F475108
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 685 | 268 | 1370 | 195 |
Family's Representative Sequence
| Representative Sequence | 3300005445|Ga0070708_100334466|Ga0070708_1003344662 |
| Length | 228 |
| Sequence | LPVRPSAKRGRRPEGFARRNRVDECVRRYVVRDGGVKLIVGLGNPGIEYQFTPHNLGFLAIDRIAGDLGIEVRNRQCRALTARAEIENVPVLLAKPETYMNLSGLSVGELVRKHDLKPESDLIVIQDELDFPLGTLRIHTRRSSAGHNGIESIIGALGRKDFLRIRIGVAPERKVEDGERYLLSPLRKAQLKVVDGMLDTAEEAVKMILKEGPAAAMNRFNRKEESSQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 83 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300019183 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 108 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 109 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 110 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 111 | 3300023672 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 112 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 113 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 114 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 164 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 168 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 169 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 170 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 171 | 3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 173 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 174 | 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 175 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 176 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 177 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 178 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 179 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 180 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 182 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 183 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 184 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 185 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 186 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 187 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 188 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 192 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 193 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 194 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 195 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 196 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 197 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 198 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 199 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 201 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 203 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 204 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 206 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 207 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 208 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 212 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 213 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 214 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 215 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 216 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 217 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 218 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 219 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 220 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 221 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 222 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 251 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 252 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 253 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 254 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 255 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 256 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 259 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 260 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 261 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 262 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 263 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.66 |
| Metatranscriptomes | 2.34 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.4 |
| Rhizosphere | 93.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 20 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070708_100334466 | 3300005445 | Unclassified | 1427 |
| 2 | LJNas_1000260 | 3300000546 | Bacteria | 9129 |
| 3 | JGI24752J21851_1003237 | 3300001976 | Bacteria | 2148 |
| 4 | JGI24737J22298_10112947 | 3300001990 | Bacteria | 803 |
| 5 | JGI24749J21850_1009599 | 3300002076 | Unclassified | 1352 |
| 6 | JGI24751J29686_10000764 | 3300002459 | Bacteria | 7574 |
| 7 | Ga0065712_10304804 | 3300005290 | Bacteria | 833 |
| 8 | Ga0065715_10134981 | 3300005293 | Bacteria | 1945 |
| 9 | Ga0065715_10158482 | 3300005293 | Bacteria | 1652 |
| 10 | Ga0070658_10754492 | 3300005327 | Unclassified | 845 |
| 11 | Ga0070676_10046894 | 3300005328 | Bacteria | 2521 |
| 12 | Ga0070683_100005649 | 3300005329 | Bacteria | 10448 |
| 13 | Ga0070683_100407720 | 3300005329 | Bacteria | 1296 |
| 14 | Ga0070690_100061327 | 3300005330 | Unclassified | 2422 |
| 15 | Ga0070690_100272973 | 3300005330 | Bacteria | 1203 |
| 16 | Ga0070670_100194552 | 3300005331 | Bacteria | 1762 |
| 17 | Ga0070670_100338078 | 3300005331 | Bacteria | 1321 |
| 18 | Ga0070670_100380499 | 3300005331 | Bacteria | 1243 |
| 19 | Ga0070677_10239818 | 3300005333 | Unclassified | 895 |
| 20 | Ga0068869_100074119 | 3300005334 | Bacteria | 2526 |
| 21 | Ga0068869_100624253 | 3300005334 | Bacteria | 912 |
| 22 | Ga0068869_100689783 | 3300005334 | Bacteria | 870 |
| 23 | Ga0070680_100506119 | 3300005336 | Unclassified | 1033 |
| 24 | Ga0068868_100004556 | 3300005338 | Bacteria | 9730 |
| 25 | Ga0068868_100096044 | 3300005338 | Bacteria | 2393 |
| 26 | Ga0068868_100355108 | 3300005338 | Bacteria | 1256 |
| 27 | Ga0068868_100743530 | 3300005338 | Unclassified | 881 |
| 28 | Ga0070660_100067840 | 3300005339 | Bacteria | 2779 |
| 29 | Ga0070660_100151726 | 3300005339 | Bacteria | 1863 |
| 30 | Ga0070689_100010090 | 3300005340 | Bacteria | 6724 |
| 31 | Ga0070689_100063235 | 3300005340 | Bacteria | 2880 |
| 32 | Ga0070687_100317222 | 3300005343 | Bacteria | 994 |
| 33 | Ga0070661_100012749 | 3300005344 | Bacteria | 5884 |
| 34 | Ga0070661_100057378 | 3300005344 | Bacteria | 2853 |
| 35 | Ga0070692_10472005 | 3300005345 | Unclassified | 807 |
| 36 | Ga0070668_100005025 | 3300005347 | Bacteria | 9796 |
| 37 | Ga0070668_100418056 | 3300005347 | Unclassified | 1147 |
| 38 | Ga0070669_100511106 | 3300005353 | Unclassified | 997 |
| 39 | Ga0070669_100651046 | 3300005353 | Bacteria | 886 |
| 40 | Ga0070675_100059776 | 3300005354 | Bacteria | 3145 |
| 41 | Ga0070675_100130904 | 3300005354 | Bacteria | 2138 |
| 42 | Ga0070675_100584183 | 3300005354 | Bacteria | 1012 |
| 43 | Ga0070675_100666770 | 3300005354 | Bacteria | 946 |
| 44 | Ga0070674_100220028 | 3300005356 | Bacteria | 1477 |
| 45 | Ga0070688_100187917 | 3300005365 | Bacteria | 1437 |
| 46 | Ga0070659_100004220 | 3300005366 | Bacteria | 10260 |
| 47 | Ga0070667_100011429 | 3300005367 | Bacteria | 7341 |
| 48 | Ga0070667_100073367 | 3300005367 | Bacteria | 2918 |
| 49 | Ga0070667_100730903 | 3300005367 | Unclassified | 917 |
| 50 | Ga0070709_10007118 | 3300005434 | Bacteria | 6122 |
| 51 | Ga0070709_10010494 | 3300005434 | Bacteria | 5133 |
| 52 | Ga0070709_10010869 | 3300005434 | Bacteria | 5054 |
| 53 | Ga0070709_10046772 | 3300005434 | Bacteria | 2692 |
| 54 | Ga0070709_10049158 | 3300005434 | Unclassified | 2635 |
| 55 | Ga0070709_10100077 | 3300005434 | Unclassified | 1930 |
| 56 | Ga0070709_10455055 | 3300005434 | Bacteria | 965 |
| 57 | Ga0070714_100000046 | 3300005435 | Bacteria | 113150 |
| 58 | Ga0070714_100002862 | 3300005435 | Bacteria | 12763 |
| 59 | Ga0070714_100010217 | 3300005435 | Bacteria | 7410 |
| 60 | Ga0070714_100059470 | 3300005435 | Unclassified | 3277 |
| 61 | Ga0070714_100746881 | 3300005435 | Bacteria | 946 |
| 62 | Ga0070713_100000057 | 3300005436 | Bacteria | 70266 |
| 63 | Ga0070713_100000583 | 3300005436 | Bacteria | 23153 |
| 64 | Ga0070713_100003196 | 3300005436 | Bacteria | 10785 |
| 65 | Ga0070713_100024512 | 3300005436 | Bacteria | 4700 |
| 66 | Ga0070713_100025850 | 3300005436 | Bacteria | 4598 |
| 67 | Ga0070713_100047430 | 3300005436 | Bacteria | 3531 |
| 68 | Ga0070713_100152369 | 3300005436 | Bacteria | 2058 |
| 69 | Ga0070713_100155028 | 3300005436 | Bacteria | 2041 |
| 70 | Ga0070713_100332154 | 3300005436 | Bacteria | 1406 |
| 71 | Ga0070713_100415804 | 3300005436 | Unclassified | 1258 |
| 72 | Ga0070713_100715086 | 3300005436 | Bacteria | 957 |
| 73 | Ga0070713_101351123 | 3300005436 | Unclassified | 691 |
| 74 | Ga0070713_101401111 | 3300005436 | Unclassified | 678 |
| 75 | Ga0070710_10004463 | 3300005437 | Bacteria | 6623 |
| 76 | Ga0070710_10033046 | 3300005437 | Unclassified | 2807 |
| 77 | Ga0070710_10209085 | 3300005437 | Bacteria | 1236 |
| 78 | Ga0070711_100007062 | 3300005439 | Bacteria | 6813 |
| 79 | Ga0070711_100021372 | 3300005439 | Bacteria | 4184 |
| 80 | Ga0070711_100203206 | 3300005439 | Bacteria | 1530 |
| 81 | Ga0070711_100273015 | 3300005439 | Unclassified | 1335 |
| 82 | Ga0070711_100449068 | 3300005439 | Bacteria | 1055 |
| 83 | Ga0070705_100125960 | 3300005440 | Bacteria | 1663 |
| 84 | Ga0070705_100287051 | 3300005440 | Unclassified | 1173 |
| 85 | Ga0070694_100091865 | 3300005444 | Bacteria | 2132 |
| 86 | Ga0070708_100000437 | 3300005445 | Bacteria | 31114 |
| 87 | Ga0070708_100015048 | 3300005445 | Bacteria | 6382 |
| 88 | Ga0070708_100018463 | 3300005445 | Bacteria | 5837 |
| 89 | Ga0070708_100033060 | 3300005445 | Bacteria | 4492 |
| 90 | Ga0070708_100055671 | 3300005445 | Bacteria | 3517 |
| 91 | Ga0070708_100062121 | 3300005445 | Bacteria | 3339 |
| 92 | Ga0070708_100070749 | 3300005445 | Bacteria | 3139 |
| 93 | Ga0070708_100162121 | 3300005445 | Bacteria | 2084 |
| 94 | Ga0070708_100174578 | 3300005445 | Unclassified | 2007 |
| 95 | Ga0070708_100333521 | 3300005445 | Bacteria | 1429 |
| 96 | Ga0070663_100021022 | 3300005455 | Bacteria | 4332 |
| 97 | Ga0070663_100257779 | 3300005455 | Unclassified | 1382 |
| 98 | Ga0070678_100074534 | 3300005456 | Bacteria | 2551 |
| 99 | Ga0070662_100128251 | 3300005457 | Bacteria | 1952 |
| 100 | Ga0070662_100130123 | 3300005457 | Bacteria | 1939 |
| 101 | Ga0070681_10006550 | 3300005458 | Bacteria | 11336 |
| 102 | Ga0070681_10369159 | 3300005458 | Bacteria | 1345 |
| 103 | Ga0068867_100053866 | 3300005459 | Unclassified | 2971 |
| 104 | Ga0070706_100000935 | 3300005467 | Bacteria | 31937 |
| 105 | Ga0070706_100003883 | 3300005467 | Bacteria | 14597 |
| 106 | Ga0070706_100006968 | 3300005467 | Bacteria | 10660 |
| 107 | Ga0070706_100064219 | 3300005467 | Unclassified | 3393 |
| 108 | Ga0070706_100261281 | 3300005467 | Bacteria | 1616 |
| 109 | Ga0070706_100577490 | 3300005467 | Bacteria | 1045 |
| 110 | Ga0070706_100701326 | 3300005467 | Unclassified | 939 |
| 111 | Ga0070706_101016775 | 3300005467 | Unclassified | 764 |
| 112 | Ga0070707_100001244 | 3300005468 | Bacteria | 25018 |
| 113 | Ga0070707_100002157 | 3300005468 | Bacteria | 18841 |
| 114 | Ga0070707_100003649 | 3300005468 | Bacteria | 14508 |
| 115 | Ga0070707_100030458 | 3300005468 | Bacteria | 5137 |
| 116 | Ga0070707_100220881 | 3300005468 | Bacteria | 1845 |
| 117 | Ga0070707_100395934 | 3300005468 | Bacteria | 1341 |
| 118 | Ga0070698_100001005 | 3300005471 | Bacteria | 31065 |
| 119 | Ga0070698_100002044 | 3300005471 | Bacteria | 22425 |
| 120 | Ga0070698_100126852 | 3300005471 | Bacteria | 2509 |
| 121 | Ga0070698_100159775 | 3300005471 | Bacteria | 2198 |
| 122 | Ga0070698_101022260 | 3300005471 | Unclassified | 774 |
| 123 | Ga0070699_100001100 | 3300005518 | Bacteria | 25172 |
| 124 | Ga0070699_100002908 | 3300005518 | Bacteria | 15244 |
| 125 | Ga0070699_100033580 | 3300005518 | Bacteria | 4432 |
| 126 | Ga0070699_100037176 | 3300005518 | Bacteria | 4213 |
| 127 | Ga0070699_100235755 | 3300005518 | Bacteria | 1632 |
| 128 | Ga0070684_100030673 | 3300005535 | Bacteria | 4570 |
| 129 | Ga0070684_100032221 | 3300005535 | Bacteria | 4466 |
| 130 | Ga0070697_100000266 | 3300005536 | Bacteria | 42492 |
| 131 | Ga0070697_100000701 | 3300005536 | Bacteria | 25059 |
| 132 | Ga0070697_100016981 | 3300005536 | Bacteria | 5722 |
| 133 | Ga0070697_100058991 | 3300005536 | Bacteria | 3123 |
| 134 | Ga0070697_100061663 | 3300005536 | Unclassified | 3059 |
| 135 | Ga0070697_100131111 | 3300005536 | Bacteria | 2102 |
| 136 | Ga0070697_100668358 | 3300005536 | Bacteria | 915 |
| 137 | Ga0068853_100341029 | 3300005539 | Bacteria | 1392 |
| 138 | Ga0070672_100661908 | 3300005543 | Bacteria | 912 |
| 139 | Ga0070686_100128055 | 3300005544 | Bacteria | 1752 |
| 140 | Ga0070686_100146117 | 3300005544 | Bacteria | 1651 |
| 141 | Ga0070695_100055008 | 3300005545 | Unclassified | 2564 |
| 142 | Ga0070695_100103496 | 3300005545 | Bacteria | 1921 |
| 143 | Ga0070695_100719205 | 3300005545 | Bacteria | 794 |
| 144 | Ga0070693_100099957 | 3300005547 | Bacteria | 1765 |
| 145 | Ga0070693_100192365 | 3300005547 | Unclassified | 1320 |
| 146 | Ga0070693_100293454 | 3300005547 | Unclassified | 1093 |
| 147 | Ga0070693_100777961 | 3300005547 | Unclassified | 707 |
| 148 | Ga0070665_100025297 | 3300005548 | Bacteria | 5981 |
| 149 | Ga0070665_100533677 | 3300005548 | Bacteria | 1185 |
| 150 | Ga0070704_100074126 | 3300005549 | Bacteria | 2482 |
| 151 | Ga0068855_100077184 | 3300005563 | Bacteria | 3864 |
| 152 | Ga0068855_100568963 | 3300005563 | Bacteria | 1225 |
| 153 | Ga0070664_100107745 | 3300005564 | Bacteria | 2429 |
| 154 | Ga0070664_100222428 | 3300005564 | Bacteria | 1689 |
| 155 | Ga0070664_100896424 | 3300005564 | Unclassified | 831 |
| 156 | Ga0068857_100002168 | 3300005577 | Bacteria | 15958 |
| 157 | Ga0068857_100044253 | 3300005577 | Bacteria | 3948 |
| 158 | Ga0068857_100099360 | 3300005577 | Bacteria | 2610 |
| 159 | Ga0068854_100093557 | 3300005578 | Bacteria | 2240 |
| 160 | Ga0068854_100302063 | 3300005578 | Unclassified | 1295 |
| 161 | Ga0068856_100018058 | 3300005614 | Bacteria | 6840 |
| 162 | Ga0068856_100021804 | 3300005614 | Bacteria | 6226 |
| 163 | Ga0068856_100044332 | 3300005614 | Bacteria | 4377 |
| 164 | Ga0068856_100064873 | 3300005614 | Bacteria | 3608 |
| 165 | Ga0068856_100104896 | 3300005614 | Bacteria | 2821 |
| 166 | Ga0068856_100211510 | 3300005614 | Bacteria | 1955 |
| 167 | Ga0068856_100256296 | 3300005614 | Bacteria | 1764 |
| 168 | Ga0068852_100011844 | 3300005616 | Bacteria | 6591 |
| 169 | Ga0068859_100021521 | 3300005617 | Bacteria | 6472 |
| 170 | Ga0068864_100073221 | 3300005618 | Bacteria | 2986 |
| 171 | Ga0068864_100163288 | 3300005618 | Bacteria | 2026 |
| 172 | Ga0068866_10020794 | 3300005718 | Unclassified | 3012 |
| 173 | Ga0068866_10109315 | 3300005718 | Unclassified | 1539 |
| 174 | Ga0068861_100042481 | 3300005719 | Bacteria | 3407 |
| 175 | Ga0068861_100428115 | 3300005719 | Bacteria | 1181 |
| 176 | Ga0068851_10007547 | 3300005834 | Bacteria | 4998 |
| 177 | Ga0068851_10311291 | 3300005834 | Unclassified | 907 |
| 178 | Ga0068870_10010814 | 3300005840 | Bacteria | 4207 |
| 179 | Ga0068863_100106501 | 3300005841 | Bacteria | 2668 |
| 180 | Ga0068863_100292337 | 3300005841 | Bacteria | 1579 |
| 181 | Ga0068858_100033597 | 3300005842 | Bacteria | 4758 |
| 182 | Ga0068858_100068255 | 3300005842 | Bacteria | 3294 |
| 183 | Ga0068858_101030596 | 3300005842 | Bacteria | 807 |
| 184 | Ga0068860_100051564 | 3300005843 | Bacteria | 3915 |
| 185 | Ga0068860_100098412 | 3300005843 | Bacteria | 2789 |
| 186 | Ga0068860_100192215 | 3300005843 | Bacteria | 1975 |
| 187 | Ga0068862_100010616 | 3300005844 | Bacteria | 7610 |
| 188 | Ga0068862_100237907 | 3300005844 | Bacteria | 1654 |
| 189 | Ga0070717_10001093 | 3300006028 | Bacteria | 18235 |
| 190 | Ga0070717_10001658 | 3300006028 | Bacteria | 15470 |
| 191 | Ga0070717_10012009 | 3300006028 | Bacteria | 6595 |
| 192 | Ga0070717_10031513 | 3300006028 | Bacteria | 4266 |
| 193 | Ga0070717_10046711 | 3300006028 | Bacteria | 3544 |
| 194 | Ga0070717_10051907 | 3300006028 | Bacteria | 3376 |
| 195 | Ga0070717_10054243 | 3300006028 | Bacteria | 3305 |
| 196 | Ga0070717_10072990 | 3300006028 | Bacteria | 2867 |
| 197 | Ga0070717_10155358 | 3300006028 | Bacteria | 1982 |
| 198 | Ga0070717_10303444 | 3300006028 | Bacteria | 1420 |
| 199 | Ga0070715_10026101 | 3300006163 | Bacteria | 2320 |
| 200 | Ga0070716_100012854 | 3300006173 | Bacteria | 4255 |
| 201 | Ga0070716_100029846 | 3300006173 | Bacteria | 2953 |
| 202 | Ga0070716_100043545 | 3300006173 | Bacteria | 2511 |
| 203 | Ga0070716_100060757 | 3300006173 | Bacteria | 2184 |
| 204 | Ga0070716_100096582 | 3300006173 | Bacteria | 1801 |
| 205 | Ga0070716_100123616 | 3300006173 | Bacteria | 1624 |
| 206 | Ga0070716_100125871 | 3300006173 | Bacteria | 1612 |
| 207 | Ga0070716_100240198 | 3300006173 | Unclassified | 1228 |
| 208 | Ga0070716_100428372 | 3300006173 | Bacteria | 959 |
| 209 | Ga0070712_100000130 | 3300006175 | Bacteria | 39526 |
| 210 | Ga0070712_100002208 | 3300006175 | Bacteria | 11974 |
| 211 | Ga0070712_100006015 | 3300006175 | Bacteria | 7508 |
| 212 | Ga0070712_100036544 | 3300006175 | Bacteria | 3343 |
| 213 | Ga0070712_100037951 | 3300006175 | Bacteria | 3287 |
| 214 | Ga0070712_100083096 | 3300006175 | Unclassified | 2324 |
| 215 | Ga0070712_100095851 | 3300006175 | Bacteria | 2184 |
| 216 | Ga0070712_100205780 | 3300006175 | Bacteria | 1549 |
| 217 | Ga0070712_100304398 | 3300006175 | Unclassified | 1291 |
| 218 | Ga0097621_100144143 | 3300006237 | Bacteria | 2038 |
| 219 | Ga0097621_100495087 | 3300006237 | Bacteria | 1106 |
| 220 | Ga0068871_100067623 | 3300006358 | Bacteria | 2932 |
| 221 | Ga0068871_100166672 | 3300006358 | Unclassified | 1886 |
| 222 | Ga0068871_100261319 | 3300006358 | Bacteria | 1510 |
| 223 | Ga0068871_100311734 | 3300006358 | Bacteria | 1383 |
| 224 | Ga0068871_100317771 | 3300006358 | Unclassified | 1370 |
| 225 | Ga0075433_10655289 | 3300006852 | Unclassified | 920 |
| 226 | Ga0068865_100115694 | 3300006881 | Bacteria | 1985 |
| 227 | Ga0075436_100001267 | 3300006914 | Bacteria | 17156 |
| 228 | Ga0097620_100021523 | 3300006931 | Bacteria | 6472 |
| 229 | Ga0075435_100010410 | 3300007076 | Bacteria | 6803 |
| 230 | Ga0099794_10011693 | 3300007265 | Bacteria | 3765 |
| 231 | Ga0099794_10302792 | 3300007265 | Unclassified | 828 |
| 232 | Ga0105250_10069541 | 3300009092 | Bacteria | 1421 |
| 233 | Ga0105240_10018684 | 3300009093 | Bacteria | 9288 |
| 234 | Ga0105240_10037791 | 3300009093 | Bacteria | 6202 |
| 235 | Ga0105240_10039687 | 3300009093 | Bacteria | 6026 |
| 236 | Ga0105240_10216890 | 3300009093 | Bacteria | 2232 |
| 237 | Ga0105240_10314497 | 3300009093 | Bacteria | 1787 |
| 238 | Ga0105240_10385045 | 3300009093 | Bacteria | 1583 |
| 239 | Ga0105240_10461079 | 3300009093 | Bacteria | 1420 |
| 240 | Ga0105245_10010421 | 3300009098 | Bacteria | 8095 |
| 241 | Ga0105245_10011580 | 3300009098 | Bacteria | 7685 |
| 242 | Ga0105245_10034309 | 3300009098 | Bacteria | 4500 |
| 243 | Ga0105245_10126039 | 3300009098 | Bacteria | 2397 |
| 244 | Ga0105245_10397236 | 3300009098 | Unclassified | 1377 |
| 245 | Ga0105245_10616474 | 3300009098 | Bacteria | 1113 |
| 246 | Ga0105247_10020036 | 3300009101 | Bacteria | 4021 |
| 247 | Ga0105247_10061130 | 3300009101 | Bacteria | 2335 |
| 248 | Ga0105247_10186684 | 3300009101 | Unclassified | 1386 |
| 249 | Ga0105241_10001638 | 3300009174 | Bacteria | 17067 |
| 250 | Ga0105241_10014378 | 3300009174 | Bacteria | 5796 |
| 251 | Ga0105241_10092985 | 3300009174 | Bacteria | 2382 |
| 252 | Ga0105241_10201452 | 3300009174 | Bacteria | 1663 |
| 253 | Ga0105242_10217703 | 3300009176 | Bacteria | 1705 |
| 254 | Ga0105248_10024998 | 3300009177 | Bacteria | 6639 |
| 255 | Ga0105248_10028234 | 3300009177 | Bacteria | 6250 |
| 256 | Ga0105248_10477857 | 3300009177 | Bacteria | 1405 |
| 257 | Ga0105237_10009832 | 3300009545 | Bacteria | 10228 |
| 258 | Ga0105237_10039971 | 3300009545 | Bacteria | 4732 |
| 259 | Ga0105237_10423771 | 3300009545 | Unclassified | 1336 |
| 260 | Ga0105237_10643054 | 3300009545 | Bacteria | 1067 |
| 261 | Ga0105238_10030176 | 3300009551 | Bacteria | 5518 |
| 262 | Ga0105238_10137889 | 3300009551 | Bacteria | 2417 |
| 263 | Ga0105238_10165197 | 3300009551 | Bacteria | 2189 |
| 264 | Ga0105238_11074347 | 3300009551 | Unclassified | 827 |
| 265 | Ga0105238_11329721 | 3300009551 | Unclassified | 745 |
| 266 | Ga0105249_10032205 | 3300009553 | Bacteria | 4742 |
| 267 | Ga0105249_10071939 | 3300009553 | Bacteria | 3196 |
| 268 | Ga0105249_10089823 | 3300009553 | Bacteria | 2871 |
| 269 | Ga0105246_10074648 | 3300011119 | Bacteria | 2398 |
| 270 | Ga0105246_10202787 | 3300011119 | Unclassified | 1543 |
| 271 | Ga0157373_10001299 | 3300013100 | Bacteria | 19063 |
| 272 | Ga0157373_10004687 | 3300013100 | Bacteria | 10283 |
| 273 | Ga0157373_10322939 | 3300013100 | Unclassified | 1098 |
| 274 | Ga0157373_10535255 | 3300013100 | Unclassified | 848 |
| 275 | Ga0157371_10008938 | 3300013102 | Bacteria | 7928 |
| 276 | Ga0157371_10014882 | 3300013102 | Bacteria | 5855 |
| 277 | Ga0157370_10016617 | 3300013104 | Bacteria | 7445 |
| 278 | Ga0157370_10314105 | 3300013104 | Bacteria | 1446 |
| 279 | Ga0157369_10031049 | 3300013105 | Bacteria | 5888 |
| 280 | Ga0157369_10046588 | 3300013105 | Bacteria | 4711 |
| 281 | Ga0157369_10060956 | 3300013105 | Bacteria | 4068 |
| 282 | Ga0157369_10201939 | 3300013105 | Unclassified | 2086 |
| 283 | Ga0157369_10323184 | 3300013105 | Unclassified | 1604 |
| 284 | Ga0157374_10013788 | 3300013296 | Bacteria | 7060 |
| 285 | Ga0157374_10030581 | 3300013296 | Bacteria | 4891 |
| 286 | Ga0157374_10038624 | 3300013296 | Bacteria | 4389 |
| 287 | Ga0157374_10062225 | 3300013296 | Bacteria | 3497 |
| 288 | Ga0157374_10291834 | 3300013296 | Bacteria | 1612 |
| 289 | Ga0157374_10403686 | 3300013296 | Bacteria | 1364 |
| 290 | Ga0157378_10435188 | 3300013297 | Bacteria | 1299 |
| 291 | Ga0157378_10983779 | 3300013297 | Bacteria | 877 |
| 292 | Ga0163162_10001531 | 3300013306 | Bacteria | 21558 |
| 293 | Ga0163162_10015654 | 3300013306 | Bacteria | 7412 |
| 294 | Ga0163162_10373372 | 3300013306 | Unclassified | 1559 |
| 295 | Ga0157372_10000825 | 3300013307 | Bacteria | 33540 |
| 296 | Ga0157372_10015799 | 3300013307 | Bacteria | 8098 |
| 297 | Ga0157372_10028645 | 3300013307 | Bacteria | 6081 |
| 298 | Ga0157372_10039702 | 3300013307 | Bacteria | 5196 |
| 299 | Ga0157372_10078707 | 3300013307 | Bacteria | 3726 |
| 300 | Ga0157375_10110076 | 3300013308 | Bacteria | 2851 |
| 301 | Ga0157375_10288099 | 3300013308 | Bacteria | 1805 |
| 302 | Ga0157375_12098690 | 3300013308 | Bacteria | 672 |
| 303 | Ga0163163_10010127 | 3300014325 | Bacteria | 8456 |
| 304 | Ga0163163_10040139 | 3300014325 | Bacteria | 4569 |
| 305 | Ga0163163_10112727 | 3300014325 | Bacteria | 2749 |
| 306 | Ga0163163_10116898 | 3300014325 | Unclassified | 2698 |
| 307 | Ga0163163_10152848 | 3300014325 | Bacteria | 2351 |
| 308 | Ga0163163_10300583 | 3300014325 | Bacteria | 1657 |
| 309 | Ga0163163_11031706 | 3300014325 | Bacteria | 886 |
| 310 | Ga0157377_10021473 | 3300014745 | Bacteria | 3396 |
| 311 | Ga0157379_10001261 | 3300014968 | Bacteria | 20577 |
| 312 | Ga0157379_10007858 | 3300014968 | Bacteria | 9240 |
| 313 | Ga0157379_10078446 | 3300014968 | Bacteria | 2958 |
| 314 | Ga0157379_10241143 | 3300014968 | Bacteria | 1640 |
| 315 | Ga0157376_10174796 | 3300014969 | Bacteria | 1958 |
| 316 | Ga0157376_10180233 | 3300014969 | Bacteria | 1930 |
| 317 | Ga0157376_10917042 | 3300014969 | Bacteria | 895 |
| 318 | Ga0157376_11717763 | 3300014969 | Unclassified | 663 |
| 319 | Ga0184601_104320 | 3300019183 | Bacteria | 848 |
| 320 | Ga0213874_10063999 | 3300021377 | Bacteria | 1158 |
| 321 | Ga0224570_100291 | 3300022730 | Bacteria | 3800 |
| 322 | Ga0224571_100317 | 3300022734 | Unclassified | 2520 |
| 323 | Ga0247553_100308 | 3300023672 | Bacteria | 1692 |
| 324 | Ga0224572_1000408 | 3300024225 | Bacteria | 4894 |
| 325 | Ga0224572_1004935 | 3300024225 | Bacteria | 2356 |
| 326 | Ga0228598_1000383 | 3300024227 | Bacteria | 8859 |
| 327 | Ga0228598_1002732 | 3300024227 | Bacteria | 3823 |
| 328 | Ga0228598_1020970 | 3300024227 | Unclassified | 1286 |
| 329 | Ga0207656_10024608 | 3300025321 | Bacteria | 2436 |
| 330 | Ga0207692_10006024 | 3300025898 | Bacteria | 4902 |
| 331 | Ga0207692_10025360 | 3300025898 | Unclassified | 2768 |
| 332 | Ga0207692_10037896 | 3300025898 | Bacteria | 2361 |
| 333 | Ga0207642_10030947 | 3300025899 | Bacteria | 2236 |
| 334 | Ga0207710_10101690 | 3300025900 | Bacteria | 1356 |
| 335 | Ga0207680_10324478 | 3300025903 | Unclassified | 1077 |
| 336 | Ga0207647_10015589 | 3300025904 | Bacteria | 5205 |
| 337 | Ga0207685_10069819 | 3300025905 | Bacteria | 1420 |
| 338 | Ga0207699_10000528 | 3300025906 | Bacteria | 18865 |
| 339 | Ga0207699_10003495 | 3300025906 | Bacteria | 7499 |
| 340 | Ga0207699_10004846 | 3300025906 | Bacteria | 6438 |
| 341 | Ga0207699_10012963 | 3300025906 | Bacteria | 4251 |
| 342 | Ga0207699_10170108 | 3300025906 | Unclassified | 1457 |
| 343 | Ga0207699_10246783 | 3300025906 | Bacteria | 1229 |
| 344 | Ga0207699_10301663 | 3300025906 | Bacteria | 1119 |
| 345 | Ga0207699_10452759 | 3300025906 | Bacteria | 921 |
| 346 | Ga0207699_10489048 | 3300025906 | Bacteria | 887 |
| 347 | Ga0207645_10004270 | 3300025907 | Bacteria | 10605 |
| 348 | Ga0207684_10000274 | 3300025910 | Bacteria | 76497 |
| 349 | Ga0207684_10003347 | 3300025910 | Bacteria | 15715 |
| 350 | Ga0207684_10019671 | 3300025910 | Bacteria | 5775 |
| 351 | Ga0207684_10096830 | 3300025910 | Bacteria | 2519 |
| 352 | Ga0207684_10145762 | 3300025910 | Unclassified | 2036 |
| 353 | Ga0207684_10207565 | 3300025910 | Bacteria | 1690 |
| 354 | Ga0207684_10517208 | 3300025910 | Bacteria | 1022 |
| 355 | Ga0207684_10723930 | 3300025910 | Unclassified | 844 |
| 356 | Ga0207654_10139287 | 3300025911 | Bacteria | 1545 |
| 357 | Ga0207654_10232786 | 3300025911 | Unclassified | 1228 |
| 358 | Ga0207707_10009709 | 3300025912 | Bacteria | 8348 |
| 359 | Ga0207707_10090077 | 3300025912 | Bacteria | 2681 |
| 360 | Ga0207707_10196174 | 3300025912 | Unclassified | 1761 |
| 361 | Ga0207695_10028405 | 3300025913 | Bacteria | 6204 |
| 362 | Ga0207695_10047537 | 3300025913 | Bacteria | 4540 |
| 363 | Ga0207695_10085345 | 3300025913 | Bacteria | 3186 |
| 364 | Ga0207695_10271179 | 3300025913 | Bacteria | 1592 |
| 365 | Ga0207671_10332065 | 3300025914 | Unclassified | 1204 |
| 366 | Ga0207671_10453384 | 3300025914 | Unclassified | 1022 |
| 367 | Ga0207693_10000013 | 3300025915 | Bacteria | 154365 |
| 368 | Ga0207693_10000143 | 3300025915 | Bacteria | 65412 |
| 369 | Ga0207693_10002309 | 3300025915 | Bacteria | 16587 |
| 370 | Ga0207693_10004457 | 3300025915 | Bacteria | 11831 |
| 371 | Ga0207693_10014717 | 3300025915 | Bacteria | 6285 |
| 372 | Ga0207693_10062201 | 3300025915 | Bacteria | 2925 |
| 373 | Ga0207693_10138156 | 3300025915 | Bacteria | 1916 |
| 374 | Ga0207693_10275187 | 3300025915 | Bacteria | 1319 |
| 375 | Ga0207693_10275488 | 3300025915 | Unclassified | 1318 |
| 376 | Ga0207663_10001881 | 3300025916 | Bacteria | 9929 |
| 377 | Ga0207663_10012032 | 3300025916 | Bacteria | 4665 |
| 378 | Ga0207663_10154117 | 3300025916 | Bacteria | 1615 |
| 379 | Ga0207663_10887446 | 3300025916 | Bacteria | 713 |
| 380 | Ga0207660_10639312 | 3300025917 | Unclassified | 867 |
| 381 | Ga0207657_10002502 | 3300025919 | Bacteria | 19880 |
| 382 | Ga0207649_10032077 | 3300025920 | Bacteria | 3128 |
| 383 | Ga0207652_10088156 | 3300025921 | Bacteria | 2722 |
| 384 | Ga0207646_10000240 | 3300025922 | Bacteria | 75609 |
| 385 | Ga0207646_10000341 | 3300025922 | Bacteria | 63056 |
| 386 | Ga0207646_10113350 | 3300025922 | Bacteria | 2434 |
| 387 | Ga0207646_10167820 | 3300025922 | Unclassified | 1982 |
| 388 | Ga0207646_10294921 | 3300025922 | Unclassified | 1465 |
| 389 | Ga0207646_10327932 | 3300025922 | Bacteria | 1383 |
| 390 | Ga0207646_10411798 | 3300025922 | Unclassified | 1221 |
| 391 | Ga0207646_10617367 | 3300025922 | Bacteria | 973 |
| 392 | Ga0207694_10088049 | 3300025924 | Bacteria | 2447 |
| 393 | Ga0207694_10391345 | 3300025924 | Unclassified | 1155 |
| 394 | Ga0207694_10576520 | 3300025924 | Unclassified | 945 |
| 395 | Ga0207650_10295167 | 3300025925 | Bacteria | 1322 |
| 396 | Ga0207687_10032008 | 3300025927 | Bacteria | 3559 |
| 397 | Ga0207687_10100734 | 3300025927 | Bacteria | 2125 |
| 398 | Ga0207700_10000337 | 3300025928 | Bacteria | 27629 |
| 399 | Ga0207700_10000346 | 3300025928 | Bacteria | 27177 |
| 400 | Ga0207700_10012848 | 3300025928 | Bacteria | 5418 |
| 401 | Ga0207700_10031073 | 3300025928 | Bacteria | 3790 |
| 402 | Ga0207700_10066360 | 3300025928 | Bacteria | 2758 |
| 403 | Ga0207700_10151549 | 3300025928 | Unclassified | 1916 |
| 404 | Ga0207700_10219183 | 3300025928 | Unclassified | 1612 |
| 405 | Ga0207700_10370578 | 3300025928 | Bacteria | 1250 |
| 406 | Ga0207700_10392450 | 3300025928 | Bacteria | 1215 |
| 407 | Ga0207700_10644168 | 3300025928 | Bacteria | 945 |
| 408 | Ga0207664_10000201 | 3300025929 | Bacteria | 44962 |
| 409 | Ga0207664_10013157 | 3300025929 | Bacteria | 5931 |
| 410 | Ga0207664_10082306 | 3300025929 | Bacteria | 2621 |
| 411 | Ga0207664_10089793 | 3300025929 | Bacteria | 2517 |
| 412 | Ga0207664_10305247 | 3300025929 | Bacteria | 1401 |
| 413 | Ga0207664_10373971 | 3300025929 | Bacteria | 1264 |
| 414 | Ga0207664_10392487 | 3300025929 | Bacteria | 1233 |
| 415 | Ga0207690_10080728 | 3300025932 | Bacteria | 2270 |
| 416 | Ga0207706_10001321 | 3300025933 | Bacteria | 24837 |
| 417 | Ga0207686_10770868 | 3300025934 | Bacteria | 769 |
| 418 | Ga0207709_10047224 | 3300025935 | Bacteria | 2616 |
| 419 | Ga0207669_10154973 | 3300025937 | Unclassified | 1610 |
| 420 | Ga0207665_10003598 | 3300025939 | Bacteria | 10348 |
| 421 | Ga0207665_10005780 | 3300025939 | Bacteria | 8227 |
| 422 | Ga0207665_10014974 | 3300025939 | Bacteria | 5094 |
| 423 | Ga0207665_10019820 | 3300025939 | Bacteria | 4420 |
| 424 | Ga0207665_10046599 | 3300025939 | Bacteria | 2904 |
| 425 | Ga0207665_10050393 | 3300025939 | Bacteria | 2800 |
| 426 | Ga0207665_10068696 | 3300025939 | Bacteria | 2415 |
| 427 | Ga0207665_10079100 | 3300025939 | Bacteria | 2260 |
| 428 | Ga0207665_10140700 | 3300025939 | Bacteria | 1720 |
| 429 | Ga0207665_10299628 | 3300025939 | Unclassified | 1201 |
| 430 | Ga0207711_10005468 | 3300025941 | Bacteria | 10741 |
| 431 | Ga0207711_10332417 | 3300025941 | Bacteria | 1405 |
| 432 | Ga0207689_10021360 | 3300025942 | Bacteria | 5444 |
| 433 | Ga0207689_10291861 | 3300025942 | Bacteria | 1351 |
| 434 | Ga0207689_10745622 | 3300025942 | Bacteria | 826 |
| 435 | Ga0207661_11523938 | 3300025944 | Bacteria | 612 |
| 436 | Ga0207679_10778907 | 3300025945 | Unclassified | 871 |
| 437 | Ga0207679_10822240 | 3300025945 | Unclassified | 848 |
| 438 | Ga0207667_10353783 | 3300025949 | Bacteria | 1498 |
| 439 | Ga0207667_10451906 | 3300025949 | Bacteria | 1305 |
| 440 | Ga0207640_10391143 | 3300025981 | Unclassified | 1129 |
| 441 | Ga0207640_11263669 | 3300025981 | Unclassified | 658 |
| 442 | Ga0207658_10169082 | 3300025986 | Unclassified | 1799 |
| 443 | Ga0207658_10625454 | 3300025986 | Unclassified | 969 |
| 444 | Ga0207677_10052606 | 3300026023 | Unclassified | 2767 |
| 445 | Ga0207677_10268477 | 3300026023 | Unclassified | 1394 |
| 446 | Ga0207639_10439738 | 3300026041 | Bacteria | 1182 |
| 447 | Ga0207678_10000277 | 3300026067 | Bacteria | 46368 |
| 448 | Ga0207702_10010133 | 3300026078 | Bacteria | 7892 |
| 449 | Ga0207702_10010742 | 3300026078 | Bacteria | 7646 |
| 450 | Ga0207702_10076477 | 3300026078 | Unclassified | 2894 |
| 451 | Ga0207702_10089073 | 3300026078 | Bacteria | 2698 |
| 452 | Ga0207702_10505245 | 3300026078 | Bacteria | 1179 |
| 453 | Ga0207641_10049231 | 3300026088 | Bacteria | 3560 |
| 454 | Ga0207641_10331212 | 3300026088 | Bacteria | 1446 |
| 455 | Ga0207641_10421987 | 3300026088 | Bacteria | 1284 |
| 456 | Ga0207648_10017311 | 3300026089 | Bacteria | 6563 |
| 457 | Ga0207676_10128670 | 3300026095 | Bacteria | 2149 |
| 458 | Ga0207674_10012162 | 3300026116 | Bacteria | 9635 |
| 459 | Ga0207674_10016566 | 3300026116 | Bacteria | 8062 |
| 460 | Ga0207674_10181249 | 3300026116 | Bacteria | 2058 |
| 461 | Ga0207675_100243973 | 3300026118 | Bacteria | 1736 |
| 462 | Ga0207683_10160969 | 3300026121 | Bacteria | 2029 |
| 463 | Ga0265356_1001162 | 3300028017 | Bacteria | 4045 |
| 464 | Ga0265356_1002472 | 3300028017 | Bacteria | 2477 |
| 465 | Ga0268266_10305898 | 3300028379 | Bacteria | 1484 |
| 466 | Ga0268265_10066561 | 3300028380 | Bacteria | 2785 |
| 467 | Ga0268264_10042134 | 3300028381 | Bacteria | 3778 |
| 468 | Ga0268264_10058821 | 3300028381 | Bacteria | 3219 |
| 469 | Ga0265326_10066592 | 3300028558 | Unclassified | 1018 |
| 470 | Ga0265338_10024720 | 3300028800 | Bacteria | 6126 |
| 471 | Ga0265338_10367482 | 3300028800 | Bacteria | 1031 |
| 472 | Ga0265762_1001174 | 3300030760 | Bacteria | 4743 |
| 473 | Ga0265767_100901 | 3300030836 | Unclassified | 1362 |
| 474 | Ga0265777_101754 | 3300030877 | Unclassified | 1198 |
| 475 | Ga0265765_1012605 | 3300030879 | Bacteria | 960 |
| 476 | Ga0265764_103767 | 3300030882 | Unclassified | 802 |
| 477 | Ga0265771_1011809 | 3300031010 | Unclassified | 659 |
| 478 | Ga0265760_10000817 | 3300031090 | Bacteria | 8977 |
| 479 | Ga0265760_10001979 | 3300031090 | Bacteria | 6017 |
| 480 | Ga0265760_10003825 | 3300031090 | Bacteria | 4364 |
| 481 | Ga0265760_10007880 | 3300031090 | Bacteria | 3043 |
| 482 | Ga0265760_10022950 | 3300031090 | Bacteria | 1810 |
| 483 | Ga0265760_10034347 | 3300031090 | Bacteria | 1500 |
| 484 | Ga0265330_10009005 | 3300031235 | Bacteria | 4764 |
| 485 | Ga0265340_10044209 | 3300031247 | Bacteria | 2180 |
| 486 | Ga0265340_10095583 | 3300031247 | Bacteria | 1385 |
| 487 | Ga0265339_10020315 | 3300031249 | Bacteria | 3883 |
| 488 | Ga0265339_10030436 | 3300031249 | Bacteria | 3056 |
| 489 | Ga0265339_10033158 | 3300031249 | Bacteria | 2910 |
| 490 | Ga0265339_10149990 | 3300031249 | Bacteria | 1180 |
| 491 | Ga0265316_10002054 | 3300031344 | Bacteria | 21202 |
| 492 | Ga0265316_10027901 | 3300031344 | Unclassified | 4667 |
| 493 | Ga0265316_10049817 | 3300031344 | Unclassified | 3297 |
| 494 | Ga0265314_10000348 | 3300031711 | Bacteria | 64175 |
| 495 | Ga0265314_10023827 | 3300031711 | Bacteria | 4655 |
| 496 | Ga0265314_10074163 | 3300031711 | Bacteria | 2267 |
| 497 | Ga0265314_10100093 | 3300031711 | Bacteria | 1865 |
| 498 | Ga0265342_10048686 | 3300031712 | Bacteria | 2540 |
| 499 | Ga0265342_10295034 | 3300031712 | Bacteria | 855 |
| 500 | Ga0316053_100216 | 3300032120 | Bacteria | 2278 |
| 501 | Ga0316212_1006664 | 3300033547 | Bacteria | 1671 |
| 502 | Ga0316212_1019356 | 3300033547 | Unclassified | 955 |
| 503 | Ga0373930_0047228 | 3300034816 | Unclassified | 931 |
| 504 | Ga0373926_0005377 | 3300035083 | Bacteria | 4218 |
| 505 | Ga0373926_0055670 | 3300035083 | Bacteria | 1434 |
| 506 | Ga0373926_0168743 | 3300035083 | Unclassified | 837 |
| 507 | Ga0373934_0038417 | 3300035086 | Bacteria | 1886 |
| 508 | Ga0373940_0014887 | 3300035088 | Bacteria | 1905 |
| 509 | Ga0373951_0025103 | 3300035091 | Unclassified | 1383 |
| 510 | Ga0373923_0008953 | 3300035111 | Bacteria | 3593 |
| 511 | Ga0373932_0015752 | 3300035112 | Bacteria | 1921 |
| 512 | Ga0373936_0000275 | 3300035113 | Bacteria | 17102 |
| 513 | Ga0373936_0018891 | 3300035113 | Bacteria | 2667 |
| 514 | Ga0373936_0032100 | 3300035113 | Bacteria | 2076 |
| 515 | Ga0373936_0107940 | 3300035113 | Bacteria | 1180 |
| 516 | Ga0373939_0004499 | 3300035114 | Bacteria | 3302 |
| 517 | Ga0373945_0053857 | 3300035116 | Unclassified | 1486 |
| 518 | Ga0373953_0057031 | 3300035117 | Bacteria | 1589 |
| 519 | Ga0373954_0029119 | 3300035118 | Bacteria | 2542 |
| 520 | Ga0373956_0035693 | 3300035119 | Bacteria | 2193 |
| 521 | Ga0373960_0007444 | 3300035121 | Unclassified | 2594 |
| 522 | Ga0373943_0000011 | 3300035170 | Bacteria | 64439 |
| 523 | Ga0373943_0018454 | 3300035170 | Unclassified | 3206 |
| 524 | Ga0373943_0052333 | 3300035170 | Bacteria | 2013 |
| 525 | Ga0373943_0135442 | 3300035170 | Bacteria | 1322 |
| 526 | Ga0373943_0136882 | 3300035170 | Bacteria | 1316 |
| 527 | Ga0373943_0237461 | 3300035170 | Bacteria | 1020 |
| 528 | Ga0373943_0274154 | 3300035170 | Bacteria | 952 |
| 529 | Ga0373946_0004868 | 3300035171 | Bacteria | 4834 |
| 530 | Ga0373955_0419814 | 3300035172 | Unclassified | 813 |
| 531 | Ga0373942_0077346 | 3300035207 | Bacteria | 982 |
| 532 | Ga0373924_0015151 | 3300035410 | Bacteria | 2925 |
| 533 | Ga0373924_0082057 | 3300035410 | Unclassified | 1372 |
| 534 | Ga0373924_0085550 | 3300035410 | Bacteria | 1345 |
| 535 | Ga0373931_0008821 | 3300035691 | Bacteria | 4798 |
| 536 | Ga0373931_0444078 | 3300035691 | Bacteria | 828 |
| 537 | Ga0373935_0001861 | 3300035692 | Bacteria | 11832 |
| 538 | Ga0373935_0002744 | 3300035692 | Bacteria | 10136 |
| 539 | Ga0373935_0064889 | 3300035692 | Bacteria | 2342 |
| 540 | Ga0373935_0438278 | 3300035692 | Bacteria | 942 |
| 541 | Ga0373927_0000604 | 3300035695 | Bacteria | 27351 |
| 542 | Ga0373927_0003800 | 3300035695 | Bacteria | 10715 |
| 543 | Ga0373927_0080802 | 3300035695 | Bacteria | 2106 |
| 544 | Ga0373927_0199084 | 3300035695 | Unclassified | 1315 |
| 545 | Ga0373927_0279037 | 3300035695 | Bacteria | 1099 |
| 546 | Ga0373933_0021828 | 3300035724 | Bacteria | 3642 |
| 547 | Ga0373933_0050277 | 3300035724 | Bacteria | 2488 |
| 548 | Ga0373933_0200177 | 3300035724 | Unclassified | 1278 |
| 549 | Ga0373947_0000784 | 3300035725 | Bacteria | 19102 |
| 550 | Ga0373947_0010631 | 3300035725 | Bacteria | 5280 |
| 551 | Ga0373947_0048835 | 3300035725 | Bacteria | 2540 |
| 552 | Ga0373937_0096584 | 3300036401 | Bacteria | 2741 |
| 553 | Ga0373937_0114777 | 3300036401 | Bacteria | 2507 |
| 554 | Ga0373937_0373907 | 3300036401 | Bacteria | 1351 |
| 555 | Ga0373937_0489643 | 3300036401 | Unclassified | 1168 |
| 556 | Ga0265778_004477 | 3300036457 | Unclassified | 1447 |
| 557 | Ga0373925_0001438 | 3300037068 | Bacteria | 20628 |
| 558 | Ga0373925_0006773 | 3300037068 | Bacteria | 8398 |
| 559 | Ga0373925_0009721 | 3300037068 | Bacteria | 6992 |
| 560 | Ga0373925_0010976 | 3300037068 | Bacteria | 6576 |
| 561 | Ga0373925_0012397 | 3300037068 | Bacteria | 6172 |
| 562 | Ga0373925_0026046 | 3300037068 | Bacteria | 4276 |
| 563 | Ga0373925_0081841 | 3300037068 | Unclassified | 2456 |
| 564 | Ga0373925_0305927 | 3300037068 | Unclassified | 1284 |
| 565 | Ga0373925_0328263 | 3300037068 | Bacteria | 1239 |
| 566 | Ga0373925_0358106 | 3300037068 | Unclassified | 1186 |
| 567 | Ga0395900_1237968 | 3300037418 | Unclassified | 661 |
| 568 | Ga0436360_0358964 | 3300039438 | Bacteria | 1147 |
| 569 | Ga0436363_0451864 | 3300039450 | Unclassified | 2065 |
| 570 | Ga0451839_1277567 | 3300041496 | Bacteria | 734 |
| 571 | Ga0451577_0000241 | 3300042876 | Bacteria | 108191 |
| 572 | Ga0451577_0677628 | 3300042876 | Bacteria | 935 |
| 573 | Ga0451577_0984051 | 3300042876 | Unclassified | 758 |
| 574 | Ga0466963_0085737 | 3300044694 | Unclassified | 2139 |
| 575 | Ga0466964_0033709 | 3300044706 | Bacteria | 2041 |
| 576 | Ga0453684_0000366 | 3300044712 | Bacteria | 186117 |
| 577 | Ga0453684_0738228 | 3300044712 | Bacteria | 1067 |
| 578 | Ga0453684_1510077 | 3300044712 | Bacteria | 693 |
| 579 | Ga0466959_0320400 | 3300045049 | Unclassified | 1060 |
| 580 | Ga0451576_0005686 | 3300045051 | Bacteria | 15558 |
| 581 | Ga0451576_0252655 | 3300045051 | Unclassified | 1843 |
| 582 | Ga0451576_0641173 | 3300045051 | Bacteria | 1116 |
| 583 | Ga0466967_0028583 | 3300045976 | Bacteria | 4657 |
| 584 | Ga0466967_0028774 | 3300045976 | Bacteria | 4644 |
| 585 | Ga0466967_0086055 | 3300045976 | Bacteria | 2847 |
| 586 | Ga0495590_0025074 | 3300046457 | Bacteria | 2098 |
| 587 | Ga0495653_0083918 | 3300046463 | Bacteria | 2348 |
| 588 | Ga0495580_0001182 | 3300046472 | Bacteria | 22952 |
| 589 | Ga0495580_0005708 | 3300046472 | Bacteria | 10237 |
| 590 | Ga0495580_0008969 | 3300046472 | Bacteria | 7902 |
| 591 | Ga0495580_0023555 | 3300046472 | Bacteria | 4519 |
| 592 | Ga0495580_0029919 | 3300046472 | Bacteria | 3948 |
| 593 | Ga0495580_0069661 | 3300046472 | Bacteria | 2457 |
| 594 | Ga0495580_0263134 | 3300046472 | Unclassified | 1179 |
| 595 | Ga0495580_0305002 | 3300046472 | Bacteria | 1084 |
| 596 | Ga0495582_0001573 | 3300046473 | Bacteria | 12875 |
| 597 | Ga0495582_0014062 | 3300046473 | Bacteria | 4405 |
| 598 | Ga0495582_0230587 | 3300046473 | Bacteria | 1060 |
| 599 | Ga0495582_0373567 | 3300046473 | Bacteria | 821 |
| 600 | Ga0495664_0081079 | 3300046477 | Bacteria | 1945 |
| 601 | Ga0495664_0220452 | 3300046477 | Bacteria | 1148 |
| 602 | Ga0495608_0268191 | 3300046511 | Bacteria | 1062 |
| 603 | Ga0495608_0494284 | 3300046511 | Bacteria | 741 |
| 604 | Ga0495630_0122804 | 3300046517 | Bacteria | 1970 |
| 605 | Ga0495630_0273204 | 3300046517 | Bacteria | 1291 |
| 606 | Ga0495666_0021858 | 3300046526 | Bacteria | 3167 |
| 607 | Ga0495666_0151103 | 3300046526 | Bacteria | 1080 |
| 608 | Ga0495665_0011363 | 3300046531 | Bacteria | 4819 |
| 609 | Ga0495665_0026731 | 3300046531 | Bacteria | 3099 |
| 610 | Ga0495665_0148579 | 3300046531 | Bacteria | 1224 |
| 611 | Ga0495665_0332171 | 3300046531 | Bacteria | 775 |
| 612 | Ga0495640_0064350 | 3300046533 | Bacteria | 2480 |
| 613 | Ga0495645_0264922 | 3300046543 | Unclassified | 1136 |
| 614 | Ga0495645_0405866 | 3300046543 | Unclassified | 867 |
| 615 | Ga0495667_0170990 | 3300046559 | Bacteria | 1396 |
| 616 | Ga0495635_0029277 | 3300046663 | Bacteria | 3829 |
| 617 | Ga0495657_0142812 | 3300046675 | Bacteria | 1491 |
| 618 | Ga0495657_0287746 | 3300046675 | Bacteria | 982 |
| 619 | Ga0495599_0184764 | 3300046678 | Bacteria | 1284 |
| 620 | Ga0495658_0069689 | 3300046683 | Bacteria | 2039 |
| 621 | Ga0495658_0303379 | 3300046683 | Bacteria | 1010 |
| 622 | Ga0495669_0002318 | 3300046684 | Bacteria | 7799 |
| 623 | Ga0495669_0029992 | 3300046684 | Bacteria | 2387 |
| 624 | Ga0495581_0023298 | 3300047315 | Unclassified | 3588 |
| 625 | Ga0495581_0088528 | 3300047315 | Bacteria | 1795 |
| 626 | Ga0495604_0178863 | 3300047317 | Bacteria | 1485 |
| 627 | Ga0495674_0010911 | 3300047319 | Bacteria | 8588 |
| 628 | Ga0495674_0020609 | 3300047319 | Bacteria | 6103 |
| 629 | Ga0495674_0196723 | 3300047319 | Bacteria | 1674 |
| 630 | Ga0495674_0234772 | 3300047319 | Bacteria | 1513 |
| 631 | Ga0495674_0343071 | 3300047319 | Unclassified | 1214 |
| 632 | Ga0495674_0680826 | 3300047319 | Unclassified | 809 |
| 633 | Ga0495680_0357459 | 3300047322 | Bacteria | 1016 |
| 634 | Ga0495675_0247434 | 3300047444 | Unclassified | 1072 |
| 635 | Ga0495677_0093393 | 3300047445 | Bacteria | 1135 |
| 636 | Ga0495593_0208859 | 3300047673 | Unclassified | 980 |
| 637 | Ga0495602_0156508 | 3300048088 | Bacteria | 1784 |
| 638 | Ga0495602_0175584 | 3300048088 | Bacteria | 1658 |
| 639 | Ga0495602_0213169 | 3300048088 | Bacteria | 1464 |
| 640 | Ga0495602_0270263 | 3300048088 | Unclassified | 1257 |
| 641 | Ga0495614_0315796 | 3300048089 | Unclassified | 724 |
| 642 | Ga0496100_0060824 | 3300048903 | Bacteria | 2487 |
| 643 | Ga0496101_0052231 | 3300048904 | Bacteria | 2947 |
| 644 | Ga0496101_0318450 | 3300048904 | Bacteria | 1220 |
| 645 | Ga0496102_0005937 | 3300048905 | Bacteria | 10396 |
| 646 | Ga0496102_0052945 | 3300048905 | Bacteria | 3699 |
| 647 | Ga0496102_0363101 | 3300048905 | Unclassified | 1363 |
| 648 | Ga0496103_0008297 | 3300048906 | Bacteria | 6168 |
| 649 | Ga0496104_0153745 | 3300048907 | Bacteria | 2208 |
| 650 | Ga0496104_0308672 | 3300048907 | Bacteria | 1495 |
| 651 | Ga0496105_0211209 | 3300048908 | Unclassified | 1582 |
| 652 | Ga0496105_0247897 | 3300048908 | Bacteria | 1443 |
| 653 | Ga0496105_0647316 | 3300048908 | Unclassified | 816 |
| 654 | Ga0496105_0649248 | 3300048908 | Bacteria | 814 |
| 655 | Ga0496106_0247080 | 3300048909 | Bacteria | 1426 |
| 656 | Ga0496106_0571434 | 3300048909 | Unclassified | 907 |
| 657 | Ga0496107_0042844 | 3300048910 | Bacteria | 3252 |
| 658 | Ga0496107_0361623 | 3300048910 | Bacteria | 1080 |
| 659 | Ga0496107_0599157 | 3300048910 | Bacteria | 814 |
| 660 | Ga0496108_0124534 | 3300048911 | Bacteria | 2212 |
| 661 | Ga0496108_0355645 | 3300048911 | Unclassified | 1278 |
| 662 | Ga0496108_0391978 | 3300048911 | Bacteria | 1213 |
| 663 | Ga0496109_0335280 | 3300048912 | Unclassified | 1428 |
| 664 | Ga0496110_0552566 | 3300048913 | Bacteria | 1046 |
| 665 | Ga0496110_1112353 | 3300048913 | Bacteria | 698 |
| 666 | Ga0496112_0011087 | 3300048915 | Bacteria | 8215 |
| 667 | Ga0496112_0058500 | 3300048915 | Bacteria | 3796 |
| 668 | Ga0496112_0089568 | 3300048915 | Bacteria | 3045 |
| 669 | Ga0496112_0094726 | 3300048915 | Bacteria | 2956 |
| 670 | Ga0496112_0437180 | 3300048915 | Bacteria | 1246 |
| 671 | Ga0496112_0619466 | 3300048915 | Unclassified | 1013 |
| 672 | Ga0496113_0015649 | 3300048916 | Bacteria | 5223 |
| 673 | Ga0496113_0504423 | 3300048916 | Unclassified | 971 |
| 674 | Ga0496114_0056576 | 3300048917 | Bacteria | 3274 |
| 675 | Ga0496114_0059045 | 3300048917 | Bacteria | 3204 |
| 676 | Ga0496115_0017969 | 3300048918 | Bacteria | 5418 |
| 677 | Ga0496115_0635984 | 3300048918 | Bacteria | 845 |
| 678 | Ga0496115_0968686 | 3300048918 | Bacteria | 652 |
| 679 | Ga0501083_0026123 | 3300049744 | Bacteria | 4040 |
| 680 | Ga0501083_0085897 | 3300049744 | Bacteria | 2081 |
| 681 | nmdc:mga0n895_224433_c1 | 3300050512 | Unclassified | 1907 |
| 682 | nmdc:mga0rr50_45157_c1 | 3300050513 | Bacteria | 3236 |
| 683 | nmdc:mga08x19_1063_c1 | 3300050514 | Bacteria | 17156 |
| 684 | nmdc:mga0a205_617208_c1 | 3300050515 | Unclassified | 937 |
| 685 | Ga0495601_0131310 | 3300053077 | Bacteria | 1631 |
| 686 | Ga0070708_100334466 | |||
| 687 | LJNas_1000260 | |||
| 688 | JGI24752J21851_1003237 | |||
| 689 | JGI24737J22298_10112947 | |||
| 690 | JGI24749J21850_1009599 | |||
| 691 | JGI24751J29686_10000764 | |||
| 692 | Ga0065712_10304804 | |||
| 693 | Ga0065715_10134981 | |||
| 694 | Ga0065715_10158482 | |||
| 695 | Ga0070658_10754492 | |||
| 696 | Ga0070676_10046894 | |||
| 697 | Ga0070683_100005649 | |||
| 698 | Ga0070683_100407720 | |||
| 699 | Ga0070690_100061327 | |||
| 700 | Ga0070690_100272973 | |||
| 701 | Ga0070670_100194552 | |||
| 702 | Ga0070670_100338078 | |||
| 703 | Ga0070670_100380499 | |||
| 704 | Ga0070677_10239818 | |||
| 705 | Ga0068869_100074119 | |||
| 706 | Ga0068869_100624253 | |||
| 707 | Ga0068869_100689783 | |||
| 708 | Ga0070680_100506119 | |||
| 709 | Ga0068868_100004556 | |||
| 710 | Ga0068868_100096044 | |||
| 711 | Ga0068868_100355108 | |||
| 712 | Ga0068868_100743530 | |||
| 713 | Ga0070660_100067840 | |||
| 714 | Ga0070660_100151726 | |||
| 715 | Ga0070689_100010090 | |||
| 716 | Ga0070689_100063235 | |||
| 717 | Ga0070687_100317222 | |||
| 718 | Ga0070661_100012749 | |||
| 719 | Ga0070661_100057378 | |||
| 720 | Ga0070692_10472005 | |||
| 721 | Ga0070668_100005025 | |||
| 722 | Ga0070668_100418056 | |||
| 723 | Ga0070669_100511106 | |||
| 724 | Ga0070669_100651046 | |||
| 725 | Ga0070675_100059776 | |||
| 726 | Ga0070675_100130904 | |||
| 727 | Ga0070675_100584183 | |||
| 728 | Ga0070675_100666770 | |||
| 729 | Ga0070674_100220028 | |||
| 730 | Ga0070688_100187917 | |||
| 731 | Ga0070659_100004220 | |||
| 732 | Ga0070667_100011429 | |||
| 733 | Ga0070667_100073367 | |||
| 734 | Ga0070667_100730903 | |||
| 735 | Ga0070709_10007118 | |||
| 736 | Ga0070709_10010494 | |||
| 737 | Ga0070709_10010869 | |||
| 738 | Ga0070709_10046772 | |||
| 739 | Ga0070709_10049158 | |||
| 740 | Ga0070709_10100077 | |||
| 741 | Ga0070709_10455055 | |||
| 742 | Ga0070714_100000046 | |||
| 743 | Ga0070714_100002862 | |||
| 744 | Ga0070714_100010217 | |||
| 745 | Ga0070714_100059470 | |||
| 746 | Ga0070714_100746881 | |||
| 747 | Ga0070713_100000057 | |||
| 748 | Ga0070713_100000583 | |||
| 749 | Ga0070713_100003196 | |||
| 750 | Ga0070713_100024512 | |||
| 751 | Ga0070713_100025850 | |||
| 752 | Ga0070713_100047430 | |||
| 753 | Ga0070713_100152369 | |||
| 754 | Ga0070713_100155028 | |||
| 755 | Ga0070713_100332154 | |||
| 756 | Ga0070713_100415804 | |||
| 757 | Ga0070713_100715086 | |||
| 758 | Ga0070713_101351123 | |||
| 759 | Ga0070713_101401111 | |||
| 760 | Ga0070710_10004463 | |||
| 761 | Ga0070710_10033046 | |||
| 762 | Ga0070710_10209085 | |||
| 763 | Ga0070711_100007062 | |||
| 764 | Ga0070711_100021372 | |||
| 765 | Ga0070711_100203206 | |||
| 766 | Ga0070711_100273015 | |||
| 767 | Ga0070711_100449068 | |||
| 768 | Ga0070705_100125960 | |||
| 769 | Ga0070705_100287051 | |||
| 770 | Ga0070694_100091865 | |||
| 771 | Ga0070708_100000437 | |||
| 772 | Ga0070708_100015048 | |||
| 773 | Ga0070708_100018463 | |||
| 774 | Ga0070708_100033060 | |||
| 775 | Ga0070708_100055671 | |||
| 776 | Ga0070708_100062121 | |||
| 777 | Ga0070708_100070749 | |||
| 778 | Ga0070708_100162121 | |||
| 779 | Ga0070708_100174578 | |||
| 780 | Ga0070708_100333521 | |||
| 781 | Ga0070663_100021022 | |||
| 782 | Ga0070663_100257779 | |||
| 783 | Ga0070678_100074534 | |||
| 784 | Ga0070662_100128251 | |||
| 785 | Ga0070662_100130123 | |||
| 786 | Ga0070681_10006550 | |||
| 787 | Ga0070681_10369159 | |||
| 788 | Ga0068867_100053866 | |||
| 789 | Ga0070706_100000935 | |||
| 790 | Ga0070706_100003883 | |||
| 791 | Ga0070706_100006968 | |||
| 792 | Ga0070706_100064219 | |||
| 793 | Ga0070706_100261281 | |||
| 794 | Ga0070706_100577490 | |||
| 795 | Ga0070706_100701326 | |||
| 796 | Ga0070706_101016775 | |||
| 797 | Ga0070707_100001244 | |||
| 798 | Ga0070707_100002157 | |||
| 799 | Ga0070707_100003649 | |||
| 800 | Ga0070707_100030458 | |||
| 801 | Ga0070707_100220881 | |||
| 802 | Ga0070707_100395934 | |||
| 803 | Ga0070698_100001005 | |||
| 804 | Ga0070698_100002044 | |||
| 805 | Ga0070698_100126852 | |||
| 806 | Ga0070698_100159775 | |||
| 807 | Ga0070698_101022260 | |||
| 808 | Ga0070699_100001100 | |||
| 809 | Ga0070699_100002908 | |||
| 810 | Ga0070699_100033580 | |||
| 811 | Ga0070699_100037176 | |||
| 812 | Ga0070699_100235755 | |||
| 813 | Ga0070684_100030673 | |||
| 814 | Ga0070684_100032221 | |||
| 815 | Ga0070697_100000266 | |||
| 816 | Ga0070697_100000701 | |||
| 817 | Ga0070697_100016981 | |||
| 818 | Ga0070697_100058991 | |||
| 819 | Ga0070697_100061663 | |||
| 820 | Ga0070697_100131111 | |||
| 821 | Ga0070697_100668358 | |||
| 822 | Ga0068853_100341029 | |||
| 823 | Ga0070672_100661908 | |||
| 824 | Ga0070686_100128055 | |||
| 825 | Ga0070686_100146117 | |||
| 826 | Ga0070695_100055008 | |||
| 827 | Ga0070695_100103496 | |||
| 828 | Ga0070695_100719205 | |||
| 829 | Ga0070693_100099957 | |||
| 830 | Ga0070693_100192365 | |||
| 831 | Ga0070693_100293454 | |||
| 832 | Ga0070693_100777961 | |||
| 833 | Ga0070665_100025297 | |||
| 834 | Ga0070665_100533677 | |||
| 835 | Ga0070704_100074126 | |||
| 836 | Ga0068855_100077184 | |||
| 837 | Ga0068855_100568963 | |||
| 838 | Ga0070664_100107745 | |||
| 839 | Ga0070664_100222428 | |||
| 840 | Ga0070664_100896424 | |||
| 841 | Ga0068857_100002168 | |||
| 842 | Ga0068857_100044253 | |||
| 843 | Ga0068857_100099360 | |||
| 844 | Ga0068854_100093557 | |||
| 845 | Ga0068854_100302063 | |||
| 846 | Ga0068856_100018058 | |||
| 847 | Ga0068856_100021804 | |||
| 848 | Ga0068856_100044332 | |||
| 849 | Ga0068856_100064873 | |||
| 850 | Ga0068856_100104896 | |||
| 851 | Ga0068856_100211510 | |||
| 852 | Ga0068856_100256296 | |||
| 853 | Ga0068852_100011844 | |||
| 854 | Ga0068859_100021521 | |||
| 855 | Ga0068864_100073221 | |||
| 856 | Ga0068864_100163288 | |||
| 857 | Ga0068866_10020794 | |||
| 858 | Ga0068866_10109315 | |||
| 859 | Ga0068861_100042481 | |||
| 860 | Ga0068861_100428115 | |||
| 861 | Ga0068851_10007547 | |||
| 862 | Ga0068851_10311291 | |||
| 863 | Ga0068870_10010814 | |||
| 864 | Ga0068863_100106501 | |||
| 865 | Ga0068863_100292337 | |||
| 866 | Ga0068858_100033597 | |||
| 867 | Ga0068858_100068255 | |||
| 868 | Ga0068858_101030596 | |||
| 869 | Ga0068860_100051564 | |||
| 870 | Ga0068860_100098412 | |||
| 871 | Ga0068860_100192215 | |||
| 872 | Ga0068862_100010616 | |||
| 873 | Ga0068862_100237907 | |||
| 874 | Ga0070717_10001093 | |||
| 875 | Ga0070717_10001658 | |||
| 876 | Ga0070717_10012009 | |||
| 877 | Ga0070717_10031513 | |||
| 878 | Ga0070717_10046711 | |||
| 879 | Ga0070717_10051907 | |||
| 880 | Ga0070717_10054243 | |||
| 881 | Ga0070717_10072990 | |||
| 882 | Ga0070717_10155358 | |||
| 883 | Ga0070717_10303444 | |||
| 884 | Ga0070715_10026101 | |||
| 885 | Ga0070716_100012854 | |||
| 886 | Ga0070716_100029846 | |||
| 887 | Ga0070716_100043545 | |||
| 888 | Ga0070716_100060757 | |||
| 889 | Ga0070716_100096582 | |||
| 890 | Ga0070716_100123616 | |||
| 891 | Ga0070716_100125871 | |||
| 892 | Ga0070716_100240198 | |||
| 893 | Ga0070716_100428372 | |||
| 894 | Ga0070712_100000130 | |||
| 895 | Ga0070712_100002208 | |||
| 896 | Ga0070712_100006015 | |||
| 897 | Ga0070712_100036544 | |||
| 898 | Ga0070712_100037951 | |||
| 899 | Ga0070712_100083096 | |||
| 900 | Ga0070712_100095851 | |||
| 901 | Ga0070712_100205780 | |||
| 902 | Ga0070712_100304398 | |||
| 903 | Ga0097621_100144143 | |||
| 904 | Ga0097621_100495087 | |||
| 905 | Ga0068871_100067623 | |||
| 906 | Ga0068871_100166672 | |||
| 907 | Ga0068871_100261319 | |||
| 908 | Ga0068871_100311734 | |||
| 909 | Ga0068871_100317771 | |||
| 910 | Ga0075433_10655289 | |||
| 911 | Ga0068865_100115694 | |||
| 912 | Ga0075436_100001267 | |||
| 913 | Ga0097620_100021523 | |||
| 914 | Ga0075435_100010410 | |||
| 915 | Ga0099794_10011693 | |||
| 916 | Ga0099794_10302792 | |||
| 917 | Ga0105250_10069541 | |||
| 918 | Ga0105240_10018684 | |||
| 919 | Ga0105240_10037791 | |||
| 920 | Ga0105240_10039687 | |||
| 921 | Ga0105240_10216890 | |||
| 922 | Ga0105240_10314497 | |||
| 923 | Ga0105240_10385045 | |||
| 924 | Ga0105240_10461079 | |||
| 925 | Ga0105245_10010421 | |||
| 926 | Ga0105245_10011580 | |||
| 927 | Ga0105245_10034309 | |||
| 928 | Ga0105245_10126039 | |||
| 929 | Ga0105245_10397236 | |||
| 930 | Ga0105245_10616474 | |||
| 931 | Ga0105247_10020036 | |||
| 932 | Ga0105247_10061130 | |||
| 933 | Ga0105247_10186684 | |||
| 934 | Ga0105241_10001638 | |||
| 935 | Ga0105241_10014378 | |||
| 936 | Ga0105241_10092985 | |||
| 937 | Ga0105241_10201452 | |||
| 938 | Ga0105242_10217703 | |||
| 939 | Ga0105248_10024998 | |||
| 940 | Ga0105248_10028234 | |||
| 941 | Ga0105248_10477857 | |||
| 942 | Ga0105237_10009832 | |||
| 943 | Ga0105237_10039971 | |||
| 944 | Ga0105237_10423771 | |||
| 945 | Ga0105237_10643054 | |||
| 946 | Ga0105238_10030176 | |||
| 947 | Ga0105238_10137889 | |||
| 948 | Ga0105238_10165197 | |||
| 949 | Ga0105238_11074347 | |||
| 950 | Ga0105238_11329721 | |||
| 951 | Ga0105249_10032205 | |||
| 952 | Ga0105249_10071939 | |||
| 953 | Ga0105249_10089823 | |||
| 954 | Ga0105246_10074648 | |||
| 955 | Ga0105246_10202787 | |||
| 956 | Ga0157373_10001299 | |||
| 957 | Ga0157373_10004687 | |||
| 958 | Ga0157373_10322939 | |||
| 959 | Ga0157373_10535255 | |||
| 960 | Ga0157371_10008938 | |||
| 961 | Ga0157371_10014882 | |||
| 962 | Ga0157370_10016617 | |||
| 963 | Ga0157370_10314105 | |||
| 964 | Ga0157369_10031049 | |||
| 965 | Ga0157369_10046588 | |||
| 966 | Ga0157369_10060956 | |||
| 967 | Ga0157369_10201939 | |||
| 968 | Ga0157369_10323184 | |||
| 969 | Ga0157374_10013788 | |||
| 970 | Ga0157374_10030581 | |||
| 971 | Ga0157374_10038624 | |||
| 972 | Ga0157374_10062225 | |||
| 973 | Ga0157374_10291834 | |||
| 974 | Ga0157374_10403686 | |||
| 975 | Ga0157378_10435188 | |||
| 976 | Ga0157378_10983779 | |||
| 977 | Ga0163162_10001531 | |||
| 978 | Ga0163162_10015654 | |||
| 979 | Ga0163162_10373372 | |||
| 980 | Ga0157372_10000825 | |||
| 981 | Ga0157372_10015799 | |||
| 982 | Ga0157372_10028645 | |||
| 983 | Ga0157372_10039702 | |||
| 984 | Ga0157372_10078707 | |||
| 985 | Ga0157375_10110076 | |||
| 986 | Ga0157375_10288099 | |||
| 987 | Ga0157375_12098690 | |||
| 988 | Ga0163163_10010127 | |||
| 989 | Ga0163163_10040139 | |||
| 990 | Ga0163163_10112727 | |||
| 991 | Ga0163163_10116898 | |||
| 992 | Ga0163163_10152848 | |||
| 993 | Ga0163163_10300583 | |||
| 994 | Ga0163163_11031706 | |||
| 995 | Ga0157377_10021473 | |||
| 996 | Ga0157379_10001261 | |||
| 997 | Ga0157379_10007858 | |||
| 998 | Ga0157379_10078446 | |||
| 999 | Ga0157379_10241143 | |||
| 1000 | Ga0157376_10174796 | |||
| 1001 | Ga0157376_10180233 | |||
| 1002 | Ga0157376_10917042 | |||
| 1003 | Ga0157376_11717763 | |||
| 1004 | Ga0184601_104320 | |||
| 1005 | Ga0213874_10063999 | |||
| 1006 | Ga0224570_100291 | |||
| 1007 | Ga0224571_100317 | |||
| 1008 | Ga0247553_100308 | |||
| 1009 | Ga0224572_1000408 | |||
| 1010 | Ga0224572_1004935 | |||
| 1011 | Ga0228598_1000383 | |||
| 1012 | Ga0228598_1002732 | |||
| 1013 | Ga0228598_1020970 | |||
| 1014 | Ga0207656_10024608 | |||
| 1015 | Ga0207692_10006024 | |||
| 1016 | Ga0207692_10025360 | |||
| 1017 | Ga0207692_10037896 | |||
| 1018 | Ga0207642_10030947 | |||
| 1019 | Ga0207710_10101690 | |||
| 1020 | Ga0207680_10324478 | |||
| 1021 | Ga0207647_10015589 | |||
| 1022 | Ga0207685_10069819 | |||
| 1023 | Ga0207699_10000528 | |||
| 1024 | Ga0207699_10003495 | |||
| 1025 | Ga0207699_10004846 | |||
| 1026 | Ga0207699_10012963 | |||
| 1027 | Ga0207699_10170108 | |||
| 1028 | Ga0207699_10246783 | |||
| 1029 | Ga0207699_10301663 | |||
| 1030 | Ga0207699_10452759 | |||
| 1031 | Ga0207699_10489048 | |||
| 1032 | Ga0207645_10004270 | |||
| 1033 | Ga0207684_10000274 | |||
| 1034 | Ga0207684_10003347 | |||
| 1035 | Ga0207684_10019671 | |||
| 1036 | Ga0207684_10096830 | |||
| 1037 | Ga0207684_10145762 | |||
| 1038 | Ga0207684_10207565 | |||
| 1039 | Ga0207684_10517208 | |||
| 1040 | Ga0207684_10723930 | |||
| 1041 | Ga0207654_10139287 | |||
| 1042 | Ga0207654_10232786 | |||
| 1043 | Ga0207707_10009709 | |||
| 1044 | Ga0207707_10090077 | |||
| 1045 | Ga0207707_10196174 | |||
| 1046 | Ga0207695_10028405 | |||
| 1047 | Ga0207695_10047537 | |||
| 1048 | Ga0207695_10085345 | |||
| 1049 | Ga0207695_10271179 | |||
| 1050 | Ga0207671_10332065 | |||
| 1051 | Ga0207671_10453384 | |||
| 1052 | Ga0207693_10000013 | |||
| 1053 | Ga0207693_10000143 | |||
| 1054 | Ga0207693_10002309 | |||
| 1055 | Ga0207693_10004457 | |||
| 1056 | Ga0207693_10014717 | |||
| 1057 | Ga0207693_10062201 | |||
| 1058 | Ga0207693_10138156 | |||
| 1059 | Ga0207693_10275187 | |||
| 1060 | Ga0207693_10275488 | |||
| 1061 | Ga0207663_10001881 | |||
| 1062 | Ga0207663_10012032 | |||
| 1063 | Ga0207663_10154117 | |||
| 1064 | Ga0207663_10887446 | |||
| 1065 | Ga0207660_10639312 | |||
| 1066 | Ga0207657_10002502 | |||
| 1067 | Ga0207649_10032077 | |||
| 1068 | Ga0207652_10088156 | |||
| 1069 | Ga0207646_10000240 | |||
| 1070 | Ga0207646_10000341 | |||
| 1071 | Ga0207646_10113350 | |||
| 1072 | Ga0207646_10167820 | |||
| 1073 | Ga0207646_10294921 | |||
| 1074 | Ga0207646_10327932 | |||
| 1075 | Ga0207646_10411798 | |||
| 1076 | Ga0207646_10617367 | |||
| 1077 | Ga0207694_10088049 | |||
| 1078 | Ga0207694_10391345 | |||
| 1079 | Ga0207694_10576520 | |||
| 1080 | Ga0207650_10295167 | |||
| 1081 | Ga0207687_10032008 | |||
| 1082 | Ga0207687_10100734 | |||
| 1083 | Ga0207700_10000337 | |||
| 1084 | Ga0207700_10000346 | |||
| 1085 | Ga0207700_10012848 | |||
| 1086 | Ga0207700_10031073 | |||
| 1087 | Ga0207700_10066360 | |||
| 1088 | Ga0207700_10151549 | |||
| 1089 | Ga0207700_10219183 | |||
| 1090 | Ga0207700_10370578 | |||
| 1091 | Ga0207700_10392450 | |||
| 1092 | Ga0207700_10644168 | |||
| 1093 | Ga0207664_10000201 | |||
| 1094 | Ga0207664_10013157 | |||
| 1095 | Ga0207664_10082306 | |||
| 1096 | Ga0207664_10089793 | |||
| 1097 | Ga0207664_10305247 | |||
| 1098 | Ga0207664_10373971 | |||
| 1099 | Ga0207664_10392487 | |||
| 1100 | Ga0207690_10080728 | |||
| 1101 | Ga0207706_10001321 | |||
| 1102 | Ga0207686_10770868 | |||
| 1103 | Ga0207709_10047224 | |||
| 1104 | Ga0207669_10154973 | |||
| 1105 | Ga0207665_10003598 | |||
| 1106 | Ga0207665_10005780 | |||
| 1107 | Ga0207665_10014974 | |||
| 1108 | Ga0207665_10019820 | |||
| 1109 | Ga0207665_10046599 | |||
| 1110 | Ga0207665_10050393 | |||
| 1111 | Ga0207665_10068696 | |||
| 1112 | Ga0207665_10079100 | |||
| 1113 | Ga0207665_10140700 | |||
| 1114 | Ga0207665_10299628 | |||
| 1115 | Ga0207711_10005468 | |||
| 1116 | Ga0207711_10332417 | |||
| 1117 | Ga0207689_10021360 | |||
| 1118 | Ga0207689_10291861 | |||
| 1119 | Ga0207689_10745622 | |||
| 1120 | Ga0207661_11523938 | |||
| 1121 | Ga0207679_10778907 | |||
| 1122 | Ga0207679_10822240 | |||
| 1123 | Ga0207667_10353783 | |||
| 1124 | Ga0207667_10451906 | |||
| 1125 | Ga0207640_10391143 | |||
| 1126 | Ga0207640_11263669 | |||
| 1127 | Ga0207658_10169082 | |||
| 1128 | Ga0207658_10625454 | |||
| 1129 | Ga0207677_10052606 | |||
| 1130 | Ga0207677_10268477 | |||
| 1131 | Ga0207639_10439738 | |||
| 1132 | Ga0207678_10000277 | |||
| 1133 | Ga0207702_10010133 | |||
| 1134 | Ga0207702_10010742 | |||
| 1135 | Ga0207702_10076477 | |||
| 1136 | Ga0207702_10089073 | |||
| 1137 | Ga0207702_10505245 | |||
| 1138 | Ga0207641_10049231 | |||
| 1139 | Ga0207641_10331212 | |||
| 1140 | Ga0207641_10421987 | |||
| 1141 | Ga0207648_10017311 | |||
| 1142 | Ga0207676_10128670 | |||
| 1143 | Ga0207674_10012162 | |||
| 1144 | Ga0207674_10016566 | |||
| 1145 | Ga0207674_10181249 | |||
| 1146 | Ga0207675_100243973 | |||
| 1147 | Ga0207683_10160969 | |||
| 1148 | Ga0265356_1001162 | |||
| 1149 | Ga0265356_1002472 | |||
| 1150 | Ga0268266_10305898 | |||
| 1151 | Ga0268265_10066561 | |||
| 1152 | Ga0268264_10042134 | |||
| 1153 | Ga0268264_10058821 | |||
| 1154 | Ga0265326_10066592 | |||
| 1155 | Ga0265338_10024720 | |||
| 1156 | Ga0265338_10367482 | |||
| 1157 | Ga0265762_1001174 | |||
| 1158 | Ga0265767_100901 | |||
| 1159 | Ga0265777_101754 | |||
| 1160 | Ga0265765_1012605 | |||
| 1161 | Ga0265764_103767 | |||
| 1162 | Ga0265771_1011809 | |||
| 1163 | Ga0265760_10000817 | |||
| 1164 | Ga0265760_10001979 | |||
| 1165 | Ga0265760_10003825 | |||
| 1166 | Ga0265760_10007880 | |||
| 1167 | Ga0265760_10022950 | |||
| 1168 | Ga0265760_10034347 | |||
| 1169 | Ga0265330_10009005 | |||
| 1170 | Ga0265340_10044209 | |||
| 1171 | Ga0265340_10095583 | |||
| 1172 | Ga0265339_10020315 | |||
| 1173 | Ga0265339_10030436 | |||
| 1174 | Ga0265339_10033158 | |||
| 1175 | Ga0265339_10149990 | |||
| 1176 | Ga0265316_10002054 | |||
| 1177 | Ga0265316_10027901 | |||
| 1178 | Ga0265316_10049817 | |||
| 1179 | Ga0265314_10000348 | |||
| 1180 | Ga0265314_10023827 | |||
| 1181 | Ga0265314_10074163 | |||
| 1182 | Ga0265314_10100093 | |||
| 1183 | Ga0265342_10048686 | |||
| 1184 | Ga0265342_10295034 | |||
| 1185 | Ga0316053_100216 | |||
| 1186 | Ga0316212_1006664 | |||
| 1187 | Ga0316212_1019356 | |||
| 1188 | Ga0373930_0047228 | |||
| 1189 | Ga0373926_0005377 | |||
| 1190 | Ga0373926_0055670 | |||
| 1191 | Ga0373926_0168743 | |||
| 1192 | Ga0373934_0038417 | |||
| 1193 | Ga0373940_0014887 | |||
| 1194 | Ga0373951_0025103 | |||
| 1195 | Ga0373923_0008953 | |||
| 1196 | Ga0373932_0015752 | |||
| 1197 | Ga0373936_0000275 | |||
| 1198 | Ga0373936_0018891 | |||
| 1199 | Ga0373936_0032100 | |||
| 1200 | Ga0373936_0107940 | |||
| 1201 | Ga0373939_0004499 | |||
| 1202 | Ga0373945_0053857 | |||
| 1203 | Ga0373953_0057031 | |||
| 1204 | Ga0373954_0029119 | |||
| 1205 | Ga0373956_0035693 | |||
| 1206 | Ga0373960_0007444 | |||
| 1207 | Ga0373943_0000011 | |||
| 1208 | Ga0373943_0018454 | |||
| 1209 | Ga0373943_0052333 | |||
| 1210 | Ga0373943_0135442 | |||
| 1211 | Ga0373943_0136882 | |||
| 1212 | Ga0373943_0237461 | |||
| 1213 | Ga0373943_0274154 | |||
| 1214 | Ga0373946_0004868 | |||
| 1215 | Ga0373955_0419814 | |||
| 1216 | Ga0373942_0077346 | |||
| 1217 | Ga0373924_0015151 | |||
| 1218 | Ga0373924_0082057 | |||
| 1219 | Ga0373924_0085550 | |||
| 1220 | Ga0373931_0008821 | |||
| 1221 | Ga0373931_0444078 | |||
| 1222 | Ga0373935_0001861 | |||
| 1223 | Ga0373935_0002744 | |||
| 1224 | Ga0373935_0064889 | |||
| 1225 | Ga0373935_0438278 | |||
| 1226 | Ga0373927_0000604 | |||
| 1227 | Ga0373927_0003800 | |||
| 1228 | Ga0373927_0080802 | |||
| 1229 | Ga0373927_0199084 | |||
| 1230 | Ga0373927_0279037 | |||
| 1231 | Ga0373933_0021828 | |||
| 1232 | Ga0373933_0050277 | |||
| 1233 | Ga0373933_0200177 | |||
| 1234 | Ga0373947_0000784 | |||
| 1235 | Ga0373947_0010631 | |||
| 1236 | Ga0373947_0048835 | |||
| 1237 | Ga0373937_0096584 | |||
| 1238 | Ga0373937_0114777 | |||
| 1239 | Ga0373937_0373907 | |||
| 1240 | Ga0373937_0489643 | |||
| 1241 | Ga0265778_004477 | |||
| 1242 | Ga0373925_0001438 | |||
| 1243 | Ga0373925_0006773 | |||
| 1244 | Ga0373925_0009721 | |||
| 1245 | Ga0373925_0010976 | |||
| 1246 | Ga0373925_0012397 | |||
| 1247 | Ga0373925_0026046 | |||
| 1248 | Ga0373925_0081841 | |||
| 1249 | Ga0373925_0305927 | |||
| 1250 | Ga0373925_0328263 | |||
| 1251 | Ga0373925_0358106 | |||
| 1252 | Ga0395900_1237968 | |||
| 1253 | Ga0436360_0358964 | |||
| 1254 | Ga0436363_0451864 | |||
| 1255 | Ga0451839_1277567 | |||
| 1256 | Ga0451577_0000241 | |||
| 1257 | Ga0451577_0677628 | |||
| 1258 | Ga0451577_0984051 | |||
| 1259 | Ga0466963_0085737 | |||
| 1260 | Ga0466964_0033709 | |||
| 1261 | Ga0453684_0000366 | |||
| 1262 | Ga0453684_0738228 | |||
| 1263 | Ga0453684_1510077 | |||
| 1264 | Ga0466959_0320400 | |||
| 1265 | Ga0451576_0005686 | |||
| 1266 | Ga0451576_0252655 | |||
| 1267 | Ga0451576_0641173 | |||
| 1268 | Ga0466967_0028583 | |||
| 1269 | Ga0466967_0028774 | |||
| 1270 | Ga0466967_0086055 | |||
| 1271 | Ga0495590_0025074 | |||
| 1272 | Ga0495653_0083918 | |||
| 1273 | Ga0495580_0001182 | |||
| 1274 | Ga0495580_0005708 | |||
| 1275 | Ga0495580_0008969 | |||
| 1276 | Ga0495580_0023555 | |||
| 1277 | Ga0495580_0029919 | |||
| 1278 | Ga0495580_0069661 | |||
| 1279 | Ga0495580_0263134 | |||
| 1280 | Ga0495580_0305002 | |||
| 1281 | Ga0495582_0001573 | |||
| 1282 | Ga0495582_0014062 | |||
| 1283 | Ga0495582_0230587 | |||
| 1284 | Ga0495582_0373567 | |||
| 1285 | Ga0495664_0081079 | |||
| 1286 | Ga0495664_0220452 | |||
| 1287 | Ga0495608_0268191 | |||
| 1288 | Ga0495608_0494284 | |||
| 1289 | Ga0495630_0122804 | |||
| 1290 | Ga0495630_0273204 | |||
| 1291 | Ga0495666_0021858 | |||
| 1292 | Ga0495666_0151103 | |||
| 1293 | Ga0495665_0011363 | |||
| 1294 | Ga0495665_0026731 | |||
| 1295 | Ga0495665_0148579 | |||
| 1296 | Ga0495665_0332171 | |||
| 1297 | Ga0495640_0064350 | |||
| 1298 | Ga0495645_0264922 | |||
| 1299 | Ga0495645_0405866 | |||
| 1300 | Ga0495667_0170990 | |||
| 1301 | Ga0495635_0029277 | |||
| 1302 | Ga0495657_0142812 | |||
| 1303 | Ga0495657_0287746 | |||
| 1304 | Ga0495599_0184764 | |||
| 1305 | Ga0495658_0069689 | |||
| 1306 | Ga0495658_0303379 | |||
| 1307 | Ga0495669_0002318 | |||
| 1308 | Ga0495669_0029992 | |||
| 1309 | Ga0495581_0023298 | |||
| 1310 | Ga0495581_0088528 | |||
| 1311 | Ga0495604_0178863 | |||
| 1312 | Ga0495674_0010911 | |||
| 1313 | Ga0495674_0020609 | |||
| 1314 | Ga0495674_0196723 | |||
| 1315 | Ga0495674_0234772 | |||
| 1316 | Ga0495674_0343071 | |||
| 1317 | Ga0495674_0680826 | |||
| 1318 | Ga0495680_0357459 | |||
| 1319 | Ga0495675_0247434 | |||
| 1320 | Ga0495677_0093393 | |||
| 1321 | Ga0495593_0208859 | |||
| 1322 | Ga0495602_0156508 | |||
| 1323 | Ga0495602_0175584 | |||
| 1324 | Ga0495602_0213169 | |||
| 1325 | Ga0495602_0270263 | |||
| 1326 | Ga0495614_0315796 | |||
| 1327 | Ga0496100_0060824 | |||
| 1328 | Ga0496101_0052231 | |||
| 1329 | Ga0496101_0318450 | |||
| 1330 | Ga0496102_0005937 | |||
| 1331 | Ga0496102_0052945 | |||
| 1332 | Ga0496102_0363101 | |||
| 1333 | Ga0496103_0008297 | |||
| 1334 | Ga0496104_0153745 | |||
| 1335 | Ga0496104_0308672 | |||
| 1336 | Ga0496105_0211209 | |||
| 1337 | Ga0496105_0247897 | |||
| 1338 | Ga0496105_0647316 | |||
| 1339 | Ga0496105_0649248 | |||
| 1340 | Ga0496106_0247080 | |||
| 1341 | Ga0496106_0571434 | |||
| 1342 | Ga0496107_0042844 | |||
| 1343 | Ga0496107_0361623 | |||
| 1344 | Ga0496107_0599157 | |||
| 1345 | Ga0496108_0124534 | |||
| 1346 | Ga0496108_0355645 | |||
| 1347 | Ga0496108_0391978 | |||
| 1348 | Ga0496109_0335280 | |||
| 1349 | Ga0496110_0552566 | |||
| 1350 | Ga0496110_1112353 | |||
| 1351 | Ga0496112_0011087 | |||
| 1352 | Ga0496112_0058500 | |||
| 1353 | Ga0496112_0089568 | |||
| 1354 | Ga0496112_0094726 | |||
| 1355 | Ga0496112_0437180 | |||
| 1356 | Ga0496112_0619466 | |||
| 1357 | Ga0496113_0015649 | |||
| 1358 | Ga0496113_0504423 | |||
| 1359 | Ga0496114_0056576 | |||
| 1360 | Ga0496114_0059045 | |||
| 1361 | Ga0496115_0017969 | |||
| 1362 | Ga0496115_0635984 | |||
| 1363 | Ga0496115_0968686 | |||
| 1364 | Ga0501083_0026123 | |||
| 1365 | Ga0501083_0085897 | |||
| 1366 | nmdc:mga0n895_224433_c1 | |||
| 1367 | nmdc:mga0rr50_45157_c1 | |||
| 1368 | nmdc:mga08x19_1063_c1 | |||
| 1369 | nmdc:mga0a205_617208_c1 | |||
| 1370 | Ga0495601_0131310 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3p2j-assembly1.cif.gz_A | crystal structure of peptidyl-trna hydrolase from mycobacterium smegmatis at 2.2 a resolution | 0.933 | 5 | 194 |
| 1ryb-assembly1.cif.gz_A | crystal structure of the chloroplast group ii intron splicing factor crs2 | 0.9314 | 7 | 183 |
| 7brd-assembly1.cif.gz_A | crystal structure of peptidyl-trna hydrolase from klebsiella pneumoniae | 0.9305 | 7 | 191 |
| 7wt6-assembly1.cif.gz_A | crystal structure of full-length peptidyl-trna hydrolase from mycobacterium tuberculosis | 0.9292 | 8 | 194 |
| 2z2j-assembly1.cif.gz_A | crystal structure of peptidyl-trna hydrolase from mycobacterium tuberculosis | 0.9274 | 5 | 183 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54V95_265_452_3.40.50.1470 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9285 | 66 | 193 | 3.40.50.1470 |
| 4q55B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9224 | 7 | 193 | 3.40.50.1470 |
| 4ylyA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9162 | 8 | 198 | 3.40.50.1470 |
| 1rynA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9153 | 8 | 192 | 3.40.50.1470 |
| 5ektA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9124 | 4 | 191 | 3.40.50.1470 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X1IHG4-F1-model_v4 | Peptidyl-tRNA hydrolase | 0.9897 | 92 | 193 |
GO:0004045
|
| AF-A0A2V9ZXL4-F1-model_v4 | Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) | 0.974 | 8 | 193 |
GO:0004045
GO:0005737 GO:0006412 |
| AF-G2LJA4-F1-model_v4 | Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) | 0.9665 | 8 | 193 |
GO:0004045
GO:0005737 GO:0006412 |
| AF-A0A7W1T158-F1-model_v4 | Aminoacyl-tRNA hydrolase (EC 3.1.1.29) | 0.9656 | 41 | 198 |
GO:0004045
|
| AF-A0A2V9ZXL4-F1-model_v4 | Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) | 0.9638 | 8 | 193 |
GO:0004045
GO:0005737 GO:0006412 |