711_100449068
768 Ga0070705_100125960
769 Ga0070705_100287051
770 Ga0070694_100091865
771 Ga0070708_100000437
772 Ga0070708_100015048
773 Ga0070708_100018463
774 Ga0070708_100033060
775 Ga0070708_100055671
776 Ga0070708_100062121
777 Ga0070708_100070749
778 Ga0070708_100162121
779 Ga0070708_100174578
780 Ga0070708_100333521
781 Ga0070663_100021022
782 Ga0070663_100257779
783 Ga0070678_100074534
784 Ga0070662_100128251
785 Ga0070662_100130123
786 Ga0070681_10006550
787 Ga0070681_10369159
788 Ga0068867_100053866
789 Ga0070706_100000935
790 Ga0070706_100003883
791 Ga0070706_100006968
792 Ga0070706_100064219
793 Ga0070706_100261281
794 Ga0070706_100577490
795 Ga0070706_100701326
796 Ga0070706_101016775
797 Ga0070707_100001244
798 Ga0070707_100002157
799 Ga0070707_100003649
800 Ga0070707_100030458
801 Ga0070707_100220881
802 Ga0070707_100395934
803 Ga0070698_100001005
804 Ga0070698_100002044
805 Ga0070698_100126852
806 Ga0070698_100159775
807 Ga0070698_101022260
808 Ga0070699_100001100
809 Ga0070699_100002908
810 Ga0070699_100033580
811 Ga0070699_100037176
812 Ga0070699_100235755
813 Ga0070684_100030673
814 Ga0070684_100032221
815 Ga0070697_100000266
816 Ga0070697_100000701
817 Ga0070697_100016981
818 Ga0070697_100058991
819 Ga0070697_100061663
820 Ga0070697_100131111
821 Ga0070697_100668358
822 Ga0068853_100341029
823 Ga0070672_100661908
824 Ga0070686_100128055
825 Ga0070686_100146117
826 Ga0070695_100055008
827 Ga0070695_100103496
828 Ga0070695_100719205
829 Ga0070693_100099957
830 Ga0070693_100192365
831 Ga0070693_100293454
832 Ga0070693_100777961
833 Ga0070665_100025297
834 Ga0070665_100533677
835 Ga0070704_100074126
836 Ga0068855_100077184
837 Ga0068855_100568963
838 Ga0070664_100107745
839 Ga0070664_100222428
840 Ga0070664_100896424
841 Ga0068857_100002168
842 Ga0068857_100044253
843 Ga0068857_100099360
844 Ga0068854_100093557
845 Ga0068854_100302063
846 Ga0068856_100018058
847 Ga0068856_100021804
848 Ga0068856_100044332
849 Ga0068856_100064873
850 Ga0068856_100104896
851 Ga0068856_100211510
852 Ga0068856_100256296
853 Ga0068852_100011844
854 Ga0068859_100021521
855 Ga0068864_100073221
856 Ga0068864_100163288
857 Ga0068866_10020794
858 Ga0068866_10109315
859 Ga0068861_100042481
860 Ga0068861_100428115
861 Ga0068851_10007547
862 Ga0068851_10311291
863 Ga0068870_10010814
864 Ga0068863_100106501
865 Ga0068863_100292337
866 Ga0068858_100033597
867 Ga0068858_100068255
868 Ga0068858_101030596
869 Ga0068860_100051564
870 Ga0068860_100098412
871 Ga0068860_100192215
872 Ga0068862_100010616
873 Ga0068862_100237907
874 Ga0070717_10001093
875 Ga0070717_10001658
876 Ga0070717_10012009
877 Ga0070717_10031513
878 Ga0070717_10046711
879 Ga0070717_10051907
880 Ga0070717_10054243
881 Ga0070717_10072990
882 Ga0070717_10155358
883 Ga0070717_10303444
884 Ga0070715_10026101
885 Ga0070716_100012854
886 Ga0070716_100029846
887 Ga0070716_100043545
888 Ga0070716_100060757
889 Ga0070716_100096582
890 Ga0070716_100123616
891 Ga0070716_100125871
892 Ga0070716_100240198
893 Ga0070716_100428372
894 Ga0070712_100000130
895 Ga0070712_100002208
896 Ga0070712_100006015
897 Ga0070712_100036544
898 Ga0070712_100037951
899 Ga0070712_100083096
900 Ga0070712_100095851
901 Ga0070712_100205780
902 Ga0070712_100304398
903 Ga0097621_100144143
904 Ga0097621_100495087
905 Ga0068871_100067623
906 Ga0068871_100166672
907 Ga0068871_100261319
908 Ga0068871_100311734
909 Ga0068871_100317771
910 Ga0075433_10655289
911 Ga0068865_100115694
912 Ga0075436_100001267
913 Ga0097620_100021523
914 Ga0075435_100010410
915 Ga0099794_10011693
916 Ga0099794_10302792
917 Ga0105250_10069541
918 Ga0105240_10018684
919 Ga0105240_10037791
920 Ga0105240_10039687
921 Ga0105240_10216890
922 Ga0105240_10314497
923 Ga0105240_10385045
924 Ga0105240_10461079
925 Ga0105245_10010421
926 Ga0105245_10011580
927 Ga0105245_10034309
928 Ga0105245_10126039
929 Ga0105245_10397236
930 Ga0105245_10616474
931 Ga0105247_10020036
932 Ga0105247_10061130
933 Ga0105247_10186684
934 Ga0105241_10001638
935 Ga0105241_10014378
936 Ga0105241_10092985
937 Ga0105241_10201452
938 Ga0105242_10217703
939 Ga0105248_10024998
940 Ga0105248_10028234
941 Ga0105248_10477857
942 Ga0105237_10009832
943 Ga0105237_10039971
944 Ga0105237_10423771
945 Ga0105237_10643054
946 Ga0105238_10030176
947 Ga0105238_10137889
948 Ga0105238_10165197
949 Ga0105238_11074347
950 Ga0105238_11329721
951 Ga0105249_10032205
952 Ga0105249_10071939
953 Ga0105249_10089823
954 Ga0105246_10074648
955 Ga0105246_10202787
956 Ga0157373_10001299
957 Ga0157373_10004687
958 Ga0157373_10322939
959 Ga0157373_10535255
960 Ga0157371_10008938
961 Ga0157371_10014882
962 Ga0157370_10016617
963 Ga0157370_10314105
964 Ga0157369_10031049
965 Ga0157369_10046588
966 Ga0157369_10060956
967 Ga0157369_10201939
968 Ga0157369_10323184
969 Ga0157374_10013788
970 Ga0157374_10030581
971 Ga0157374_10038624
972 Ga0157374_10062225
973 Ga0157374_10291834
974 Ga0157374_10403686
975 Ga0157378_10435188
976 Ga0157378_10983779
977 Ga0163162_10001531
978 Ga0163162_10015654
979 Ga0163162_10373372
980 Ga0157372_10000825
981 Ga0157372_10015799
982 Ga0157372_10028645
983 Ga0157372_10039702
984 Ga0157372_10078707
985 Ga0157375_10110076
986 Ga0157375_10288099
987 Ga0157375_12098690
988 Ga0163163_10010127
989 Ga0163163_10040139
990 Ga0163163_10112727
991 Ga0163163_10116898
992 Ga0163163_10152848
993 Ga0163163_10300583
994 Ga0163163_11031706
995 Ga0157377_10021473
996 Ga0157379_10001261
997 Ga0157379_10007858
998 Ga0157379_10078446
999 Ga0157379_10241143
1000 Ga0157376_10174796
1001 Ga0157376_10180233
1002 Ga0157376_10917042
1003 Ga0157376_11717763
1004 Ga0184601_104320
1005 Ga0213874_10063999
1006 Ga0224570_100291
1007 Ga0224571_100317
1008 Ga0247553_100308
1009 Ga0224572_1000408
1010 Ga0224572_1004935
1011 Ga0228598_1000383
1012 Ga0228598_1002732
1013 Ga0228598_1020970
1014 Ga0207656_10024608
1015 Ga0207692_10006024
1016 Ga0207692_10025360
1017 Ga0207692_10037896
1018 Ga0207642_10030947
1019 Ga0207710_10101690
1020 Ga0207680_10324478
1021 Ga0207647_10015589
1022 Ga0207685_10069819
1023 Ga0207699_10000528
1024 Ga0207699_10003495
1025 Ga0207699_10004846
1026 Ga0207699_10012963
1027 Ga0207699_10170108
1028 Ga0207699_10246783
1029 Ga0207699_10301663
1030 Ga0207699_10452759
1031 Ga0207699_10489048
1032 Ga0207645_10004270
1033 Ga0207684_10000274
1034 Ga0207684_10003347
1035 Ga0207684_10019671
1036 Ga0207684_10096830
1037 Ga0207684_10145762
1038 Ga0207684_10207565
1039 Ga0207684_10517208
1040 Ga0207684_10723930
1041 Ga0207654_10139287
1042 Ga0207654_10232786
1043 Ga0207707_10009709
1044 Ga0207707_10090077
1045 Ga0207707_10196174
1046 Ga0207695_10028405
1047 Ga0207695_10047537
1048 Ga0207695_10085345
1049 Ga0207695_10271179
1050 Ga0207671_10332065
1051 Ga0207671_10453384
1052 Ga0207693_10000013
1053 Ga0207693_10000143
1054 Ga0207693_10002309
1055 Ga0207693_10004457
1056 Ga0207693_10014717
1057 Ga0207693_10062201
1058 Ga0207693_10138156
1059 Ga0207693_10275187
1060 Ga0207693_10275488
1061 Ga0207663_10001881
1062 Ga0207663_10012032
1063 Ga0207663_10154117
1064 Ga0207663_10887446
1065 Ga0207660_10639312
1066 Ga0207657_10002502
1067 Ga0207649_10032077
1068 Ga0207652_10088156
1069 Ga0207646_10000240
1070 Ga0207646_10000341
1071 Ga0207646_10113350
1072 Ga0207646_10167820
1073 Ga0207646_10294921
1074 Ga0207646_10327932
1075 Ga0207646_10411798
1076 Ga0207646_10617367
1077 Ga0207694_10088049
1078 Ga0207694_10391345
1079 Ga0207694_10576520
1080 Ga0207650_10295167
1081 Ga0207687_10032008
1082 Ga0207687_10100734
1083 Ga0207700_10000337
1084 Ga0207700_10000346
1085 Ga0207700_10012848
1086 Ga0207700_10031073
1087 Ga0207700_10066360
1088 Ga0207700_10151549
1089 Ga0207700_10219183
1090 Ga0207700_10370578
1091 Ga0207700_10392450
1092 Ga0207700_10644168
1093 Ga0207664_10000201
1094 Ga0207664_10013157
1095 Ga0207664_10082306
1096 Ga0207664_10089793
1097 Ga0207664_10305247
1098 Ga0207664_10373971
1099 Ga0207664_10392487
1100 Ga0207690_10080728
1101 Ga0207706_10001321
1102 Ga0207686_10770868
1103 Ga0207709_10047224
1104 Ga0207669_10154973
1105 Ga0207665_10003598
1106 Ga0207665_10005780
1107 Ga0207665_10014974
1108 Ga0207665_10019820
1109 Ga0207665_10046599
1110 Ga0207665_10050393
1111 Ga0207665_10068696
1112 Ga0207665_10079100
1113 Ga0207665_10140700
1114 Ga0207665_10299628
1115 Ga0207711_10005468
1116 Ga0207711_10332417
1117 Ga0207689_10021360
1118 Ga0207689_10291861
1119 Ga0207689_10745622
1120 Ga0207661_11523938
1121 Ga0207679_10778907
1122 Ga0207679_10822240
1123 Ga0207667_10353783
1124 Ga0207667_10451906
1125 Ga0207640_10391143
1126 Ga0207640_11263669
1127 Ga0207658_10169082
1128 Ga0207658_10625454
1129 Ga0207677_10052606
1130 Ga0207677_10268477
1131 Ga0207639_10439738
1132 Ga0207678_10000277
1133 Ga0207702_10010133
1134 Ga0207702_10010742
1135 Ga0207702_10076477
1136 Ga0207702_10089073
1137 Ga0207702_10505245
1138 Ga0207641_10049231
1139 Ga0207641_10331212
1140 Ga0207641_10421987
1141 Ga0207648_10017311
1142 Ga0207676_10128670
1143 Ga0207674_10012162
1144 Ga0207674_10016566
1145 Ga0207674_10181249
1146 Ga0207675_100243973
1147 Ga0207683_10160969
1148 Ga0265356_1001162
1149 Ga0265356_1002472
1150 Ga0268266_10305898
1151 Ga0268265_10066561
1152 Ga0268264_10042134
1153 Ga0268264_10058821
1154 Ga0265326_10066592
1155 Ga0265338_10024720
1156 Ga0265338_10367482
1157 Ga0265762_1001174
1158 Ga0265767_100901
1159 Ga0265777_101754
1160 Ga0265765_1012605
1161 Ga0265764_103767
1162 Ga0265771_1011809
1163 Ga0265760_10000817
1164 Ga0265760_10001979
1165 Ga0265760_10003825
1166 Ga0265760_10007880
1167 Ga0265760_10022950
1168 Ga0265760_10034347
1169 Ga0265330_10009005
1170 Ga0265340_10044209
1171 Ga0265340_10095583
1172 Ga0265339_10020315
1173 Ga0265339_10030436
1174 Ga0265339_10033158
1175 Ga0265339_10149990
1176 Ga0265316_10002054
1177 Ga0265316_10027901
1178 Ga0265316_10049817
1179 Ga0265314_10000348
1180 Ga0265314_10023827
1181 Ga0265314_10074163
1182 Ga0265314_10100093
1183 Ga0265342_10048686
1184 Ga0265342_10295034
1185 Ga0316053_100216
1186 Ga0316212_1006664
1187 Ga0316212_1019356
1188 Ga0373930_0047228
1189 Ga0373926_0005377
1190 Ga0373926_0055670
1191 Ga0373926_0168743
1192 Ga0373934_0038417
1193 Ga0373940_0014887
1194 Ga0373951_0025103
1195 Ga0373923_0008953
1196 Ga0373932_0015752
1197 Ga0373936_0000275
1198 Ga0373936_0018891
1199 Ga0373936_0032100
1200 Ga0373936_0107940
1201 Ga0373939_0004499
1202 Ga0373945_0053857
1203 Ga0373953_0057031
1204 Ga0373954_0029119
1205 Ga0373956_0035693
1206 Ga0373960_0007444
1207 Ga0373943_0000011
1208 Ga0373943_0018454
1209 Ga0373943_0052333
1210 Ga0373943_0135442
1211 Ga0373943_0136882
1212 Ga0373943_0237461
1213 Ga0373943_0274154
1214 Ga0373946_0004868
1215 Ga0373955_0419814
1216 Ga0373942_0077346
1217 Ga0373924_0015151
1218 Ga0373924_0082057
1219 Ga0373924_0085550
1220 Ga0373931_0008821
1221 Ga0373931_0444078
1222 Ga0373935_0001861
1223 Ga0373935_0002744
1224 Ga0373935_0064889
1225 Ga0373935_0438278
1226 Ga0373927_0000604
1227 Ga0373927_0003800
1228 Ga0373927_0080802
1229 Ga0373927_0199084
1230 Ga0373927_0279037
1231 Ga0373933_0021828
1232 Ga0373933_0050277
1233 Ga0373933_0200177
1234 Ga0373947_0000784
1235 Ga0373947_0010631
1236 Ga0373947_0048835
1237 Ga0373937_0096584
1238 Ga0373937_0114777
1239 Ga0373937_0373907
1240 Ga0373937_0489643
1241 Ga0265778_004477
1242 Ga0373925_0001438
1243 Ga0373925_0006773
1244 Ga0373925_0009721
1245 Ga0373925_0010976
1246 Ga0373925_0012397
1247 Ga0373925_0026046
1248 Ga0373925_0081841
1249 Ga0373925_0305927
1250 Ga0373925_0328263
1251 Ga0373925_0358106
1252 Ga0395900_1237968
1253 Ga0436360_0358964
1254 Ga0436363_0451864
1255 Ga0451839_1277567
1256 Ga0451577_0000241
1257 Ga0451577_0677628
1258 Ga0451577_0984051
1259 Ga0466963_0085737
1260 Ga0466964_0033709
1261 Ga0453684_0000366
1262 Ga0453684_0738228
1263 Ga0453684_1510077
1264 Ga0466959_0320400
1265 Ga0451576_0005686
1266 Ga0451576_0252655
1267 Ga0451576_0641173
1268 Ga0466967_0028583
1269 Ga0466967_0028774
1270 Ga0466967_0086055
1271 Ga0495590_0025074
1272 Ga0495653_0083918
1273 Ga0495580_0001182
1274 Ga0495580_0005708
1275 Ga0495580_0008969
1276 Ga0495580_0023555
1277 Ga0495580_0029919
1278 Ga0495580_0069661
1279 Ga0495580_0263134
1280 Ga0495580_0305002
1281 Ga0495582_0001573
1282 Ga0495582_0014062
1283 Ga0495582_0230587
1284 Ga0495582_0373567
1285 Ga0495664_0081079
1286 Ga0495664_0220452
1287 Ga0495608_0268191
1288 Ga0495608_0494284
1289 Ga0495630_0122804
1290 Ga0495630_0273204
1291 Ga0495666_0021858
1292 Ga0495666_0151103
1293 Ga0495665_0011363
1294 Ga0495665_0026731
1295 Ga0495665_0148579
1296 Ga0495665_0332171
1297 Ga0495640_0064350
1298 Ga0495645_0264922
1299 Ga0495645_0405866
1300 Ga0495667_0170990
1301 Ga0495635_0029277
1302 Ga0495657_0142812
1303 Ga0495657_0287746
1304 Ga0495599_0184764
1305 Ga0495658_0069689
1306 Ga0495658_0303379
1307 Ga0495669_0002318
1308 Ga0495669_0029992
1309 Ga0495581_0023298
1310 Ga0495581_0088528
1311 Ga0495604_0178863
1312 Ga0495674_0010911
1313 Ga0495674_0020609
1314 Ga0495674_0196723
1315 Ga0495674_0234772
1316 Ga0495674_0343071
1317 Ga0495674_0680826
1318 Ga0495680_0357459
1319 Ga0495675_0247434
1320 Ga0495677_0093393
1321 Ga0495593_0208859
1322 Ga0495602_0156508
1323 Ga0495602_0175584
1324 Ga0495602_0213169
1325 Ga0495602_0270263
1326 Ga0495614_0315796
1327 Ga0496100_0060824
1328 Ga0496101_0052231
1329 Ga0496101_0318450
1330 Ga0496102_0005937
1331 Ga0496102_0052945
1332 Ga0496102_0363101
1333 Ga0496103_0008297
1334 Ga0496104_0153745
1335 Ga0496104_0308672
1336 Ga0496105_0211209
1337 Ga0496105_0247897
1338 Ga0496105_0647316
1339 Ga0496105_0649248
1340 Ga0496106_0247080
1341 Ga0496106_0571434
1342 Ga0496107_0042844
1343 Ga0496107_0361623
1344 Ga0496107_0599157
1345 Ga0496108_0124534
1346 Ga0496108_0355645
1347 Ga0496108_0391978
1348 Ga0496109_0335280
1349 Ga0496110_0552566
1350 Ga0496110_1112353
1351 Ga0496112_0011087
1352 Ga0496112_0058500
1353 Ga0496112_0089568
1354 Ga0496112_0094726
1355 Ga0496112_0437180
1356 Ga0496112_0619466
1357 Ga0496113_0015649
1358 Ga0496113_0504423
1359 Ga0496114_0056576
1360 Ga0496114_0059045
1361 Ga0496115_0017969
1362 Ga0496115_0635984
1363 Ga0496115_0968686
1364 Ga0501083_0026123
1365 Ga0501083_0085897
1366 nmdc:mga0n895_224433_c1
1367 nmdc:mga0rr50_45157_c1
1368 nmdc:mga08x19_1063_c1
1369 nmdc:mga0a205_617208_c1
1370 Ga0495601_0131310

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01195

Pept_tRNA_hydro

Peptidyl-tRNA hydrolase

38

221

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p2j-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from mycobacterium smegmatis at 2.2 a resolution 0.933 5 194
1ryb-assembly1.cif.gz_A crystal structure of the chloroplast group ii intron splicing factor crs2 0.9314 7 183
7brd-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from klebsiella pneumoniae 0.9305 7 191
7wt6-assembly1.cif.gz_A crystal structure of full-length peptidyl-trna hydrolase from mycobacterium tuberculosis 0.9292 8 194
2z2j-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from mycobacterium tuberculosis 0.9274 5 183
ID Description Score Start End Superfamily
af_Q54V95_265_452_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9285 66 193 3.40.50.1470
4q55B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9224 7 193 3.40.50.1470
4ylyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9162 8 198 3.40.50.1470
1rynA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9153 8 192 3.40.50.1470
5ektA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9124 4 191 3.40.50.1470
ID Description Score Start End GO Terms
AF-X1IHG4-F1-model_v4 Peptidyl-tRNA hydrolase 0.9897 92 193 GO:0004045
AF-A0A2V9ZXL4-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.974 8 193 GO:0004045
GO:0005737
GO:0006412
AF-G2LJA4-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9665 8 193 GO:0004045
GO:0005737
GO:0006412
AF-A0A7W1T158-F1-model_v4 Aminoacyl-tRNA hydrolase (EC 3.1.1.29) 0.9656 41 198 GO:0004045
AF-A0A2V9ZXL4-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9638 8 193 GO:0004045
GO:0005737
GO:0006412

Map