F475030

General Info

Members Datasets Scaffolds Average Seq Length
684 270 1368 323

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100016787|Ga0070689_1000167874
Length 376
Sequence MPVLRFVIRAVRHFEPLRRRWRAPMRHLTVRGPLPILHFPRSRRRAHHAGFPTRRNLPAVTTPVPPIEVAFPDIGRWASGNTGIPYVWTFASNVAGPHVLVQALTHGNEVCGAIALDWLLGKDFRPVRGTLTMCFANIGAYQRFDRADPFGSRCIDEDFNRLWTADVLDGPRKTADLVRARALRPLYERVDYLLDLHSMTDPCPPLAMAGRQRKGVELAQAIGSPEHIIVDGGHAAGRRLRDYAFFDDSEDPRNALLIECGQHWEAAAPEVAKQVTLRFLRHFGMCGPEFLDAWLERVPMPRQKVIEVTAAVTITTDDFRFVIPVAGLSVVSKAGTLLARDGGADVATPYDDCVLIMPTRRPKKGETAVRLGHFVH

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
181 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
182 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
183 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
184 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
185 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
188 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
191 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
194 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
200 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
201 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
202 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
203 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
211 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
212 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
215 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
216 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
217 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
218 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
219 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
220 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
221 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
222 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
223 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
224 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
225 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
226 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
227 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
228 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
229 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
230 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
231 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
232 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
233 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
234 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
237 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
238 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
239 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
240 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
241 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
242 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
259 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
265 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
266 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
267 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
268 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
269 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
270 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.27
Metatranscriptomes 0
Isolates 0.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.09
Rhizosphere 95.18
Stem 0
Stem Tuber 0
Unclassified 1.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100016787 3300005340 Bacteria 5364
2 JGI24735J21928_10000135 3300002067 Bacteria 26292
3 Ga0070658_10052923 3300005327 Bacteria 3294
4 Ga0070658_10096881 3300005327 Bacteria 2436
5 Ga0070676_10005665 3300005328 Bacteria 6651
6 Ga0070676_10007808 3300005328 Bacteria 5750
7 Ga0070676_10031948 3300005328 Bacteria 3013
8 Ga0070676_10034852 3300005328 Bacteria 2891
9 Ga0070676_10100232 3300005328 Bacteria 1788
10 Ga0070683_100036909 3300005329 Bacteria 4471
11 Ga0070683_100147032 3300005329 Bacteria 2233
12 Ga0070690_100034673 3300005330 Bacteria 3163
13 Ga0070690_100102369 3300005330 Bacteria 1900
14 Ga0070670_100001006 3300005331 Bacteria 22231
15 Ga0070670_100001198 3300005331 Bacteria 20595
16 Ga0070670_100010694 3300005331 Bacteria 7841
17 Ga0070670_100016640 3300005331 Bacteria 6310
18 Ga0070670_100047041 3300005331 Bacteria 3712
19 Ga0070670_100135660 3300005331 Bacteria 2127
20 Ga0070677_10003827 3300005333 Bacteria 4876
21 Ga0070677_10065200 3300005333 Bacteria 1515
22 Ga0068869_100000015 3300005334 Bacteria 70868
23 Ga0068869_100002201 3300005334 Bacteria 11727
24 Ga0068869_100062865 3300005334 Bacteria 2726
25 Ga0068869_100106920 3300005334 Bacteria 2124
26 Ga0070666_10004660 3300005335 Bacteria 8372
27 Ga0070666_10007302 3300005335 Bacteria 6808
28 Ga0070666_10043797 3300005335 Bacteria 2998
29 Ga0070666_10125394 3300005335 Bacteria 1782
30 Ga0070680_100076175 3300005336 Bacteria 2761
31 Ga0070682_100034114 3300005337 Bacteria 3096
32 Ga0068868_100009210 3300005338 Bacteria 7095
33 Ga0068868_100042789 3300005338 Bacteria 3537
34 Ga0070660_100002915 3300005339 Bacteria 11783
35 Ga0070660_100082035 3300005339 Bacteria 2531
36 Ga0070689_100005372 3300005340 Bacteria 8733
37 Ga0070689_100082743 3300005340 Bacteria 2522
38 Ga0070691_10042784 3300005341 Bacteria 2144
39 Ga0070691_10134633 3300005341 Bacteria 1255
40 Ga0070687_100020180 3300005343 Bacteria 3112
41 Ga0070687_100031090 3300005343 Bacteria 2617
42 Ga0070661_100000805 3300005344 Bacteria 22549
43 Ga0070661_100022771 3300005344 Bacteria 4486
44 Ga0070661_100025944 3300005344 Bacteria 4211
45 Ga0070661_100029411 3300005344 Bacteria 3965
46 Ga0070692_10036660 3300005345 Bacteria 2489
47 Ga0070668_100010899 3300005347 Bacteria 6765
48 Ga0070668_100020939 3300005347 Bacteria 4940
49 Ga0070668_100154046 3300005347 Bacteria 1861
50 Ga0070668_100237350 3300005347 Bacteria 1509
51 Ga0070669_100011044 3300005353 Bacteria 6408
52 Ga0070669_100033855 3300005353 Bacteria 3697
53 Ga0070675_100000744 3300005354 Bacteria 22671
54 Ga0070675_100024728 3300005354 Bacteria 4810
55 Ga0070675_100186310 3300005354 Bacteria 1796
56 Ga0070675_100188061 3300005354 Bacteria 1788
57 Ga0070675_100203065 3300005354 Bacteria 1721
58 Ga0070675_100314878 3300005354 Bacteria 1381
59 Ga0070675_100438498 3300005354 Bacteria 1170
60 Ga0070675_100486242 3300005354 Bacteria 1111
61 Ga0070671_100000582 3300005355 Bacteria 25999
62 Ga0070671_100015873 3300005355 Bacteria 6084
63 Ga0070671_100024650 3300005355 Bacteria 4927
64 Ga0070671_100075957 3300005355 Bacteria 2806
65 Ga0070671_100109782 3300005355 Unclassified 2317
66 Ga0070674_100019302 3300005356 Bacteria 4328
67 Ga0070674_100140368 3300005356 Bacteria 1813
68 Ga0070674_100214945 3300005356 Bacteria 1493
69 Ga0070673_100003212 3300005364 Bacteria 10130
70 Ga0070673_100003995 3300005364 Bacteria 9278
71 Ga0070673_100014455 3300005364 Bacteria 5500
72 Ga0070688_100009208 3300005365 Bacteria 5389
73 Ga0070688_100016719 3300005365 Bacteria 4199
74 Ga0070659_100008341 3300005366 Bacteria 7565
75 Ga0070659_100013711 3300005366 Bacteria 6041
76 Ga0070659_100023032 3300005366 Bacteria 4762
77 Ga0070667_100001141 3300005367 Bacteria 24116
78 Ga0070667_100011134 3300005367 Bacteria 7440
79 Ga0070667_100092379 3300005367 Bacteria 2604
80 Ga0070709_10011270 3300005434 Bacteria 4976
81 Ga0070714_100009841 3300005435 Bacteria 7536
82 Ga0070714_100124498 3300005435 Bacteria 2296
83 Ga0070713_100000033 3300005436 Bacteria 86758
84 Ga0070713_100002027 3300005436 Bacteria 13093
85 Ga0070713_100072598 3300005436 Bacteria 2911
86 Ga0070701_10072679 3300005438 Bacteria 1843
87 Ga0070701_10101134 3300005438 Bacteria 1597
88 Ga0070711_100000713 3300005439 Bacteria 17378
89 Ga0070711_100133826 3300005439 Bacteria 1850
90 Ga0070700_100013819 3300005441 Bacteria 4542
91 Ga0070700_100166442 3300005441 Bacteria 1523
92 Ga0070694_100009891 3300005444 Bacteria 5861
93 Ga0070708_100000422 3300005445 Bacteria 31591
94 Ga0070708_100042643 3300005445 Bacteria 3984
95 Ga0070663_100001047 3300005455 Bacteria 15129
96 Ga0070678_100004176 3300005456 Bacteria 8153
97 Ga0070678_100017415 3300005456 Bacteria 4626
98 Ga0070678_100236085 3300005456 Bacteria 1526
99 Ga0070678_100356090 3300005456 Bacteria 1260
100 Ga0070678_100403334 3300005456 Unclassified 1188
101 Ga0070662_100000894 3300005457 Bacteria 18244
102 Ga0070662_100152028 3300005457 Bacteria 1803
103 Ga0070681_10006378 3300005458 Bacteria 11466
104 Ga0068867_100011065 3300005459 Bacteria 6364
105 Ga0068867_100023978 3300005459 Bacteria 4372
106 Ga0068867_100165378 3300005459 Unclassified 1748
107 Ga0068867_100364883 3300005459 Bacteria 1209
108 Ga0068867_100471509 3300005459 Bacteria 1074
109 Ga0070685_10002258 3300005466 Bacteria 9939
110 Ga0070685_10005847 3300005466 Bacteria 6260
111 Ga0070685_10016782 3300005466 Bacteria 3907
112 Ga0070706_100059151 3300005467 Bacteria 3536
113 Ga0070706_100089278 3300005467 Bacteria 2858
114 Ga0070698_100247110 3300005471 Bacteria 1717
115 Ga0070699_100025242 3300005518 Bacteria 5124
116 Ga0070679_100004423 3300005530 Bacteria 12985
117 Ga0070684_100009130 3300005535 Bacteria 7796
118 Ga0070684_100092199 3300005535 Bacteria 2695
119 Ga0070684_100102032 3300005535 Bacteria 2564
120 Ga0070697_100082861 3300005536 Bacteria 2644
121 Ga0070697_100083792 3300005536 Bacteria 2629
122 Ga0070697_100154449 3300005536 Bacteria 1936
123 Ga0068853_100004985 3300005539 Bacteria 10350
124 Ga0068853_100010718 3300005539 Bacteria 7423
125 Ga0068853_100101952 3300005539 Bacteria 2539
126 Ga0070672_100000799 3300005543 Bacteria 18754
127 Ga0070672_100002210 3300005543 Bacteria 12268
128 Ga0070672_100004841 3300005543 Bacteria 8847
129 Ga0070672_100004852 3300005543 Bacteria 8841
130 Ga0070672_100096738 3300005543 Bacteria 2389
131 Ga0070672_100281344 3300005543 Bacteria 1406
132 Ga0070686_100003766 3300005544 Bacteria 8335
133 Ga0070695_100064127 3300005545 Bacteria 2389
134 Ga0070696_100035972 3300005546 Bacteria 3411
135 Ga0070696_100082121 3300005546 Bacteria 2284
136 Ga0070693_100002360 3300005547 Bacteria 8681
137 Ga0070693_100030679 3300005547 Bacteria 2941
138 Ga0070665_100001730 3300005548 Bacteria 24965
139 Ga0070665_100009440 3300005548 Bacteria 9872
140 Ga0070665_100044092 3300005548 Bacteria 4480
141 Ga0070665_100061042 3300005548 Bacteria 3779
142 Ga0070665_100106411 3300005548 Bacteria 2807
143 Ga0070704_100080462 3300005549 Bacteria 2396
144 Ga0070704_100087662 3300005549 Bacteria 2310
145 Ga0068855_100001384 3300005563 Bacteria 30026
146 Ga0068855_100002143 3300005563 Bacteria 24411
147 Ga0068855_100060650 3300005563 Bacteria 4423
148 Ga0068855_100076361 3300005563 Bacteria 3888
149 Ga0068855_100165190 3300005563 Bacteria 2510
150 Ga0068855_100183666 3300005563 Bacteria 2363
151 Ga0070664_100000463 3300005564 Bacteria 30826
152 Ga0070664_100001450 3300005564 Bacteria 18896
153 Ga0070664_100025574 3300005564 Bacteria 4895
154 Ga0070664_100035821 3300005564 Bacteria 4167
155 Ga0070664_100066709 3300005564 Bacteria 3074
156 Ga0070664_100075182 3300005564 Bacteria 2900
157 Ga0070664_100184428 3300005564 Bacteria 1856
158 Ga0068857_100037733 3300005577 Bacteria 4281
159 Ga0068857_100087741 3300005577 Bacteria 2783
160 Ga0068857_100105884 3300005577 Bacteria 2525
161 Ga0068857_100227872 3300005577 Bacteria 1703
162 Ga0068857_100245424 3300005577 Bacteria 1640
163 Ga0068857_100443251 3300005577 Bacteria 1213
164 Ga0068854_100001439 3300005578 Bacteria 14404
165 Ga0068854_100014339 3300005578 Bacteria 5223
166 Ga0068854_100024462 3300005578 Bacteria 4135
167 Ga0068854_100070575 3300005578 Bacteria 2553
168 Ga0068854_100152745 3300005578 Bacteria 1782
169 Ga0068856_100000265 3300005614 Bacteria 56919
170 Ga0068856_100001465 3300005614 Bacteria 24722
171 Ga0068856_100012505 3300005614 Bacteria 8216
172 Ga0068856_100059053 3300005614 Bacteria 3788
173 Ga0068856_100174117 3300005614 Bacteria 2165
174 Ga0070702_100006801 3300005615 Bacteria 5439
175 Ga0070702_100009038 3300005615 Bacteria 4857
176 Ga0068852_100000730 3300005616 Bacteria 21553
177 Ga0068852_100005033 3300005616 Bacteria 9395
178 Ga0068852_100014714 3300005616 Bacteria 6035
179 Ga0068852_100209758 3300005616 Bacteria 1847
180 Ga0068859_100000217 3300005617 Bacteria 56968
181 Ga0068859_100011269 3300005617 Bacteria 8997
182 Ga0068859_100015640 3300005617 Bacteria 7624
183 Ga0068859_100064889 3300005617 Bacteria 3685
184 Ga0068859_100083080 3300005617 Bacteria 3245
185 Ga0068859_100134951 3300005617 Bacteria 2540
186 Ga0068864_100002249 3300005618 Bacteria 15963
187 Ga0068864_100005142 3300005618 Bacteria 10716
188 Ga0068864_100005412 3300005618 Bacteria 10462
189 Ga0068864_100010891 3300005618 Bacteria 7516
190 Ga0068864_100031035 3300005618 Bacteria 4532
191 Ga0068864_100110465 3300005618 Bacteria 2448
192 Ga0068864_100122338 3300005618 Bacteria 2328
193 Ga0068864_100324379 3300005618 Bacteria 1447
194 Ga0068866_10007095 3300005718 Bacteria 4684
195 Ga0068866_10033536 3300005718 Bacteria 2492
196 Ga0068861_100000795 3300005719 Bacteria 18997
197 Ga0068861_100021864 3300005719 Bacteria 4601
198 Ga0068861_100162614 3300005719 Bacteria 1843
199 Ga0068851_10033611 3300005834 Bacteria 2557
200 Ga0068851_10076246 3300005834 Unclassified 1743
201 Ga0068870_10049411 3300005840 Bacteria 2219
202 Ga0068863_100000555 3300005841 Bacteria 37962
203 Ga0068863_100003997 3300005841 Bacteria 14559
204 Ga0068863_100014834 3300005841 Bacteria 7492
205 Ga0068863_100047672 3300005841 Bacteria 4064
206 Ga0068863_100048400 3300005841 Bacteria 4032
207 Ga0068863_100132517 3300005841 Bacteria 2379
208 Ga0068863_100235984 3300005841 Bacteria 1765
209 Ga0068863_100337794 3300005841 Bacteria 1465
210 Ga0068858_100001816 3300005842 Bacteria 21723
211 Ga0068858_100003829 3300005842 Bacteria 14878
212 Ga0068858_100004941 3300005842 Bacteria 13063
213 Ga0068858_100326401 3300005842 Bacteria 1467
214 Ga0068858_100401026 3300005842 Bacteria 1318
215 Ga0068860_100027571 3300005843 Bacteria 5469
216 Ga0068860_100119938 3300005843 Bacteria 2518
217 Ga0068860_100153247 3300005843 Bacteria 2220
218 Ga0068862_100019461 3300005844 Bacteria 5666
219 Ga0068862_100047443 3300005844 Bacteria 3666
220 Ga0068862_100096383 3300005844 Bacteria 2582
221 Ga0068862_100163748 3300005844 Bacteria 1987
222 Ga0068862_100196129 3300005844 Bacteria 1819
223 Ga0070715_10007607 3300006163 Bacteria 3736
224 Ga0070716_100007690 3300006173 Bacteria 5319
225 Ga0070712_100001191 3300006175 Bacteria 15718
226 Ga0070712_100033442 3300006175 Bacteria 3479
227 Ga0070712_100318940 3300006175 Bacteria 1263
228 Ga0097621_100000380 3300006237 Bacteria 30961
229 Ga0097621_100021138 3300006237 Bacteria 5026
230 Ga0097621_100138253 3300006237 Bacteria 2080
231 Ga0097621_100151376 3300006237 Bacteria 1990
232 Ga0068871_100002210 3300006358 Bacteria 13215
233 Ga0068871_100049561 3300006358 Bacteria 3395
234 Ga0068871_100078548 3300006358 Bacteria 2729
235 Ga0075428_100323223 3300006844 Bacteria 1658
236 Ga0075434_100052492 3300006871 Bacteria 4051
237 Ga0068865_100090034 3300006881 Bacteria 2224
238 Ga0075436_100023394 3300006914 Bacteria 4244
239 Ga0097620_100000217 3300006931 Bacteria 56968
240 Ga0097620_100011270 3300006931 Bacteria 8997
241 Ga0097620_100015640 3300006931 Bacteria 7624
242 Ga0097620_100064888 3300006931 Bacteria 3685
243 Ga0097620_100083076 3300006931 Bacteria 3245
244 Ga0097620_100134958 3300006931 Bacteria 2540
245 Ga0075435_100065549 3300007076 Bacteria 2953
246 Ga0075435_100129659 3300007076 Bacteria 2110
247 Ga0105240_10013674 3300009093 Bacteria 11130
248 Ga0105240_10015401 3300009093 Bacteria 10393
249 Ga0105240_10071201 3300009093 Bacteria 4301
250 Ga0111539_10022948 3300009094 Bacteria 7662
251 Ga0111539_10062939 3300009094 Bacteria 4391
252 Ga0105245_10057551 3300009098 Bacteria 3497
253 Ga0105245_10079908 3300009098 Bacteria 2987
254 Ga0105245_10457103 3300009098 Bacteria 1286
255 Ga0114129_10133684 3300009147 Bacteria 3405
256 Ga0105243_10032242 3300009148 Bacteria 4047
257 Ga0105243_10058772 3300009148 Bacteria 3066
258 Ga0105241_10025668 3300009174 Bacteria 4379
259 Ga0105241_10026233 3300009174 Bacteria 4333
260 Ga0105242_10140093 3300009176 Bacteria 2098
261 Ga0105242_10142996 3300009176 Bacteria 2078
262 Ga0105248_10002088 3300009177 Bacteria 22111
263 Ga0105248_10005492 3300009177 Bacteria 13919
264 Ga0105248_10017533 3300009177 Bacteria 7896
265 Ga0105248_10071480 3300009177 Bacteria 3898
266 Ga0105237_10011201 3300009545 Bacteria 9505
267 Ga0105237_10049934 3300009545 Bacteria 4204
268 Ga0105238_10001144 3300009551 Bacteria 26753
269 Ga0105238_10282655 3300009551 Bacteria 1641
270 Ga0105249_10088282 3300009553 Bacteria 2896
271 Ga0105249_10097015 3300009553 Bacteria 2767
272 Ga0105249_10150639 3300009553 Bacteria 2239
273 Ga0105249_10403415 3300009553 Bacteria 1398
274 Ga0105239_10096901 3300010375 Bacteria 3259
275 Ga0105246_10036277 3300011119 Bacteria 3302
276 Ga0105246_10070995 3300011119 Bacteria 2451
277 Ga0157373_10000321 3300013100 Bacteria 38735
278 Ga0157371_10000470 3300013102 Bacteria 49205
279 Ga0157370_10010349 3300013104 Bacteria 9839
280 Ga0157370_10049477 3300013104 Bacteria 4022
281 Ga0157370_10079668 3300013104 Bacteria 3084
282 Ga0157369_10043885 3300013105 Bacteria 4870
283 Ga0157369_10055599 3300013105 Bacteria 4272
284 Ga0157374_10005410 3300013296 Bacteria 10726
285 Ga0157374_10076797 3300013296 Bacteria 3158
286 Ga0157378_10037886 3300013297 Bacteria 4273
287 Ga0157378_10049224 3300013297 Bacteria 3749
288 Ga0157378_10158411 3300013297 Bacteria 2115
289 Ga0163162_10023867 3300013306 Bacteria 6035
290 Ga0163162_10030510 3300013306 Bacteria 5341
291 Ga0163162_10356845 3300013306 Bacteria 1595
292 Ga0157372_10002246 3300013307 Bacteria 20974
293 Ga0157372_10003708 3300013307 Bacteria 16414
294 Ga0157372_10035168 3300013307 Bacteria 5513
295 Ga0157372_10170934 3300013307 Bacteria 2515
296 Ga0157375_10001474 3300013308 Bacteria 20229
297 Ga0157375_10003344 3300013308 Bacteria 13895
298 Ga0157375_10054697 3300013308 Bacteria 3932
299 Ga0157375_10135240 3300013308 Bacteria 2588
300 Ga0157375_10295113 3300013308 Bacteria 1784
301 Ga0163163_10003415 3300014325 Bacteria 13494
302 Ga0163163_10009489 3300014325 Bacteria 8690
303 Ga0163163_10033033 3300014325 Bacteria 5002
304 Ga0163163_10107403 3300014325 Bacteria 2818
305 Ga0163163_10117485 3300014325 Bacteria 2691
306 Ga0163163_10362339 3300014325 Bacteria 1506
307 Ga0157380_10006867 3300014326 Bacteria 8045
308 Ga0157380_10017728 3300014326 Bacteria 5273
309 Ga0157380_10091229 3300014326 Bacteria 2515
310 Ga0157380_10116223 3300014326 Bacteria 2257
311 Ga0157380_10335901 3300014326 Bacteria 1407
312 Ga0157377_10006371 3300014745 Bacteria 5624
313 Ga0157379_10000045 3300014968 Bacteria 75128
314 Ga0157379_10003051 3300014968 Bacteria 14152
315 Ga0157379_10019143 3300014968 Bacteria 6044
316 Ga0157379_10025288 3300014968 Bacteria 5274
317 Ga0157379_10103736 3300014968 Bacteria 2552
318 Ga0157379_10160726 3300014968 Bacteria 2027
319 Ga0157376_10003796 3300014969 Bacteria 10444
320 Ga0157376_10016232 3300014969 Bacteria 5646
321 Ga0157376_10023919 3300014969 Bacteria 4790
322 Ga0157376_10207569 3300014969 Bacteria 1806
323 Ga0163161_10114847 3300017792 Bacteria 2017
324 Ga0207697_10000647 3300025315 Bacteria 19803
325 Ga0207697_10006354 3300025315 Bacteria 5354
326 Ga0207692_10013963 3300025898 Bacteria 3498
327 Ga0207692_10089127 3300025898 Bacteria 1669
328 Ga0207688_10001186 3300025901 Bacteria 13453
329 Ga0207680_10003490 3300025903 Bacteria 7405
330 Ga0207680_10017366 3300025903 Bacteria 3800
331 Ga0207680_10017825 3300025903 Bacteria 3759
332 Ga0207680_10073174 3300025903 Bacteria 2130
333 Ga0207647_10104572 3300025904 Bacteria 1678
334 Ga0207685_10011344 3300025905 Bacteria 2675
335 Ga0207645_10001518 3300025907 Bacteria 18972
336 Ga0207645_10001694 3300025907 Bacteria 17901
337 Ga0207645_10010361 3300025907 Bacteria 6399
338 Ga0207645_10023513 3300025907 Bacteria 4005
339 Ga0207645_10074082 3300025907 Bacteria 2180
340 Ga0207645_10120222 3300025907 Bacteria 1705
341 Ga0207645_10203301 3300025907 Bacteria 1304
342 Ga0207643_10000408 3300025908 Bacteria 28508
343 Ga0207643_10008780 3300025908 Bacteria 5420
344 Ga0207643_10015354 3300025908 Bacteria 4168
345 Ga0207643_10033800 3300025908 Bacteria 2861
346 Ga0207705_10167009 3300025909 Unclassified 1655
347 Ga0207684_10111550 3300025910 Bacteria 2341
348 Ga0207684_10298772 3300025910 Unclassified 1388
349 Ga0207707_10020712 3300025912 Bacteria 5744
350 Ga0207707_10067330 3300025912 Bacteria 3119
351 Ga0207671_10100347 3300025914 Bacteria 2192
352 Ga0207693_10000459 3300025915 Bacteria 37224
353 Ga0207693_10045211 3300025915 Bacteria 3460
354 Ga0207693_10089841 3300025915 Bacteria 2408
355 Ga0207663_10001764 3300025916 Bacteria 10202
356 Ga0207663_10150415 3300025916 Bacteria 1633
357 Ga0207662_10071825 3300025918 Bacteria 2096
358 Ga0207662_10245708 3300025918 Bacteria 1173
359 Ga0207657_10007048 3300025919 Bacteria 11552
360 Ga0207657_10008686 3300025919 Bacteria 10284
361 Ga0207657_10013039 3300025919 Bacteria 8168
362 Ga0207657_10087651 3300025919 Bacteria 2604
363 Ga0207657_10111632 3300025919 Bacteria 2257
364 Ga0207649_10002022 3300025920 Bacteria 11527
365 Ga0207649_10073423 3300025920 Unclassified 2191
366 Ga0207649_10079360 3300025920 Bacteria 2120
367 Ga0207649_10243026 3300025920 Bacteria 1293
368 Ga0207649_10243912 3300025920 Bacteria 1291
369 Ga0207652_10062059 3300025921 Bacteria 3229
370 Ga0207646_10013355 3300025922 Bacteria 7858
371 Ga0207681_10019347 3300025923 Bacteria 4301
372 Ga0207681_10055878 3300025923 Bacteria 2691
373 Ga0207681_10059955 3300025923 Bacteria 2610
374 Ga0207681_10191344 3300025923 Bacteria 1565
375 Ga0207694_10123431 3300025924 Bacteria 2069
376 Ga0207694_10184192 3300025924 Bacteria 1694
377 Ga0207650_10003654 3300025925 Bacteria 10525
378 Ga0207650_10005628 3300025925 Bacteria 8554
379 Ga0207650_10035449 3300025925 Bacteria 3623
380 Ga0207650_10098991 3300025925 Bacteria 2241
381 Ga0207650_10162384 3300025925 Unclassified 1771
382 Ga0207659_10000917 3300025926 Bacteria 17553
383 Ga0207659_10042599 3300025926 Bacteria 3184
384 Ga0207659_10200702 3300025926 Bacteria 1593
385 Ga0207659_10368083 3300025926 Bacteria 1196
386 Ga0207687_10003000 3300025927 Bacteria 11445
387 Ga0207687_10015981 3300025927 Bacteria 4924
388 Ga0207700_10000099 3300025928 Bacteria 53179
389 Ga0207700_10080496 3300025928 Bacteria 2540
390 Ga0207664_10000714 3300025929 Bacteria 22576
391 Ga0207644_10005753 3300025931 Bacteria 8066
392 Ga0207644_10007760 3300025931 Bacteria 7004
393 Ga0207644_10029427 3300025931 Bacteria 3811
394 Ga0207644_10029725 3300025931 Bacteria 3794
395 Ga0207644_10061636 3300025931 Bacteria 2717
396 Ga0207644_10066877 3300025931 Bacteria 2618
397 Ga0207690_10000395 3300025932 Bacteria 28806
398 Ga0207690_10028571 3300025932 Bacteria 3536
399 Ga0207706_10000002 3300025933 Bacteria 360309
400 Ga0207706_10004229 3300025933 Bacteria 13523
401 Ga0207706_10009673 3300025933 Bacteria 8851
402 Ga0207706_10054144 3300025933 Bacteria 3541
403 Ga0207706_10119836 3300025933 Bacteria 2313
404 Ga0207706_10159500 3300025933 Bacteria 1983
405 Ga0207686_10002984 3300025934 Bacteria 9121
406 Ga0207670_10193251 3300025936 Bacteria 1541
407 Ga0207669_10010364 3300025937 Bacteria 4484
408 Ga0207669_10051736 3300025937 Bacteria 2462
409 Ga0207669_10055732 3300025937 Bacteria 2396
410 Ga0207704_10118068 3300025938 Bacteria 1808
411 Ga0207691_10000289 3300025940 Bacteria 49595
412 Ga0207691_10001774 3300025940 Bacteria 21239
413 Ga0207691_10002924 3300025940 Bacteria 16663
414 Ga0207691_10013170 3300025940 Bacteria 7920
415 Ga0207691_10048947 3300025940 Bacteria 3873
416 Ga0207691_10118089 3300025940 Bacteria 2353
417 Ga0207691_10139208 3300025940 Bacteria 2139
418 Ga0207691_10167269 3300025940 Bacteria 1927
419 Ga0207691_10170725 3300025940 Bacteria 1904
420 Ga0207691_10311616 3300025940 Bacteria 1350
421 Ga0207711_10000626 3300025941 Bacteria 35493
422 Ga0207711_10023650 3300025941 Bacteria 5145
423 Ga0207711_10032983 3300025941 Bacteria 4379
424 Ga0207711_10055857 3300025941 Bacteria 3391
425 Ga0207711_10262887 3300025941 Bacteria 1586
426 Ga0207711_10361199 3300025941 Bacteria 1345
427 Ga0207711_10377412 3300025941 Bacteria 1315
428 Ga0207689_10000030 3300025942 Bacteria 97584
429 Ga0207689_10001070 3300025942 Bacteria 26388
430 Ga0207689_10006324 3300025942 Bacteria 10489
431 Ga0207689_10036408 3300025942 Bacteria 4086
432 Ga0207689_10044397 3300025942 Bacteria 3675
433 Ga0207661_10019933 3300025944 Bacteria 5006
434 Ga0207679_10002497 3300025945 Bacteria 11320
435 Ga0207679_10027370 3300025945 Bacteria 3942
436 Ga0207679_10041280 3300025945 Bacteria 3307
437 Ga0207679_10047151 3300025945 Bacteria 3129
438 Ga0207679_10222542 3300025945 Bacteria 1588
439 Ga0207667_10007019 3300025949 Bacteria 13604
440 Ga0207667_10009304 3300025949 Bacteria 11588
441 Ga0207667_10013669 3300025949 Bacteria 9277
442 Ga0207667_10153948 3300025949 Bacteria 2366
443 Ga0207651_10000481 3300025960 Bacteria 16781
444 Ga0207651_10030522 3300025960 Bacteria 3433
445 Ga0207651_10035000 3300025960 Bacteria 3259
446 Ga0207651_10064453 3300025960 Bacteria 2565
447 Ga0207651_10145304 3300025960 Bacteria 1838
448 Ga0207651_10450688 3300025960 Bacteria 1104
449 Ga0207712_10071072 3300025961 Bacteria 2502
450 Ga0207668_10008267 3300025972 Bacteria 6199
451 Ga0207668_10010950 3300025972 Bacteria 5497
452 Ga0207668_10184698 3300025972 Bacteria 1647
453 Ga0207668_10187356 3300025972 Bacteria 1637
454 Ga0207640_10003226 3300025981 Bacteria 8785
455 Ga0207640_10041249 3300025981 Bacteria 2934
456 Ga0207640_10079280 3300025981 Bacteria 2238
457 Ga0207640_10231410 3300025981 Bacteria 1422
458 Ga0207658_10026998 3300025986 Bacteria 4030
459 Ga0207658_10031271 3300025986 Bacteria 3778
460 Ga0207658_10163509 3300025986 Bacteria 1826
461 Ga0207658_10236545 3300025986 Bacteria 1544
462 Ga0207677_10000359 3300026023 Bacteria 31912
463 Ga0207677_10005047 3300026023 Bacteria 7133
464 Ga0207677_10147717 3300026023 Bacteria 1809
465 Ga0207677_10218379 3300026023 Bacteria 1527
466 Ga0207677_10267906 3300026023 Bacteria 1396
467 Ga0207703_10000143 3300026035 Bacteria 84508
468 Ga0207703_10000739 3300026035 Bacteria 32194
469 Ga0207703_10008651 3300026035 Bacteria 8033
470 Ga0207703_10011513 3300026035 Bacteria 6881
471 Ga0207703_10245080 3300026035 Bacteria 1613
472 Ga0207639_10000715 3300026041 Bacteria 22749
473 Ga0207639_10073681 3300026041 Unclassified 2678
474 Ga0207639_10258975 3300026041 Bacteria 1520
475 Ga0207639_10312147 3300026041 Bacteria 1393
476 Ga0207678_10003128 3300026067 Bacteria 14981
477 Ga0207678_10013857 3300026067 Bacteria 7083
478 Ga0207678_10124128 3300026067 Bacteria 2203
479 Ga0207678_10336262 3300026067 Bacteria 1301
480 Ga0207708_10001050 3300026075 Bacteria 20680
481 Ga0207702_10000810 3300026078 Bacteria 33176
482 Ga0207702_10010048 3300026078 Bacteria 7934
483 Ga0207702_10042630 3300026078 Bacteria 3807
484 Ga0207702_10229475 3300026078 Bacteria 1734
485 Ga0207702_10438528 3300026078 Bacteria 1265
486 Ga0207641_10003914 3300026088 Bacteria 13024
487 Ga0207641_10007133 3300026088 Bacteria 9331
488 Ga0207641_10012868 3300026088 Bacteria 6862
489 Ga0207641_10027328 3300026088 Bacteria 4713
490 Ga0207641_10037085 3300026088 Bacteria 4070
491 Ga0207641_10122306 3300026088 Bacteria 2324
492 Ga0207641_10253936 3300026088 Bacteria 1643
493 Ga0207641_10273955 3300026088 Bacteria 1584
494 Ga0207641_10321294 3300026088 Bacteria 1468
495 Ga0207648_10000539 3300026089 Bacteria 42198
496 Ga0207648_10001652 3300026089 Bacteria 24455
497 Ga0207648_10016549 3300026089 Bacteria 6735
498 Ga0207648_10020535 3300026089 Bacteria 5947
499 Ga0207648_10053330 3300026089 Bacteria 3535
500 Ga0207648_10139665 3300026089 Bacteria 2135
501 Ga0207676_10001145 3300026095 Bacteria 19988
502 Ga0207676_10001668 3300026095 Bacteria 16361
503 Ga0207676_10013373 3300026095 Bacteria 5894
504 Ga0207676_10055115 3300026095 Bacteria 3119
505 Ga0207676_10092821 3300026095 Bacteria 2483
506 Ga0207674_10002105 3300026116 Bacteria 25194
507 Ga0207674_10002729 3300026116 Bacteria 22016
508 Ga0207674_10004765 3300026116 Bacteria 16269
509 Ga0207674_10031789 3300026116 Bacteria 5541
510 Ga0207674_10117150 3300026116 Bacteria 2635
511 Ga0207675_100006689 3300026118 Bacteria 10907
512 Ga0207675_100008050 3300026118 Bacteria 9933
513 Ga0207675_100019964 3300026118 Bacteria 6252
514 Ga0207675_100353398 3300026118 Bacteria 1441
515 Ga0207683_10001151 3300026121 Bacteria 24079
516 Ga0207683_10002860 3300026121 Bacteria 15061
517 Ga0207683_10007956 3300026121 Bacteria 9066
518 Ga0207683_10013876 3300026121 Bacteria 6871
519 Ga0207683_10033596 3300026121 Bacteria 4456
520 Ga0207683_10073352 3300026121 Bacteria 3028
521 Ga0207683_10155238 3300026121 Bacteria 2067
522 Ga0207683_10270924 3300026121 Bacteria 1551
523 Ga0207698_10004156 3300026142 Bacteria 8797
524 Ga0207698_10005501 3300026142 Bacteria 7836
525 Ga0207698_10018940 3300026142 Bacteria 4701
526 Ga0207698_10090874 3300026142 Bacteria 2498
527 Ga0209995_1003188 3300027471 Bacteria 2609
528 Ga0209968_1004849 3300027526 Bacteria 2016
529 Ga0209999_1004165 3300027543 Bacteria 2605
530 Ga0209970_1007485 3300027614 Bacteria 1790
531 Ga0209983_1003360 3300027665 Bacteria 3426
532 Ga0209971_1002639 3300027682 Bacteria 4295
533 Ga0209971_1018102 3300027682 Bacteria 1671
534 Ga0209966_1014938 3300027695 Bacteria 1455
535 Ga0209974_10003152 3300027876 Bacteria 5971
536 Ga0209974_10004146 3300027876 Bacteria 5180
537 Ga0268266_10004145 3300028379 Bacteria 13994
538 Ga0268266_10007102 3300028379 Bacteria 10160
539 Ga0268266_10031998 3300028379 Bacteria 4469
540 Ga0268266_10155337 3300028379 Bacteria 2066
541 Ga0268265_10181167 3300028380 Bacteria 1810
542 Ga0268265_10276294 3300028380 Bacteria 1501
543 Ga0268265_10326891 3300028380 Bacteria 1391
544 Ga0268264_10000502 3300028381 Bacteria 50745
545 Ga0268264_10007973 3300028381 Bacteria 8812
546 Ga0268264_10014839 3300028381 Bacteria 6398
547 Ga0268264_10107102 3300028381 Bacteria 2441
548 Ga0268264_10113180 3300028381 Bacteria 2380
549 Ga0307515_10143122 3300028794 Bacteria 2551
550 Ga0265330_10002781 3300031235 Bacteria 9390
551 Ga0265332_10000594 3300031238 Bacteria 23783
552 Ga0265329_10002431 3300031242 Bacteria 8442
553 Ga0265331_10000796 3300031250 Bacteria 26243
554 Ga0265316_10010150 3300031344 Bacteria 8600
555 Ga0307408_100016172 3300031548 Bacteria 4975
556 Ga0307408_100285753 3300031548 Bacteria 1375
557 Ga0265314_10023442 3300031711 Bacteria 4705
558 Ga0265342_10017976 3300031712 Bacteria 4590
559 Ga0307405_10004325 3300031731 Bacteria 6692
560 Ga0307405_10025362 3300031731 Bacteria 3402
561 Ga0307413_10034389 3300031824 Bacteria 2896
562 Ga0307413_10035282 3300031824 Bacteria 2867
563 Ga0307410_10005764 3300031852 Bacteria 6602
564 Ga0307410_10007259 3300031852 Bacteria 6054
565 Ga0307410_10031993 3300031852 Bacteria 3380
566 Ga0307406_10001568 3300031901 Bacteria 12590
567 Ga0307406_10057002 3300031901 Bacteria 2504
568 Ga0307407_10031427 3300031903 Bacteria 2875
569 Ga0307407_10034426 3300031903 Bacteria 2773
570 Ga0307407_10120676 3300031903 Bacteria 1661
571 Ga0307412_10118292 3300031911 Bacteria 1903
572 Ga0307409_100028116 3300031995 Bacteria 3999
573 Ga0307409_100029398 3300031995 Bacteria 3932
574 Ga0307409_100071603 3300031995 Bacteria 2757
575 Ga0307416_100005440 3300032002 Bacteria 7823
576 Ga0307416_100014006 3300032002 Bacteria 5472
577 Ga0307416_100322534 3300032002 Bacteria 1548
578 Ga0307414_10007939 3300032004 Bacteria 5993
579 Ga0307414_10344315 3300032004 Bacteria 1277
580 Ga0307411_10021204 3300032005 Bacteria 3796
581 Ga0307411_10101980 3300032005 Bacteria 2032
582 Ga0307415_100062900 3300032126 Bacteria 2576
583 Ga0373934_0006473 3300035086 Bacteria 4347
584 Ga0373945_0022046 3300035116 Bacteria 2191
585 Ga0373956_0014328 3300035119 Bacteria 3311
586 Ga0373957_0021486 3300035120 Bacteria 2291
587 Ga0373943_0035808 3300035170 Bacteria 2374
588 Ga0373946_0017110 3300035171 Bacteria 2770
589 Ga0373946_0135653 3300035171 Bacteria 1136
590 Ga0373955_0013832 3300035172 Bacteria 3914
591 Ga0373924_0002145 3300035410 Bacteria 6604
592 Ga0373924_0023099 3300035410 Bacteria 2435
593 Ga0373931_0093326 3300035691 Bacteria 1681
594 Ga0373935_0050364 3300035692 Bacteria 2643
595 Ga0373927_0002996 3300035695 Bacteria 12255
596 Ga0373927_0012616 3300035695 Bacteria 5621
597 Ga0373927_0052098 3300035695 Bacteria 2647
598 Ga0373927_0244866 3300035695 Bacteria 1178
599 Ga0373933_0002724 3300035724 Bacteria 9880
600 Ga0373933_0120619 3300035724 Bacteria 1642
601 Ga0373947_0132508 3300035725 Bacteria 1592
602 Ga0373937_0008308 3300036401 Bacteria 9012
603 Ga0373937_0010034 3300036401 Bacteria 8258
604 Ga0373937_0111756 3300036401 Bacteria 2541
605 Ga0373937_0126683 3300036401 Bacteria 2383
606 Ga0373937_0183905 3300036401 Bacteria 1963
607 Ga0373925_0015742 3300037068 Bacteria 5475
608 Ga0373925_0099124 3300037068 Bacteria 2237
609 Ga0450890_002056 3300042127 Bacteria 2827
610 Ga0450893_0015470 3300042532 Bacteria 1286
611 Ga0466963_0189496 3300044694 Bacteria 1437
612 Ga0466960_0158474 3300044901 Bacteria 1214
613 Ga0495603_0034364 3300046455 Bacteria 3048
614 Ga0495629_0008811 3300046459 Bacteria 7418
615 Ga0495651_0036433 3300046462 Bacteria 3831
616 Ga0495580_0007839 3300046472 Bacteria 8550
617 Ga0495580_0035431 3300046472 Bacteria 3589
618 Ga0495580_0070262 3300046472 Unclassified 2446
619 Ga0495580_0070377 3300046472 Bacteria 2444
620 Ga0495639_0001280 3300046475 Bacteria 11299
621 Ga0495664_0030990 3300046477 Bacteria 3134
622 Ga0495594_0115047 3300046499 Bacteria 1518
623 Ga0495628_0129512 3300046516 Bacteria 1931
624 Ga0495630_0095805 3300046517 Bacteria 2244
625 Ga0495598_0036624 3300046537 Bacteria 1411
626 Ga0495621_0028224 3300046539 Bacteria 1907
627 Ga0495645_0012937 3300046543 Bacteria 5891
628 Ga0495667_0134343 3300046559 Bacteria 1595
629 Ga0495659_0108892 3300046664 Bacteria 1080
630 Ga0495647_0001465 3300046681 Bacteria 7320
631 Ga0495669_0062862 3300046684 Bacteria 1683
632 Ga0495669_0088273 3300046684 Bacteria 1429
633 Ga0495613_0126839 3300046689 Bacteria 1829
634 Ga0495649_0003175 3300046694 Bacteria 11233
635 Ga0495589_0059682 3300046794 Bacteria 1874
636 Ga0495581_0025946 3300047315 Bacteria 3398
637 Ga0495683_0029298 3300047323 Bacteria 2814
638 Ga0495675_0040339 3300047444 Bacteria 2975
639 Ga0495684_0085251 3300047471 Bacteria 2395
640 Ga0495593_0042088 3300047673 Bacteria 2453
641 Ga0496101_0413094 3300048904 Bacteria 1063
642 Ga0496102_0001095 3300048905 Bacteria 25074
643 Ga0496102_0024334 3300048905 Bacteria 5383
644 Ga0496102_0109236 3300048905 Bacteria 2577
645 Ga0496103_0015871 3300048906 Bacteria 4490
646 Ga0496103_0102549 3300048906 Bacteria 1812
647 Ga0496104_0006807 3300048907 Bacteria 10070
648 Ga0496104_0010734 3300048907 Bacteria 8191
649 Ga0496105_0039618 3300048908 Bacteria 3884
650 Ga0496106_0000553 3300048909 Bacteria 26612
651 Ga0496106_0095006 3300048909 Bacteria 2305
652 Ga0496107_0012868 3300048910 Bacteria 5848
653 Ga0496107_0044086 3300048910 Bacteria 3206
654 Ga0496107_0045897 3300048910 Bacteria 3144
655 Ga0496108_0011684 3300048911 Bacteria 7142
656 Ga0496108_0039141 3300048911 Bacteria 3953
657 Ga0496108_0103797 3300048911 Bacteria 2425
658 Ga0496109_0068056 3300048912 Bacteria 3263
659 Ga0496109_0113438 3300048912 Bacteria 2521
660 Ga0496109_0141614 3300048912 Bacteria 2249
661 Ga0496109_0143453 3300048912 Bacteria 2233
662 Ga0496110_0102795 3300048913 Bacteria 2563
663 Ga0496110_0111187 3300048913 Bacteria 2462
664 Ga0496112_0010658 3300048915 Bacteria 8352
665 Ga0496112_0072257 3300048915 Bacteria 3410
666 Ga0496113_0082287 3300048916 Bacteria 2469
667 Ga0496114_0098949 3300048917 Bacteria 2487
668 Ga0496114_0174696 3300048917 Bacteria 1874
669 Ga0501043_0236752 3300049579 Bacteria 1409
670 Ga0501047_0088005 3300049581 Bacteria 2983
671 Ga0501071_0280174 3300049587 Bacteria 1262
672 Ga0501045_0242087 3300049824 Bacteria 1343
673 nmdc:mga05p37_176739_c1 3300050507 Bacteria 2600
674 nmdc:mga08y16_69935_c1 3300050511 Bacteria 3659
675 nmdc:mga0n895_201890_c1 3300050512 Bacteria 2019
676 nmdc:mga0rr50_10129_c1 3300050513 Bacteria 5966
677 Ga0495612_0071406 3300053078 Bacteria 1448
678 Ga0495619_0033136 3300053085 Bacteria 3354
679 Ga0495619_0269364 3300053085 Bacteria 1180
680 2599103452 2597490356 Bacteria 7030811
681 2792840733 2791355137 Bacteria 9654227
682 2846953338 2846952575 Bacteria 6587527
683 2848858812 2848858292 Bacteria 7391279
684 8055228760 8055225921 Bacteria 3341787
685 Ga0070689_100016787
686 JGI24735J21928_10000135
687 Ga0070658_10052923
688 Ga0070658_10096881
689 Ga0070676_10005665
690 Ga0070676_10007808
691 Ga0070676_10031948
692 Ga0070676_10034852
693 Ga0070676_10100232
694 Ga0070683_100036909
695 Ga0070683_100147032
696 Ga0070690_100034673
697 Ga0070690_100102369
698 Ga0070670_100001006
699 Ga0070670_100001198
700 Ga0070670_100010694
701 Ga0070670_100016640
702 Ga0070670_100047041
703 Ga0070670_100135660
704 Ga0070677_10003827
705 Ga0070677_10065200
706 Ga0068869_100000015
707 Ga0068869_100002201
708 Ga0068869_100062865
709 Ga0068869_100106920
710 Ga0070666_10004660
711 Ga0070666_10007302
712 Ga0070666_10043797
713 Ga0070666_10125394
714 Ga0070680_100076175
715 Ga0070682_100034114
716 Ga0068868_100009210
717 Ga0068868_100042789
718 Ga0070660_100002915
719 Ga0070660_100082035
720 Ga0070689_100005372
721 Ga0070689_100082743
722 Ga0070691_10042784
723 Ga0070691_10134633
724 Ga0070687_100020180
725 Ga0070687_100031090
726 Ga0070661_100000805
727 Ga0070661_100022771
728 Ga0070661_100025944
729 Ga0070661_100029411
730 Ga0070692_10036660
731 Ga0070668_100010899
732 Ga0070668_100020939
733 Ga0070668_100154046
734 Ga0070668_100237350
735 Ga0070669_100011044
736 Ga0070669_100033855
737 Ga0070675_100000744
738 Ga0070675_100024728
739 Ga0070675_100186310
740 Ga0070675_100188061
741 Ga0070675_100203065
742 Ga0070675_100314878
743 Ga0070675_100438498
744 Ga0070675_100486242
745 Ga0070671_100000582
746 Ga0070671_100015873
747 Ga0070671_100024650
748 Ga0070671_100075957
749 Ga0070671_100109782
750 Ga0070674_100019302
751 Ga0070674_100140368
752 Ga0070674_100214945
753 Ga0070673_100003212
754 Ga0070673_100003995
755 Ga0070673_100014455
756 Ga0070688_100009208
757 Ga0070688_100016719
758 Ga0070659_100008341
759 Ga0070659_100013711
760 Ga0070659_100023032
761 Ga0070667_100001141
762 Ga0070667_100011134
763 Ga0070667_100092379
764 Ga0070709_10011270
765 Ga0070714_100009841
766 Ga0070714_100124498
767 Ga0070713_100000033
768 Ga0070713_100002027
769 Ga0070713_100072598
770 Ga0070701_10072679
771 Ga0070701_10101134
772 Ga0070711_100000713
773 Ga0070711_100133826
774 Ga0070700_100013819
775 Ga0070700_100166442
776 Ga0070694_100009891
777 Ga0070708_100000422
778 Ga0070708_100042643
779 Ga0070663_100001047
780 Ga0070678_100004176
781 Ga0070678_100017415
782 Ga0070678_100236085
783 Ga0070678_100356090
784 Ga0070678_100403334
785 Ga0070662_100000894
786 Ga0070662_100152028
787 Ga0070681_10006378
788 Ga0068867_100011065
789 Ga0068867_100023978
790 Ga0068867_100165378
791 Ga0068867_100364883
792 Ga0068867_100471509
793 Ga0070685_10002258
794 Ga0070685_10005847
795 Ga0070685_10016782
796 Ga0070706_100059151
797 Ga0070706_100089278
798 Ga0070698_100247110
799 Ga0070699_100025242
800 Ga0070679_100004423
801 Ga0070684_100009130
802 Ga0070684_100092199
803 Ga0070684_100102032
804 Ga0070697_100082861
805 Ga0070697_100083792
806 Ga0070697_100154449
807 Ga0068853_100004985
808 Ga0068853_100010718
809 Ga0068853_100101952
810 Ga0070672_100000799
811 Ga0070672_100002210
812 Ga0070672_100004841
813 Ga0070672_100004852
814 Ga0070672_100096738
815 Ga0070672_100281344
816 Ga0070686_100003766
817 Ga0070695_100064127
818 Ga0070696_100035972
819 Ga0070696_100082121
820 Ga0070693_100002360
821 Ga0070693_100030679
822 Ga0070665_100001730
823 Ga0070665_100009440
824 Ga0070665_100044092
825 Ga0070665_100061042
826 Ga0070665_100106411
827 Ga0070704_100080462
828 Ga0070704_100087662
829 Ga0068855_100001384
830 Ga0068855_100002143
831 Ga0068855_100060650
832 Ga0068855_100076361
833 Ga0068855_100165190
834 Ga0068855_100183666
835 Ga0070664_100000463
836 Ga0070664_100001450
837 Ga0070664_100025574
838 Ga0070664_100035821
839 Ga0070664_100066709
840 Ga0070664_100075182
841 Ga0070664_100184428
842 Ga0068857_100037733
843 Ga0068857_100087741
844 Ga0068857_100105884
845 Ga0068857_100227872
846 Ga0068857_100245424
847 Ga0068857_100443251
848 Ga0068854_100001439
849 Ga0068854_100014339
850 Ga0068854_100024462
851 Ga0068854_100070575
852 Ga0068854_100152745
853 Ga0068856_100000265
854 Ga0068856_100001465
855 Ga0068856_100012505
856 Ga0068856_100059053
857 Ga0068856_100174117
858 Ga0070702_100006801
859 Ga0070702_100009038
860 Ga0068852_100000730
861 Ga0068852_100005033
862 Ga0068852_100014714
863 Ga0068852_100209758
864 Ga0068859_100000217
865 Ga0068859_100011269
866 Ga0068859_100015640
867 Ga0068859_100064889
868 Ga0068859_100083080
869 Ga0068859_100134951
870 Ga0068864_100002249
871 Ga0068864_100005142
872 Ga0068864_100005412
873 Ga0068864_100010891
874 Ga0068864_100031035
875 Ga0068864_100110465
876 Ga0068864_100122338
877 Ga0068864_100324379
878 Ga0068866_10007095
879 Ga0068866_10033536
880 Ga0068861_100000795
881 Ga0068861_100021864
882 Ga0068861_100162614
883 Ga0068851_10033611
884 Ga0068851_10076246
885 Ga0068870_10049411
886 Ga0068863_100000555
887 Ga0068863_100003997
888 Ga0068863_100014834
889 Ga0068863_100047672
890 Ga0068863_100048400
891 Ga0068863_100132517
892 Ga0068863_100235984
893 Ga0068863_100337794
894 Ga0068858_100001816
895 Ga0068858_100003829
896 Ga0068858_100004941
897 Ga0068858_100326401
898 Ga0068858_100401026
899 Ga0068860_100027571
900 Ga0068860_100119938
901 Ga0068860_100153247
902 Ga0068862_100019461
903 Ga0068862_100047443
904 Ga0068862_100096383
905 Ga0068862_100163748
906 Ga0068862_100196129
907 Ga0070715_10007607
908 Ga0070716_100007690
909 Ga0070712_100001191
910 Ga0070712_100033442
911 Ga0070712_100318940
912 Ga0097621_100000380
913 Ga0097621_100021138
914 Ga0097621_100138253
915 Ga0097621_100151376
916 Ga0068871_100002210
917 Ga0068871_100049561
918 Ga0068871_100078548
919 Ga0075428_100323223
920 Ga0075434_100052492
921 Ga0068865_100090034
922 Ga0075436_100023394
923 Ga0097620_100000217
924 Ga0097620_100011270
925 Ga0097620_100015640
926 Ga0097620_100064888
927 Ga0097620_100083076
928 Ga0097620_100134958
929 Ga0075435_100065549
930 Ga0075435_100129659
931 Ga0105240_10013674
932 Ga0105240_10015401
933 Ga0105240_10071201
934 Ga0111539_10022948
935 Ga0111539_10062939
936 Ga0105245_10057551
937 Ga0105245_10079908
938 Ga0105245_10457103
939 Ga0114129_10133684
940 Ga0105243_10032242
941 Ga0105243_10058772
942 Ga0105241_10025668
943 Ga0105241_10026233
944 Ga0105242_10140093
945 Ga0105242_10142996
946 Ga0105248_10002088
947 Ga0105248_10005492
948 Ga0105248_10017533
949 Ga0105248_10071480
950 Ga0105237_10011201
951 Ga0105237_10049934
952 Ga0105238_10001144
953 Ga0105238_10282655
954 Ga0105249_10088282
955 Ga0105249_10097015
956 Ga0105249_10150639
957 Ga0105249_10403415
958 Ga0105239_10096901
959 Ga0105246_10036277
960 Ga0105246_10070995
961 Ga0157373_10000321
962 Ga0157371_10000470
963 Ga0157370_10010349
964 Ga0157370_10049477
965 Ga0157370_10079668
966 Ga0157369_10043885
967 Ga0157369_10055599
968 Ga0157374_10005410
969 Ga0157374_10076797
970 Ga0157378_10037886
971 Ga0157378_10049224
972 Ga0157378_10158411
973 Ga0163162_10023867
974 Ga0163162_10030510
975 Ga0163162_10356845
976 Ga0157372_10002246
977 Ga0157372_10003708
978 Ga0157372_10035168
979 Ga0157372_10170934
980 Ga0157375_10001474
981 Ga0157375_10003344
982 Ga0157375_10054697
983 Ga0157375_10135240
984 Ga0157375_10295113
985 Ga0163163_10003415
986 Ga0163163_10009489
987 Ga0163163_10033033
988 Ga0163163_10107403
989 Ga0163163_10117485
990 Ga0163163_10362339
991 Ga0157380_10006867
992 Ga0157380_10017728
993 Ga0157380_10091229
994 Ga0157380_10116223
995 Ga0157380_10335901
996 Ga0157377_10006371
997 Ga0157379_10000045
998 Ga0157379_10003051
999 Ga0157379_10019143
1000 Ga0157379_10025288
1001 Ga0157379_10103736
1002 Ga0157379_10160726
1003 Ga0157376_10003796
1004 Ga0157376_10016232
1005 Ga0157376_10023919
1006 Ga0157376_10207569
1007 Ga0163161_10114847
1008 Ga0207697_10000647
1009 Ga0207697_10006354
1010 Ga0207692_10013963
1011 Ga0207692_10089127
1012 Ga0207688_10001186
1013 Ga0207680_10003490
1014 Ga0207680_10017366
1015 Ga0207680_10017825
1016 Ga0207680_10073174
1017 Ga0207647_10104572
1018 Ga0207685_10011344
1019 Ga0207645_10001518
1020 Ga0207645_10001694
1021 Ga0207645_10010361
1022 Ga0207645_10023513
1023 Ga0207645_10074082
1024 Ga0207645_10120222
1025 Ga0207645_10203301
1026 Ga0207643_10000408
1027 Ga0207643_10008780
1028 Ga0207643_10015354
1029 Ga0207643_10033800
1030 Ga0207705_10167009
1031 Ga0207684_10111550
1032 Ga0207684_10298772
1033 Ga0207707_10020712
1034 Ga0207707_10067330
1035 Ga0207671_10100347
1036 Ga0207693_10000459
1037 Ga0207693_10045211
1038 Ga0207693_10089841
1039 Ga0207663_10001764
1040 Ga0207663_10150415
1041 Ga0207662_10071825
1042 Ga0207662_10245708
1043 Ga0207657_10007048
1044 Ga0207657_10008686
1045 Ga0207657_10013039
1046 Ga0207657_10087651
1047 Ga0207657_10111632
1048 Ga0207649_10002022
1049 Ga0207649_10073423
1050 Ga0207649_10079360
1051 Ga0207649_10243026
1052 Ga0207649_10243912
1053 Ga0207652_10062059
1054 Ga0207646_10013355
1055 Ga0207681_10019347
1056 Ga0207681_10055878
1057 Ga0207681_10059955
1058 Ga0207681_10191344
1059 Ga0207694_10123431
1060 Ga0207694_10184192
1061 Ga0207650_10003654
1062 Ga0207650_10005628
1063 Ga0207650_10035449
1064 Ga0207650_10098991
1065 Ga0207650_10162384
1066 Ga0207659_10000917
1067 Ga0207659_10042599
1068 Ga0207659_10200702
1069 Ga0207659_10368083
1070 Ga0207687_10003000
1071 Ga0207687_10015981
1072 Ga0207700_10000099
1073 Ga0207700_10080496
1074 Ga0207664_10000714
1075 Ga0207644_10005753
1076 Ga0207644_10007760
1077 Ga0207644_10029427
1078 Ga0207644_10029725
1079 Ga0207644_10061636
1080 Ga0207644_10066877
1081 Ga0207690_10000395
1082 Ga0207690_10028571
1083 Ga0207706_10000002
1084 Ga0207706_10004229
1085 Ga0207706_10009673
1086 Ga0207706_10054144
1087 Ga0207706_10119836
1088 Ga0207706_10159500
1089 Ga0207686_10002984
1090 Ga0207670_10193251
1091 Ga0207669_10010364
1092 Ga0207669_10051736
1093 Ga0207669_10055732
1094 Ga0207704_10118068
1095 Ga0207691_10000289
1096 Ga0207691_10001774
1097 Ga0207691_10002924
1098 Ga0207691_10013170
1099 Ga0207691_10048947
1100 Ga0207691_10118089
1101 Ga0207691_10139208
1102 Ga0207691_10167269
1103 Ga0207691_10170725
1104 Ga0207691_10311616
1105 Ga0207711_10000626
1106 Ga0207711_10023650
1107 Ga0207711_10032983
1108 Ga0207711_10055857
1109 Ga0207711_10262887
1110 Ga0207711_10361199
1111 Ga0207711_10377412
1112 Ga0207689_10000030
1113 Ga0207689_10001070
1114 Ga0207689_10006324
1115 Ga0207689_10036408
1116 Ga0207689_10044397
1117 Ga0207661_10019933
1118 Ga0207679_10002497
1119 Ga0207679_10027370
1120 Ga0207679_10041280
1121 Ga0207679_10047151
1122 Ga0207679_10222542
1123 Ga0207667_10007019
1124 Ga0207667_10009304
1125 Ga0207667_10013669
1126 Ga0207667_10153948
1127 Ga0207651_10000481
1128 Ga0207651_10030522
1129 Ga0207651_10035000
1130 Ga0207651_10064453
1131 Ga0207651_10145304
1132 Ga0207651_10450688
1133 Ga0207712_10071072
1134 Ga0207668_10008267
1135 Ga0207668_10010950
1136 Ga0207668_10184698
1137 Ga0207668_10187356
1138 Ga0207640_10003226
1139 Ga0207640_10041249
1140 Ga0207640_10079280
1141 Ga0207640_10231410
1142 Ga0207658_10026998
1143 Ga0207658_10031271
1144 Ga0207658_10163509
1145 Ga0207658_10236545
1146 Ga0207677_10000359
1147 Ga0207677_10005047
1148 Ga0207677_10147717
1149 Ga0207677_10218379
1150 Ga0207677_10267906
1151 Ga0207703_10000143
1152 Ga0207703_10000739
1153 Ga0207703_10008651
1154 Ga0207703_10011513
1155 Ga0207703_10245080
1156 Ga0207639_10000715
1157 Ga0207639_10073681
1158 Ga0207639_10258975
1159 Ga0207639_10312147
1160 Ga0207678_10003128
1161 Ga0207678_10013857
1162 Ga0207678_10124128
1163 Ga0207678_10336262
1164 Ga0207708_10001050
1165 Ga0207702_10000810
1166 Ga0207702_10010048
1167 Ga0207702_10042630
1168 Ga0207702_10229475
1169 Ga0207702_10438528
1170 Ga0207641_10003914
1171 Ga0207641_10007133
1172 Ga0207641_10012868
1173 Ga0207641_10027328
1174 Ga0207641_10037085
1175 Ga0207641_10122306
1176 Ga0207641_10253936
1177 Ga0207641_10273955
1178 Ga0207641_10321294
1179 Ga0207648_10000539
1180 Ga0207648_10001652
1181 Ga0207648_10016549
1182 Ga0207648_10020535
1183 Ga0207648_10053330
1184 Ga0207648_10139665
1185 Ga0207676_10001145
1186 Ga0207676_10001668
1187 Ga0207676_10013373
1188 Ga0207676_10055115
1189 Ga0207676_10092821
1190 Ga0207674_10002105
1191 Ga0207674_10002729
1192 Ga0207674_10004765
1193 Ga0207674_10031789
1194 Ga0207674_10117150
1195 Ga0207675_100006689
1196 Ga0207675_100008050
1197 Ga0207675_100019964
1198 Ga0207675_100353398
1199 Ga0207683_10001151
1200 Ga0207683_10002860
1201 Ga0207683_10007956
1202 Ga0207683_10013876
1203 Ga0207683_10033596
1204 Ga0207683_10073352
1205 Ga0207683_10155238
1206 Ga0207683_10270924
1207 Ga0207698_10004156
1208 Ga0207698_10005501
1209 Ga0207698_10018940
1210 Ga0207698_10090874
1211 Ga0209995_1003188
1212 Ga0209968_1004849
1213 Ga0209999_1004165
1214 Ga0209970_1007485
1215 Ga0209983_1003360
1216 Ga0209971_1002639
1217 Ga0209971_1018102
1218 Ga0209966_1014938
1219 Ga0209974_10003152
1220 Ga0209974_10004146
1221 Ga0268266_10004145
1222 Ga0268266_10007102
1223 Ga0268266_10031998
1224 Ga0268266_10155337
1225 Ga0268265_10181167
1226 Ga0268265_10276294
1227 Ga0268265_10326891
1228 Ga0268264_10000502
1229 Ga0268264_10007973
1230 Ga0268264_10014839
1231 Ga0268264_10107102
1232 Ga0268264_10113180
1233 Ga0307515_10143122
1234 Ga0265330_10002781
1235 Ga0265332_10000594
1236 Ga0265329_10002431
1237 Ga0265331_10000796
1238 Ga0265316_10010150
1239 Ga0307408_100016172
1240 Ga0307408_100285753
1241 Ga0265314_10023442
1242 Ga0265342_10017976
1243 Ga0307405_10004325
1244 Ga0307405_10025362
1245 Ga0307413_10034389
1246 Ga0307413_10035282
1247 Ga0307410_10005764
1248 Ga0307410_10007259
1249 Ga0307410_10031993
1250 Ga0307406_10001568
1251 Ga0307406_10057002
1252 Ga0307407_10031427
1253 Ga0307407_10034426
1254 Ga0307407_10120676
1255 Ga0307412_10118292
1256 Ga0307409_100028116
1257 Ga0307409_100029398
1258 Ga0307409_100071603
1259 Ga0307416_100005440
1260 Ga0307416_100014006
1261 Ga0307416_100322534
1262 Ga0307414_10007939
1263 Ga0307414_10344315
1264 Ga0307411_10021204
1265 Ga0307411_10101980
1266 Ga0307415_100062900
1267 Ga0373934_0006473
1268 Ga0373945_0022046
1269 Ga0373956_0014328
1270 Ga0373957_0021486
1271 Ga0373943_0035808
1272 Ga0373946_0017110
1273 Ga0373946_0135653
1274 Ga0373955_0013832
1275 Ga0373924_0002145
1276 Ga0373924_0023099
1277 Ga0373931_0093326
1278 Ga0373935_0050364
1279 Ga0373927_0002996
1280 Ga0373927_0012616
1281 Ga0373927_0052098
1282 Ga0373927_0244866
1283 Ga0373933_0002724
1284 Ga0373933_0120619
1285 Ga0373947_0132508
1286 Ga0373937_0008308
1287 Ga0373937_0010034
1288 Ga0373937_0111756
1289 Ga0373937_0126683
1290 Ga0373937_0183905
1291 Ga0373925_0015742
1292 Ga0373925_0099124
1293 Ga0450890_002056
1294 Ga0450893_0015470
1295 Ga0466963_0189496
1296 Ga0466960_0158474
1297 Ga0495603_0034364
1298 Ga0495629_0008811
1299 Ga0495651_0036433
1300 Ga0495580_0007839
1301 Ga0495580_0035431
1302 Ga0495580_0070262
1303 Ga0495580_0070377
1304 Ga0495639_0001280
1305 Ga0495664_0030990
1306 Ga0495594_0115047
1307 Ga0495628_0129512
1308 Ga0495630_0095805
1309 Ga0495598_0036624
1310 Ga0495621_0028224
1311 Ga0495645_0012937
1312 Ga0495667_0134343
1313 Ga0495659_0108892
1314 Ga0495647_0001465
1315 Ga0495669_0062862
1316 Ga0495669_0088273
1317 Ga0495613_0126839
1318 Ga0495649_0003175
1319 Ga0495589_0059682
1320 Ga0495581_0025946
1321 Ga0495683_0029298
1322 Ga0495675_0040339
1323 Ga0495684_0085251
1324 Ga0495593_0042088
1325 Ga0496101_0413094
1326 Ga0496102_0001095
1327 Ga0496102_0024334
1328 Ga0496102_0109236
1329 Ga0496103_0015871
1330 Ga0496103_0102549
1331 Ga0496104_0006807
1332 Ga0496104_0010734
1333 Ga0496105_0039618
1334 Ga0496106_0000553
1335 Ga0496106_0095006
1336 Ga0496107_0012868
1337 Ga0496107_0044086
1338 Ga0496107_0045897
1339 Ga0496108_0011684
1340 Ga0496108_0039141
1341 Ga0496108_0103797
1342 Ga0496109_0068056
1343 Ga0496109_0113438
1344 Ga0496109_0141614
1345 Ga0496109_0143453
1346 Ga0496110_0102795
1347 Ga0496110_0111187
1348 Ga0496112_0010658
1349 Ga0496112_0072257
1350 Ga0496113_0082287
1351 Ga0496114_0098949
1352 Ga0496114_0174696
1353 Ga0501043_0236752
1354 Ga0501047_0088005
1355 Ga0501071_0280174
1356 Ga0501045_0242087
1357 nmdc:mga05p37_176739_c1
1358 nmdc:mga08y16_69935_c1
1359 nmdc:mga0n895_201890_c1
1360 nmdc:mga0rr50_10129_c1
1361 Ga0495612_0071406
1362 Ga0495619_0033136
1363 Ga0495619_0269364
1364 2599103452
1365 2792840733
1366 2846953338
1367 2848858812
1368 8055228760

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF24827

95

281

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yw4-assembly1.cif.gz_A crystal structure of the succinylglutamate desuccinylase from chromobacterium violaceum, northeast structural genomics target cvr22. 0.7251 23 314
4tnu-assembly1.cif.gz_B human brain aspartoacylase mutant y231c complex with intermediate analog (n-phosphonomethyl-l-aspartate) 0.7185 38 318
3cdx-assembly1.cif.gz_A crystal structure of succinylglutamatedesuccinylase/aspartoacylase from rhodobacter sphaeroides 0.7176 26 314
3cdx-assembly1.cif.gz_C crystal structure of succinylglutamatedesuccinylase/aspartoacylase from rhodobacter sphaeroides 0.7075 26 313
3cdx-assembly1.cif.gz_B crystal structure of succinylglutamatedesuccinylase/aspartoacylase from rhodobacter sphaeroides 0.7058 26 314
ID Description Score Start End Superfamily
2bcoA02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.8211 246 307 2.40.50.630
2bcoA02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.787 246 307 2.40.50.630
af_P76215_1_322_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.7138 23 314 3.40.630.10
2qj8A00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.7134 26 314 3.40.630.10
3cdxD00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.6898 26 313 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A158D793-F1-model_v4 Succinylglutamate desuccinylase / aspartoacylase family protein 0.9958 1 319 GO:0005829
GO:0016788
GO:0046872
AF-A0A158D793-F1-model_v4 Succinylglutamate desuccinylase / aspartoacylase family protein 0.9927 1 319 GO:0005829
GO:0016788
GO:0046872
AF-A0A0M4KPF2-F1-model_v4 deleted 0.9925 2 314
AF-A0A356HK33-F1-model_v4 deleted 0.9914 250 314
AF-A0A1N7RS14-F1-model_v4 Succinate-semialdehyde dehydrogenase I, NADP-dependent (Modular protein) (EC 1.2.1.16) 0.9911 2 319 GO:0004777
GO:0009450
GO:0016788
GO:0046872

Map