F474975

General Info

Members Datasets Scaffolds Average Seq Length
683 321 653 295

Family's Representative Sequence

Representative Sequence 3300025298|Ga0209050_1000257|Ga0209050_100025786
Length 323
Sequence MRERLARQLIQDIDTTEGKNMTASKNPRVGFIGLGMMGHGMAKNLLAKGFPVSFVAHRNRSNLQDLLDAGASEQPTRAAVAVASDVVIICVTGSPQVEEIVYGTEGLLTAAAKGLTVIDTSTAEPASTARIRADFAARGVAFIDAPLARTPKEAEEGRLNTMVGAEQADFDRVRPVLAAFCENIFHVGPPGHGHVLKLINNMLAMTTAAAIAEATATAAKSGLSLQKLFEVISAGGVNSGIFQMMLGKTLQGDLAGLKFAIGNAQKDLRYYTHLTEMLPTTSFLAEAAHQSFVQAGNLGLGDKFIASLLEAQEKLNNVQIIPR

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
3 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
4 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
5 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
6 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
7 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
8 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
9 2738543012 Acidovorax sp. CF301 Isolate Unclassified
10 2738543013 Variovorax sp. BT01 Isolate Unclassified
11 2816332133 Acidovorax radicis 2721A Isolate Unclassified
12 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
13 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
14 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
15 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
16 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
17 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
18 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
19 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
20 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
21 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
24 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
25 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
26 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
27 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
28 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
29 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
30 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
31 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
32 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
33 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
34 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
55 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
56 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
57 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
87 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
88 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
89 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
90 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
127 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
128 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
129 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
130 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
131 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
132 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
133 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
136 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
141 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
144 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
198 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
199 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
200 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
201 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
204 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
205 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
208 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
209 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
210 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
211 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
212 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
213 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
214 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
215 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
217 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
218 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
219 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
220 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
223 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
224 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
225 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
226 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
227 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
228 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
229 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
230 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
231 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
232 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
233 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
234 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
235 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
236 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
237 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
238 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
239 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
240 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
241 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
242 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
243 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
244 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
245 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
246 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
247 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
248 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
249 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
250 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
251 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
252 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
253 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
254 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
255 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
256 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
257 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
258 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
259 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
260 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
261 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
262 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
263 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
264 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
265 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
266 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
267 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
268 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
269 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
270 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
271 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
272 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
273 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
274 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
281 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
282 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
283 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
284 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
285 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
286 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
287 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
288 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
289 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
290 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
291 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
292 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
293 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
294 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
295 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
296 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
297 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
298 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
299 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
300 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
301 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
302 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
303 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
304 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
305 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
306 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
307 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
308 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
309 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
310 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
311 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
312 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
313 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
314 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
315 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
316 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
317 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
318 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
319 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
320 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
321 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.1
Metatranscriptomes 0
Isolates 1.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.01
Nodule 0.15
Rhizoplane 1.02
Rhizosphere 68.52
Stem 0
Stem Tuber 0
Unclassified 6.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000009 3300002704 Bacteria 224358
2 JGI25156J39149_1000009 3300002705 Bacteria 224379
3 JGI25154J39366_1000024 3300002738 Bacteria 211372
4 JGI25157J39369_1000007 3300002741 Bacteria 224377
5 JGI25152J39213_1003177 3300002773 Bacteria 5718
6 JGI25150J39212_1017171 3300002774 Bacteria 1173
7 JGI25159J45721_1000402 3300002987 Bacteria 20189
8 JGI25159J45721_1000474 3300002987 Bacteria 18495
9 JGI25159J45721_1003869 3300002987 Bacteria 5132
10 JGI25151J46595_10002845 3300003187 Bacteria 9965
11 JGI25151J46595_10014225 3300003187 Bacteria 3552
12 JGI25151J46595_10017793 3300003187 Bacteria 3069
13 JGI25153J46596_10001286 3300003215 Bacteria 15041
14 JGI25153J46596_10003485 3300003215 Bacteria 8798
15 rootL2_10212273 3300003322 Bacteria 2091
16 rootH1_10066207 3300003323 Bacteria 2230
17 JGI25160J50197_1000117 3300003354 Bacteria 72240
18 JGI25160J50197_1000240 3300003354 Bacteria 42558
19 JGI25161J50226_1000009 3300003374 Bacteria 224699
20 Ga0055526_1001550 3300003771 Bacteria 16263
21 Ga0055526_1003249 3300003771 Bacteria 10465
22 Ga0055526_1007405 3300003771 Bacteria 5710
23 Ga0055537_1000020 3300003773 Bacteria 117325
24 Ga0055524_1000047 3300003775 Bacteria 150887
25 Ga0055524_1000143 3300003775 Bacteria 84686
26 Ga0055534_1000901 3300003784 Bacteria 13451
27 Ga0055534_1000967 3300003784 Bacteria 12750
28 Ga0055534_1003852 3300003784 Bacteria 4578
29 Ga0055528_1000812 3300003790 Bacteria 21450
30 Ga0055528_1000973 3300003790 Bacteria 19015
31 Ga0055530_10000252 3300003791 Bacteria 48125
32 Ga0055540_1000027 3300003792 Bacteria 187454
33 Ga0055531_10001909 3300003794 Bacteria 14594
34 Ga0055531_10008317 3300003794 Bacteria 5499
35 Ga0055543_1000199 3300004625 Bacteria 49097
36 Ga0055543_1001706 3300004625 Bacteria 8290
37 Ga0065165_1000832 3300005262 Bacteria 40569
38 Ga0065165_1010769 3300005262 Bacteria 3903
39 Ga0065165_1011728 3300005262 Bacteria 3621
40 Ga0065165_1021619 3300005262 Bacteria 2229
41 Ga0070690_100001392 3300005330 Bacteria 12605
42 Ga0070690_100020078 3300005330 Bacteria 4067
43 Ga0070690_100157446 3300005330 Bacteria 1554
44 Ga0070670_100035710 3300005331 Bacteria 4278
45 Ga0070670_100080828 3300005331 Bacteria 2793
46 Ga0070670_100451391 3300005331 Bacteria 1139
47 Ga0070677_10051187 3300005333 Bacteria 1671
48 Ga0070677_10052777 3300005333 Bacteria 1651
49 Ga0070677_10098565 3300005333 Bacteria 1284
50 Ga0068869_100000631 3300005334 Bacteria 19900
51 Ga0068869_100024865 3300005334 Bacteria 4152
52 Ga0068869_100025542 3300005334 Bacteria 4103
53 Ga0068869_100038558 3300005334 Bacteria 3407
54 Ga0068869_100399917 3300005334 Bacteria 1130
55 Ga0070666_10013495 3300005335 Bacteria 5185
56 Ga0070680_100121813 3300005336 Bacteria 2178
57 Ga0068868_100001100 3300005338 Bacteria 18486
58 Ga0068868_100247837 3300005338 Bacteria 1498
59 Ga0070689_100003108 3300005340 Bacteria 10962
60 Ga0070689_100064767 3300005340 Bacteria 2846
61 Ga0070689_100094251 3300005340 Bacteria 2364
62 Ga0070689_100142447 3300005340 Bacteria 1928
63 Ga0070661_100141193 3300005344 Bacteria 1815
64 Ga0070668_100029973 3300005347 Bacteria 4134
65 Ga0070668_100248896 3300005347 Bacteria 1475
66 Ga0070669_100148065 3300005353 Bacteria 1815
67 Ga0070669_100178964 3300005353 Bacteria 1658
68 Ga0070675_100000422 3300005354 Bacteria 28826
69 Ga0070675_100022267 3300005354 Bacteria 5062
70 Ga0070675_100028908 3300005354 Bacteria 4466
71 Ga0070675_100044916 3300005354 Bacteria 3614
72 Ga0070675_100078392 3300005354 Bacteria 2751
73 Ga0070671_100022045 3300005355 Bacteria 5203
74 Ga0070671_100071674 3300005355 Bacteria 2892
75 Ga0070671_100216592 3300005355 Bacteria 1624
76 Ga0070671_100338824 3300005355 Bacteria 1282
77 Ga0070671_100417755 3300005355 Bacteria 1148
78 Ga0070671_100525477 3300005355 Bacteria 1019
79 Ga0070674_100014175 3300005356 Bacteria 4949
80 Ga0070674_100201383 3300005356 Bacteria 1538
81 Ga0070674_100332471 3300005356 Bacteria 1221
82 Ga0070673_100033758 3300005364 Bacteria 3866
83 Ga0070673_100074690 3300005364 Bacteria 2732
84 Ga0070673_100286302 3300005364 Bacteria 1447
85 Ga0070673_100293410 3300005364 Bacteria 1430
86 Ga0070688_100004402 3300005365 Bacteria 7323
87 Ga0070688_100137504 3300005365 Bacteria 1656
88 Ga0070688_100205502 3300005365 Unclassified 1380
89 Ga0070688_100383276 3300005365 Bacteria 1037
90 Ga0070659_100129605 3300005366 Bacteria 2047
91 Ga0070667_100030592 3300005367 Bacteria 4490
92 Ga0070667_100519500 3300005367 Bacteria 1093
93 Ga0070714_100011248 3300005435 Bacteria 7094
94 Ga0070713_100001288 3300005436 Bacteria 16024
95 Ga0070713_100071478 3300005436 Bacteria 2932
96 Ga0070701_10000512 3300005438 Bacteria 13327
97 Ga0070700_100000680 3300005441 Bacteria 16817
98 Ga0070663_100059886 3300005455 Bacteria 2737
99 Ga0070663_100243759 3300005455 Bacteria 1420
100 Ga0070678_100010764 3300005456 Bacteria 5604
101 Ga0070678_100011176 3300005456 Bacteria 5528
102 Ga0070678_100097297 3300005456 Bacteria 2272
103 Ga0070678_100109843 3300005456 Bacteria 2155
104 Ga0070678_100126120 3300005456 Bacteria 2026
105 Ga0070678_100223377 3300005456 Bacteria 1566
106 Ga0070678_100233510 3300005456 Bacteria 1534
107 Ga0070678_100311266 3300005456 Bacteria 1342
108 Ga0070662_100463964 3300005457 Bacteria 1053
109 Ga0070681_10120812 3300005458 Bacteria 2555
110 Ga0068867_100002384 3300005459 Bacteria 13215
111 Ga0068867_100016098 3300005459 Bacteria 5310
112 Ga0068867_100053004 3300005459 Bacteria 2995
113 Ga0068867_100109642 3300005459 Bacteria 2119
114 Ga0068867_100400886 3300005459 Bacteria 1157
115 Ga0070706_100025761 3300005467 Bacteria 5412
116 Ga0068853_100067941 3300005539 Bacteria 3098
117 Ga0070672_100007566 3300005543 Bacteria 7383
118 Ga0070672_100050232 3300005543 Bacteria 3247
119 Ga0070672_100124469 3300005543 Bacteria 2113
120 Ga0070672_100290757 3300005543 Bacteria 1383
121 Ga0070686_100000973 3300005544 Bacteria 16512
122 Ga0070696_100023215 3300005546 Bacteria 4215
123 Ga0070696_100038871 3300005546 Bacteria 3285
124 Ga0070693_100005977 3300005547 Bacteria 5883
125 Ga0070693_100128489 3300005547 Bacteria 1581
126 Ga0070665_100005277 3300005548 Bacteria 13348
127 Ga0070665_100053168 3300005548 Bacteria 4062
128 Ga0070665_100386108 3300005548 Bacteria 1408
129 Ga0070704_100138497 3300005549 Bacteria 1897
130 Ga0070664_100249396 3300005564 Bacteria 1595
131 Ga0068857_100178986 3300005577 Bacteria 1929
132 Ga0068854_100038140 3300005578 Bacteria 3377
133 Ga0070702_100001461 3300005615 Bacteria 9684
134 Ga0068852_100236236 3300005616 Bacteria 1745
135 Ga0068859_100004520 3300005617 Bacteria 14187
136 Ga0068859_100014408 3300005617 Bacteria 7933
137 Ga0068859_100139094 3300005617 Bacteria 2502
138 Ga0068859_100242938 3300005617 Bacteria 1890
139 Ga0068859_100278097 3300005617 Bacteria 1766
140 Ga0068864_100001444 3300005618 Bacteria 19588
141 Ga0068864_100021397 3300005618 Bacteria 5419
142 Ga0068866_10000632 3300005718 Bacteria 15998
143 Ga0068866_10009776 3300005718 Bacteria 4086
144 Ga0068861_100001526 3300005719 Bacteria 14664
145 Ga0068861_100004985 3300005719 Bacteria 8946
146 Ga0068861_100219964 3300005719 Bacteria 1604
147 Ga0068861_100649709 3300005719 Bacteria 974
148 Ga0068851_10034595 3300005834 Bacteria 2523
149 Ga0068851_10126681 3300005834 Bacteria 1377
150 Ga0068870_10010668 3300005840 Bacteria 4228
151 Ga0068863_100031771 3300005841 Bacteria 5037
152 Ga0068863_100067070 3300005841 Bacteria 3395
153 Ga0068863_100189823 3300005841 Bacteria 1974
154 Ga0068863_100308542 3300005841 Bacteria 1536
155 Ga0068858_100000436 3300005842 Bacteria 43518
156 Ga0068858_100022445 3300005842 Bacteria 5890
157 Ga0068858_100168829 3300005842 Bacteria 2062
158 Ga0068858_100265785 3300005842 Bacteria 1632
159 Ga0068858_100395282 3300005842 Bacteria 1328
160 Ga0068860_100001387 3300005843 Bacteria 26293
161 Ga0068860_100040991 3300005843 Bacteria 4424
162 Ga0068860_100126878 3300005843 Bacteria 2446
163 Ga0068860_100656792 3300005843 Bacteria 1057
164 Ga0068862_100002384 3300005844 Bacteria 16717
165 Ga0068862_100010800 3300005844 Bacteria 7541
166 Ga0068862_100036607 3300005844 Bacteria 4160
167 Ga0068862_100305111 3300005844 Bacteria 1465
168 Ga0081539_10017821 3300005985 Bacteria 4961
169 Ga0070717_10213025 3300006028 Bacteria 1696
170 Ga0075365_10168002 3300006038 Bacteria 1531
171 Ga0075365_10260821 3300006038 Bacteria 1218
172 Ga0075363_100012169 3300006048 Bacteria 4140
173 Ga0075364_10009318 3300006051 Bacteria 5883
174 Ga0075364_10070091 3300006051 Bacteria 2307
175 Ga0070712_100024404 3300006175 Bacteria 4007
176 Ga0075367_10023806 3300006178 Bacteria 3449
177 Ga0075367_10184647 3300006178 Bacteria 1300
178 Ga0075366_10006732 3300006195 Bacteria 6311
179 Ga0075366_10010048 3300006195 Bacteria 5305
180 Ga0075366_10021481 3300006195 Bacteria 3752
181 Ga0075366_10025415 3300006195 Bacteria 3459
182 Ga0075366_10027699 3300006195 Bacteria 3326
183 Ga0075366_10104141 3300006195 Bacteria 1705
184 Ga0097621_100002825 3300006237 Bacteria 11902
185 Ga0097621_100005706 3300006237 Bacteria 8794
186 Ga0097621_100021589 3300006237 Bacteria 4984
187 Ga0097621_100027003 3300006237 Bacteria 4510
188 Ga0097621_100070706 3300006237 Bacteria 2882
189 Ga0097621_100389383 3300006237 Bacteria 1246
190 Ga0075370_10035330 3300006353 Bacteria 2805
191 Ga0075370_10120486 3300006353 Bacteria 1527
192 Ga0068871_100005154 3300006358 Bacteria 9137
193 Ga0068871_100018572 3300006358 Bacteria 5289
194 Ga0068871_100065570 3300006358 Bacteria 2974
195 Ga0068871_100161197 3300006358 Bacteria 1918
196 Ga0068871_100250503 3300006358 Bacteria 1542
197 Ga0075433_10056208 3300006852 Bacteria 3437
198 Ga0075433_10102717 3300006852 Bacteria 2532
199 Ga0075434_100041160 3300006871 Bacteria 4576
200 Ga0068865_100000305 3300006881 Bacteria 27101
201 Ga0068865_100000371 3300006881 Bacteria 24845
202 Ga0068865_100207539 3300006881 Bacteria 1524
203 Ga0075436_100023634 3300006914 Bacteria 4222
204 Ga0097620_100004520 3300006931 Bacteria 14187
205 Ga0097620_100014408 3300006931 Bacteria 7933
206 Ga0097620_100139088 3300006931 Bacteria 2502
207 Ga0097620_100242932 3300006931 Bacteria 1890
208 Ga0097620_100278110 3300006931 Bacteria 1766
209 Ga0079104_1012746 3300006946 Bacteria 2623
210 Ga0075435_100140160 3300007076 Bacteria 2028
211 Ga0105245_10008300 3300009098 Bacteria 9072
212 Ga0105245_10067086 3300009098 Bacteria 3249
213 Ga0114129_10126379 3300009147 Bacteria 3515
214 Ga0114129_10178343 3300009147 Bacteria 2892
215 Ga0114129_10686451 3300009147 Bacteria 1317
216 Ga0114129_10689742 3300009147 Bacteria 1314
217 Ga0105243_10004538 3300009148 Bacteria 10971
218 Ga0105243_10013136 3300009148 Bacteria 6259
219 Ga0105243_10090013 3300009148 Bacteria 2524
220 Ga0105243_10210349 3300009148 Bacteria 1712
221 Ga0105243_10290724 3300009148 Bacteria 1476
222 Ga0105241_10022246 3300009174 Bacteria 4694
223 Ga0105242_10001363 3300009176 Bacteria 19278
224 Ga0105242_10030898 3300009176 Bacteria 4278
225 Ga0105242_10097193 3300009176 Bacteria 2489
226 Ga0105242_10108408 3300009176 Bacteria 2363
227 Ga0105242_10358448 3300009176 Bacteria 1349
228 Ga0105242_10424242 3300009176 Bacteria 1247
229 Ga0105248_10018384 3300009177 Bacteria 7722
230 Ga0105248_10060749 3300009177 Bacteria 4243
231 Ga0105248_10124945 3300009177 Bacteria 2902
232 Ga0105248_10146496 3300009177 Bacteria 2664
233 Ga0105248_10205658 3300009177 Bacteria 2218
234 Ga0105248_10262630 3300009177 Bacteria 1944
235 Ga0105238_10344814 3300009551 Bacteria 1478
236 Ga0105249_10009105 3300009553 Bacteria 8683
237 Ga0105249_10045362 3300009553 Bacteria 3998
238 Ga0105249_10178096 3300009553 Bacteria 2067
239 Ga0105249_10199795 3300009553 Bacteria 1956
240 Ga0105239_10364228 3300010375 Bacteria 1633
241 Ga0157326_1001281 3300012513 Bacteria 2794
242 Ga0157326_1001965 3300012513 Bacteria 2232
243 Ga0157370_10145615 3300013104 Bacteria 2206
244 Ga0157374_10211848 3300013296 Bacteria 1900
245 Ga0157378_10001140 3300013297 Bacteria 24155
246 Ga0157378_10010272 3300013297 Bacteria 8174
247 Ga0157378_10177105 3300013297 Bacteria 2004
248 Ga0157378_10493944 3300013297 Bacteria 1221
249 Ga0163162_10000948 3300013306 Bacteria 26987
250 Ga0163162_10017890 3300013306 Bacteria 6933
251 Ga0163162_10525979 3300013306 Unclassified 1312
252 Ga0163162_10554114 3300013306 Bacteria 1278
253 Ga0157372_10531022 3300013307 Bacteria 1371
254 Ga0157375_10061001 3300013308 Bacteria 3742
255 Ga0157375_10134345 3300013308 Bacteria 2596
256 Ga0157375_10165231 3300013308 Bacteria 2358
257 Ga0157375_10183914 3300013308 Bacteria 2242
258 Ga0157375_10337114 3300013308 Bacteria 1673
259 Ga0157375_10365618 3300013308 Bacteria 1609
260 Ga0163163_10238443 3300014325 Bacteria 1868
261 Ga0163163_10262681 3300014325 Bacteria 1777
262 Ga0157380_10000449 3300014326 Bacteria 25167
263 Ga0157380_10034222 3300014326 Bacteria 3918
264 Ga0157380_10112856 3300014326 Bacteria 2287
265 Ga0157380_10175681 3300014326 Bacteria 1876
266 Ga0157380_10200827 3300014326 Bacteria 1769
267 Ga0157377_10003600 3300014745 Bacteria 7016
268 Ga0157379_10007509 3300014968 Bacteria 9437
269 Ga0157379_10020080 3300014968 Bacteria 5905
270 Ga0157379_10138739 3300014968 Bacteria 2191
271 Ga0157379_10241174 3300014968 Bacteria 1640
272 Ga0157376_10013138 3300014969 Bacteria 6170
273 Ga0157376_10024182 3300014969 Bacteria 4766
274 Ga0157376_10037162 3300014969 Bacteria 3950
275 Ga0157376_10074822 3300014969 Bacteria 2888
276 Ga0157376_10132229 3300014969 Bacteria 2228
277 Ga0157376_10342347 3300014969 Bacteria 1428
278 Ga0157376_10345028 3300014969 Bacteria 1423
279 Ga0157376_10496136 3300014969 Bacteria 1199
280 Ga0163161_10006676 3300017792 Bacteria 7987
281 Ga0163161_10190331 3300017792 Bacteria 1577
282 Ga0209435_100008 3300025206 Bacteria 503644
283 Ga0209435_100051 3300025206 Bacteria 90866
284 Ga0209436_109092 3300025208 Bacteria 1922
285 Ga0207425_1001920 3300025245 Bacteria 7843
286 Ga0207425_1002658 3300025245 Bacteria 6146
287 Ga0207425_1016265 3300025245 Bacteria 1653
288 Ga0209646_1000029 3300025246 Bacteria 386414
289 Ga0209026_1000016 3300025250 Bacteria 386457
290 Ga0209759_1000016 3300025256 Bacteria 386414
291 Ga0209129_1000075 3300025258 Bacteria 201273
292 Ga0209565_1000061 3300025263 Bacteria 185308
293 Ga0209565_1000122 3300025263 Bacteria 111132
294 Ga0209565_1000551 3300025263 Bacteria 26059
295 Ga0209565_1001661 3300025263 Bacteria 9294
296 Ga0209673_1000298 3300025273 Bacteria 91771
297 Ga0209673_1000302 3300025273 Bacteria 91221
298 Ga0209673_1003861 3300025273 Bacteria 8458
299 Ga0209673_1011939 3300025273 Bacteria 3539
300 Ga0209130_1000014 3300025284 Bacteria 412039
301 Ga0209130_1001940 3300025284 Bacteria 11488
302 Ga0209130_1004197 3300025284 Bacteria 5624
303 Ga0209130_1005309 3300025284 Bacteria 4519
304 Ga0209675_1000098 3300025291 Bacteria 130512
305 Ga0209675_1000105 3300025291 Bacteria 121013
306 Ga0209675_1001283 3300025291 Bacteria 14924
307 Ga0209675_1002955 3300025291 Bacteria 8385
308 Ga0209675_1003943 3300025291 Bacteria 6800
309 Ga0209675_1017807 3300025291 Bacteria 2015
310 Ga0209676_1000013 3300025292 Bacteria 816080
311 Ga0209676_1003560 3300025292 Bacteria 9415
312 Ga0209676_1006368 3300025292 Bacteria 5847
313 Ga0209676_1020092 3300025292 Bacteria 2278
314 Ga0209025_1009911 3300025294 Bacteria 6549
315 Ga0209025_1010306 3300025294 Bacteria 6350
316 Ga0209025_1013495 3300025294 Bacteria 5127
317 Ga0209025_1015171 3300025294 Bacteria 4670
318 Ga0209025_1025924 3300025294 Bacteria 2963
319 Ga0209025_1051898 3300025294 Bacteria 1624
320 Ga0209564_1000046 3300025295 Bacteria 373787
321 Ga0209564_1000181 3300025295 Bacteria 151002
322 Ga0209564_1000247 3300025295 Bacteria 116628
323 Ga0209564_1003446 3300025295 Bacteria 10818
324 Ga0209564_1007257 3300025295 Bacteria 5758
325 Ga0209564_1014320 3300025295 Bacteria 3307
326 Ga0209758_1000045 3300025297 Bacteria 369174
327 Ga0209758_1000052 3300025297 Bacteria 338962
328 Ga0209758_1014508 3300025297 Bacteria 4181
329 Ga0209758_1019783 3300025297 Bacteria 3226
330 Ga0209758_1044978 3300025297 Bacteria 1607
331 Ga0209050_1000008 3300025298 Bacteria 1144179
332 Ga0209050_1000257 3300025298 Bacteria 114186
333 Ga0209050_1006029 3300025298 Bacteria 7342
334 Ga0209050_1011391 3300025298 Bacteria 4224
335 Ga0209050_1022835 3300025298 Bacteria 2226
336 Ga0209050_1027531 3300025298 Bacteria 1871
337 Ga0209256_1000039 3300025299 Bacteria 372337
338 Ga0209256_1012968 3300025299 Bacteria 3133
339 Ga0209256_1030082 3300025299 Bacteria 1503
340 Ga0207426_1000224 3300025302 Bacteria 130233
341 Ga0207426_1000242 3300025302 Bacteria 122839
342 Ga0207426_1000816 3300025302 Bacteria 33430
343 Ga0209051_1000005 3300025303 Bacteria 1142353
344 Ga0209051_1009002 3300025303 Bacteria 5199
345 Ga0209051_1026527 3300025303 Bacteria 2332
346 Ga0209257_1000031 3300025304 Bacteria 688770
347 Ga0209257_1009089 3300025304 Bacteria 5433
348 Ga0209257_1011422 3300025304 Bacteria 4277
349 Ga0207682_10010395 3300025893 Bacteria 3648
350 Ga0207682_10012243 3300025893 Bacteria 3349
351 Ga0207682_10016949 3300025893 Bacteria 2844
352 Ga0207682_10027171 3300025893 Bacteria 2277
353 Ga0207642_10006840 3300025899 Bacteria 3816
354 Ga0207642_10050531 3300025899 Bacteria 1876
355 Ga0207688_10094510 3300025901 Bacteria 1720
356 Ga0207680_10068485 3300025903 Bacteria 2190
357 Ga0207699_10110131 3300025906 Bacteria 1763
358 Ga0207643_10028008 3300025908 Bacteria 3127
359 Ga0207643_10158274 3300025908 Bacteria 1361
360 Ga0207684_10014503 3300025910 Bacteria 6793
361 Ga0207707_10307111 3300025912 Bacteria 1371
362 Ga0207693_10056021 3300025915 Bacteria 3091
363 Ga0207693_10283297 3300025915 Bacteria 1299
364 Ga0207649_10363448 3300025920 Bacteria 1075
365 Ga0207646_10025948 3300025922 Bacteria 5356
366 Ga0207681_10112675 3300025923 Bacteria 1981
367 Ga0207650_10051820 3300025925 Bacteria 3038
368 Ga0207650_10084484 3300025925 Bacteria 2413
369 Ga0207650_10191225 3300025925 Bacteria 1635
370 Ga0207659_10000355 3300025926 Bacteria 27371
371 Ga0207659_10037234 3300025926 Bacteria 3376
372 Ga0207659_10048355 3300025926 Bacteria 3012
373 Ga0207659_10234719 3300025926 Bacteria 1481
374 Ga0207687_10000800 3300025927 Bacteria 21246
375 Ga0207700_10000605 3300025928 Bacteria 21017
376 Ga0207664_10000197 3300025929 Bacteria 45209
377 Ga0207644_10002035 3300025931 Bacteria 13083
378 Ga0207644_10010478 3300025931 Bacteria 6110
379 Ga0207644_10070047 3300025931 Bacteria 2562
380 Ga0207644_10070163 3300025931 Bacteria 2560
381 Ga0207690_10215328 3300025932 Bacteria 1467
382 Ga0207706_10039697 3300025933 Bacteria 4173
383 Ga0207706_10099167 3300025933 Bacteria 2563
384 Ga0207686_10002242 3300025934 Bacteria 10617
385 Ga0207686_10008362 3300025934 Bacteria 5586
386 Ga0207709_10005847 3300025935 Bacteria 6953
387 Ga0207709_10192695 3300025935 Bacteria 1449
388 Ga0207670_10036809 3300025936 Bacteria 3185
389 Ga0207670_10232786 3300025936 Bacteria 1415
390 Ga0207669_10262938 3300025937 Bacteria 1291
391 Ga0207704_10001417 3300025938 Bacteria 10719
392 Ga0207704_10035604 3300025938 Bacteria 2854
393 Ga0207704_10087355 3300025938 Bacteria 2036
394 Ga0207704_10141494 3300025938 Bacteria 1684
395 Ga0207704_10158074 3300025938 Bacteria 1609
396 Ga0207691_10015746 3300025940 Bacteria 7187
397 Ga0207691_10025614 3300025940 Bacteria 5537
398 Ga0207691_10026141 3300025940 Bacteria 5477
399 Ga0207691_10060236 3300025940 Bacteria 3450
400 Ga0207691_10102507 3300025940 Bacteria 2553
401 Ga0207691_10165763 3300025940 Bacteria 1936
402 Ga0207691_10211255 3300025940 Bacteria 1685
403 Ga0207711_10020774 3300025941 Bacteria 5479
404 Ga0207711_10075318 3300025941 Bacteria 2937
405 Ga0207711_10094429 3300025941 Bacteria 2636
406 Ga0207711_10176107 3300025941 Bacteria 1943
407 Ga0207711_10176970 3300025941 Bacteria 1938
408 Ga0207711_10377460 3300025941 Bacteria 1315
409 Ga0207689_10000642 3300025942 Bacteria 33355
410 Ga0207689_10005711 3300025942 Bacteria 11065
411 Ga0207689_10015983 3300025942 Bacteria 6351
412 Ga0207689_10016667 3300025942 Bacteria 6218
413 Ga0207689_10249644 3300025942 Bacteria 1467
414 Ga0207679_10320159 3300025945 Bacteria 1343
415 Ga0207679_10352316 3300025945 Bacteria 1284
416 Ga0207667_10115216 3300025949 Bacteria 2770
417 Ga0207651_10004523 3300025960 Bacteria 7024
418 Ga0207651_10104713 3300025960 Bacteria 2109
419 Ga0207651_10115232 3300025960 Bacteria 2026
420 Ga0207651_10194128 3300025960 Bacteria 1622
421 Ga0207712_10023687 3300025961 Bacteria 4055
422 Ga0207712_10071700 3300025961 Bacteria 2492
423 Ga0207668_10215518 3300025972 Bacteria 1538
424 Ga0207668_10229392 3300025972 Bacteria 1496
425 Ga0207640_10154406 3300025981 Bacteria 1690
426 Ga0207658_10004719 3300025986 Bacteria 9439
427 Ga0207658_10558772 3300025986 Bacteria 1025
428 Ga0207677_10002009 3300026023 Bacteria 10724
429 Ga0207677_10209541 3300026023 Bacteria 1555
430 Ga0207703_10015016 3300026035 Bacteria 6044
431 Ga0207703_10018805 3300026035 Bacteria 5395
432 Ga0207703_10059338 3300026035 Bacteria 3125
433 Ga0207639_10017559 3300026041 Bacteria 5074
434 Ga0207639_10086446 3300026041 Bacteria 2497
435 Ga0207639_10207533 3300026041 Bacteria 1684
436 Ga0207678_10034309 3300026067 Bacteria 4420
437 Ga0207678_10188691 3300026067 Bacteria 1761
438 Ga0207708_10000102 3300026075 Bacteria 64743
439 Ga0207708_10096364 3300026075 Bacteria 2286
440 Ga0207708_10125108 3300026075 Bacteria 2006
441 Ga0207641_10004003 3300026088 Bacteria 12856
442 Ga0207641_10612769 3300026088 Bacteria 1067
443 Ga0207648_10005941 3300026089 Bacteria 12211
444 Ga0207648_10011696 3300026089 Bacteria 8258
445 Ga0207648_10021357 3300026089 Bacteria 5819
446 Ga0207648_10022820 3300026089 Bacteria 5615
447 Ga0207648_10080674 3300026089 Bacteria 2838
448 Ga0207648_10088187 3300026089 Bacteria 2709
449 Ga0207648_10330737 3300026089 Bacteria 1371
450 Ga0207676_10002262 3300026095 Bacteria 13826
451 Ga0207676_10042018 3300026095 Bacteria 3514
452 Ga0207676_10110268 3300026095 Bacteria 2301
453 Ga0207674_10028836 3300026116 Bacteria 5851
454 Ga0207674_10319435 3300026116 Bacteria 1502
455 Ga0207675_100000527 3300026118 Bacteria 37150
456 Ga0207675_100009000 3300026118 Bacteria 9369
457 Ga0207675_100034360 3300026118 Bacteria 4727
458 Ga0207675_100160642 3300026118 Bacteria 2143
459 Ga0207683_10005679 3300026121 Bacteria 10698
460 Ga0207683_10019835 3300026121 Bacteria 5743
461 Ga0207683_10062016 3300026121 Bacteria 3292
462 Ga0207683_10154795 3300026121 Bacteria 2070
463 Ga0207698_10129657 3300026142 Bacteria 2152
464 Ga0207428_10016574 3300027907 Bacteria 6334
465 Ga0268266_10006738 3300028379 Bacteria 10476
466 Ga0268266_10129117 3300028379 Bacteria 2259
467 Ga0268266_10246227 3300028379 Bacteria 1652
468 Ga0268265_10009147 3300028380 Bacteria 6694
469 Ga0268264_10133224 3300028381 Bacteria 2206
470 Ga0268264_10721634 3300028381 Bacteria 991
471 Ga0307517_10072154 3300028786 Bacteria 3082
472 Ga0307517_10161776 3300028786 Bacteria 1500
473 Ga0307515_10000047 3300028794 Bacteria 291475
474 Ga0307515_10003694 3300028794 Bacteria 32127
475 Ga0307515_10029308 3300028794 Bacteria 9310
476 Ga0307511_10000036 3300030521 Bacteria 103249
477 Ga0265327_10000194 3300031251 Bacteria 129264
478 Ga0307513_10000013 3300031456 Bacteria 325682
479 Ga0307513_10000025 3300031456 Bacteria 202918
480 Ga0307513_10000194 3300031456 Bacteria 87921
481 Ga0307513_10000219 3300031456 Bacteria 82663
482 Ga0307513_10020743 3300031456 Bacteria 7780
483 Ga0307408_100004950 3300031548 Bacteria 8958
484 Ga0307408_100203326 3300031548 Bacteria 1605
485 Ga0307516_10004231 3300031730 Bacteria 17873
486 Ga0307516_10005929 3300031730 Bacteria 14458
487 Ga0307516_10021022 3300031730 Bacteria 6729
488 Ga0307413_10180440 3300031824 Bacteria 1505
489 Ga0307410_10352792 3300031852 Bacteria 1176
490 Ga0307406_10036044 3300031901 Bacteria 3045
491 Ga0307407_10060005 3300031903 Unclassified 2218
492 Ga0307407_10164558 3300031903 Bacteria 1455
493 Ga0307407_10312713 3300031903 Bacteria 1099
494 Ga0307412_10041991 3300031911 Bacteria 2968
495 Ga0307412_10073366 3300031911 Bacteria 2341
496 Ga0307409_100011985 3300031995 Bacteria 5500
497 Ga0307416_100002194 3300032002 Bacteria 11091
498 Ga0307416_100151740 3300032002 Bacteria 2126
499 Ga0307416_100159849 3300032002 Bacteria 2081
500 Ga0307416_100531985 3300032002 Bacteria 1246
501 Ga0307411_10055114 3300032005 Bacteria 2614
502 Ga0307411_10056654 3300032005 Bacteria 2585
503 Ga0307411_10206859 3300032005 Unclassified 1512
504 Ga0307415_100000510 3300032126 Bacteria 16914
505 Ga0307510_10000170 3300033180 Bacteria 55071
506 Ga0373955_0083037 3300035172 Bacteria 1814
507 Ga0373924_0020148 3300035410 Bacteria 2589
508 Ga0373935_0070484 3300035692 Bacteria 2254
509 Ga0373935_0319231 3300035692 Bacteria 1102
510 Ga0373927_0004742 3300035695 Bacteria 9472
511 Ga0373927_0051770 3300035695 Bacteria 2655
512 Ga0373933_0128933 3300035724 Bacteria 1589
513 Ga0373947_0011443 3300035725 Bacteria 5091
514 Ga0373937_0018936 3300036401 Bacteria 6156
515 Ga0373937_0051353 3300036401 Bacteria 3779
516 Ga0373937_0055964 3300036401 Bacteria 3622
517 Ga0373937_0056959 3300036401 Bacteria 3589
518 Ga0373937_0288174 3300036401 Bacteria 1551
519 Ga0373925_0044409 3300037068 Bacteria 3300
520 Ga0373925_0063380 3300037068 Bacteria 2781
521 Ga0373925_0411574 3300037068 Bacteria 1104
522 Ga0373925_0411885 3300037068 Bacteria 1103
523 Ga0395905_0006927 3300037471 Bacteria 11332
524 Ga0439436_0000196 3300041404 Bacteria 14457
525 Ga0439447_009378 3300041407 Bacteria 2973
526 Ga0439466_0011953 3300041411 Bacteria 3206
527 Ga0439465_0005369 3300041413 Bacteria 4087
528 Ga0451789_0778680 3300041443 Bacteria 1579
529 Ga0451789_1210807 3300041443 Bacteria 1692
530 Ga0451793_0513185 3300041452 Bacteria 2152
531 Ga0451841_0450575 3300041498 Bacteria 1121
532 Ga0451849_0159593 3300041505 Bacteria 1109
533 Ga0451853_1120642 3300041512 Bacteria 1663
534 Ga0439431_0000556 3300041997 Bacteria 7908
535 Ga0439431_0004971 3300041997 Bacteria 2929
536 Ga0439433_0000436 3300041999 Bacteria 7637
537 Ga0439445_0003662 3300042004 Bacteria 3449
538 Ga0439449_0003792 3300042007 Bacteria 5848
539 Ga0439452_001713 3300042010 Bacteria 8607
540 Ga0439457_010793 3300042014 Bacteria 2091
541 Ga0439462_0001401 3300042015 Bacteria 5347
542 Ga0450913_003568 3300042117 Bacteria 1027
543 Ga0439446_0000943 3300042156 Bacteria 6291
544 Ga0450909_009631 3300042185 Bacteria 1410
545 Ga0439434_0000158 3300042435 Bacteria 18217
546 Ga0439464_0025929 3300042439 Bacteria 1624
547 Ga0450893_0008775 3300042532 Bacteria 1648
548 Ga0451577_0372202 3300042876 Bacteria 1296
549 Ga0453684_0388244 3300044712 Bacteria 1566
550 Ga0495592_0040309 3300046454 Bacteria 3505
551 Ga0495651_0105380 3300046462 Bacteria 2091
552 Ga0495651_0219162 3300046462 Bacteria 1318
553 Ga0495580_0098977 3300046472 Bacteria 2028
554 Ga0495580_0100854 3300046472 Bacteria 2008
555 Ga0495608_0049661 3300046511 Bacteria 2785
556 Ga0495610_0050304 3300046512 Bacteria 2035
557 Ga0495628_0077170 3300046516 Bacteria 2592
558 Ga0495632_0002042 3300046519 Bacteria 15864
559 Ga0495632_0019438 3300046519 Bacteria 3700
560 Ga0495643_0043118 3300046522 Bacteria 2456
561 Ga0495643_0125441 3300046522 Bacteria 1293
562 Ga0495663_0017353 3300046525 Bacteria 2042
563 Ga0495598_0009039 3300046537 Bacteria 2341
564 Ga0495621_0042757 3300046539 Bacteria 1596
565 Ga0495621_0055657 3300046539 Bacteria 1424
566 Ga0495645_0004594 3300046543 Bacteria 9426
567 Ga0495656_0000171 3300046615 Bacteria 22920
568 Ga0495625_0004789 3300046660 Bacteria 12656
569 Ga0495635_0022394 3300046663 Bacteria 4400
570 Ga0495657_0064897 3300046675 Bacteria 2403
571 Ga0495599_0065634 3300046678 Bacteria 2267
572 Ga0495623_0073606 3300046679 Bacteria 2123
573 Ga0495623_0180609 3300046679 Bacteria 1226
574 Ga0495658_0062591 3300046683 Bacteria 2139
575 Ga0495600_0100982 3300046809 Bacteria 1881
576 Ga0495604_0110884 3300047317 Bacteria 2001
577 Ga0495684_0077260 3300047471 Bacteria 2528
578 Ga0495686_0136519 3300047472 Bacteria 1450
579 Ga0495615_0001305 3300048090 Bacteria 3656
580 Ga0496104_0018269 3300048907 Bacteria 6397
581 Ga0496108_0094281 3300048911 Bacteria 2548
582 Ga0496109_0022068 3300048912 Bacteria 5636
583 Ga0496109_0248162 3300048912 Bacteria 1676
584 Ga0501034_0000456 3300049571 Bacteria 67493
585 Ga0501034_0123878 3300049571 Bacteria 2570
586 Ga0501036_0119596 3300049572 Bacteria 2225
587 Ga0501036_0150633 3300049572 Bacteria 1962
588 Ga0501039_0091118 3300049575 Bacteria 2376
589 Ga0501041_0213571 3300049577 Bacteria 1210
590 Ga0501042_0132338 3300049578 Bacteria 1798
591 Ga0501046_0156235 3300049580 Bacteria 1718
592 Ga0501068_0000960 3300049584 Bacteria 15139
593 Ga0501072_0003561 3300049588 Bacteria 11719
594 Ga0501073_0001375 3300049589 Bacteria 17975
595 Ga0501076_0407618 3300049592 Bacteria 1118
596 Ga0501229_009829 3300049706 Bacteria 1204
597 Ga0501080_0001249 3300049742 Bacteria 21171
598 Ga0501083_0086491 3300049744 Bacteria 2073
599 Ga0501045_0117669 3300049824 Bacteria 1972
600 Ga0501045_0169894 3300049824 Bacteria 1624
601 nmdc:mga03683_42803_c1 3300050489 Bacteria 1865
602 nmdc:mga00v17_7418_c1 3300050491 Bacteria 5852
603 nmdc:mga0yw44_125488_c1 3300050492 Bacteria 1657
604 nmdc:mga0yw44_138815_c1 3300050492 Bacteria 1578
605 nmdc:mga0k408_2052_c1 3300050493 Bacteria 10769
606 nmdc:mga0k408_39179_c1 3300050493 Bacteria 2722
607 nmdc:mga06z11_90534_c1 3300050494 Bacteria 1660
608 nmdc:mga07m45_10514_c1 3300050496 Bacteria 4836
609 nmdc:mga07m45_194_c1 3300050496 Bacteria 24053
610 nmdc:mga05p37_100678_c1 3300050507 Bacteria 3559
611 nmdc:mga08y16_10820_c1 3300050511 Bacteria 9578
612 nmdc:mga0rr50_17231_c1 3300050513 Bacteria 4817
613 nmdc:mga0a205_109270_c1 3300050515 Bacteria 2664
614 nmdc:mga0a205_237476_c1 3300050515 Bacteria 1704
615 nmdc:mga0sz30_30369_c1 3300050516 Bacteria 2232
616 Ga0495595_0094656 3300053084 Bacteria 1436
617 Ga0500578_0001274 3300053086 Bacteria 26109
618 Ga0500644_0000917 3300053088 Bacteria 9381
619 Ga0500646_0000553 3300053090 Bacteria 10805
620 Ga0500646_0000730 3300053090 Bacteria 9288
621 Ga0500651_0020032 3300053093 Bacteria 4164
622 Ga0500650_0052354 3300053098 Bacteria 1898
623 Ga0500562_001476 3300053108 Bacteria 5804
624 Ga0500562_040360 3300053108 Bacteria 1241
625 Ga0500593_000120 3300053117 Bacteria 30583
626 Ga0500593_001375 3300053117 Bacteria 8756
627 Ga0500593_005564 3300053117 Bacteria 4980
628 Ga0500593_007263 3300053117 Bacteria 4496
629 Ga0500628_018632 3300053129 Bacteria 1371
630 Ga0500642_0037765 3300053130 Bacteria 2066
631 Ga0500642_0086052 3300053130 Bacteria 1449
632 Ga0500559_0000085 3300053136 Bacteria 73850
633 Ga0500568_0064768 3300053139 Bacteria 1408
634 Ga0500568_0102237 3300053139 Bacteria 1074
635 Ga0500604_0000621 3300053151 Bacteria 9733
636 Ga0500604_0004198 3300053151 Bacteria 3833
637 Ga0500604_0021270 3300053151 Bacteria 1833
638 Ga0500616_0045635 3300053153 Bacteria 2334
639 Ga0500622_0000164 3300053156 Bacteria 70630
640 Ga0500622_0011754 3300053156 Bacteria 4758
641 Ga0500627_0115930 3300053158 Bacteria 1207
642 Ga0500637_0210637 3300053178 Bacteria 1103
643 Ga0500645_000206 3300053730 Bacteria 45626
644 Ga0500645_002283 3300053730 Bacteria 8703
645 Ga0500645_007558 3300053730 Bacteria 3773
646 Ga0500645_011405 3300053730 Bacteria 2903
647 Ga0500645_032009 3300053730 Bacteria 1579
648 Ga0500587_001612 3300053739 Bacteria 3210
649 Ga0501084_0241081 3300054114 Bacteria 1526
650 Ga0500661_012513 3300055283 Bacteria 1531
651 Ga0501082_0044702 3300060353 Bacteria 3820
652 Ga0530510_0330913 3300061734 Bacteria 1143
653 Ga0530510_0371091 3300061734 Bacteria 1076

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003187 JGI25151J46595_10014225 JGI25151J46595_100142253 256
2 3300055283 Ga0500661_012513 Ga0500661_012513_702_1481 259
3 3300053108 Ga0500562_001476 Ga0500562_001476_1241_2140 262
4 3300005355 Ga0070671_100338824 Ga0070671_1003388242 270
5 3300005456 Ga0070678_100126120 Ga0070678_1001261202 270
6 3300009176 Ga0105242_10108408 Ga0105242_101084082 270
7 3300025893 Ga0207682_10027171 Ga0207682_100271712 270
8 3300025931 Ga0207644_10070047 Ga0207644_100700472 270
9 3300025940 Ga0207691_10102507 Ga0207691_101025072 270
10 3300026116 Ga0207674_10319435 Ga0207674_103194352 270
11 3300005344 Ga0070661_100141193 Ga0070661_1001411932 272
12 3300005334 Ga0068869_100038558 Ga0068869_1000385583 273
13 3300005354 Ga0070675_100028908 Ga0070675_1000289083 273
14 3300005456 Ga0070678_100311266 Ga0070678_1003112662 273
15 3300005543 Ga0070672_100050232 Ga0070672_1000502323 273
16 3300005577 Ga0068857_100178986 Ga0068857_1001789862 273
17 3300025901 Ga0207688_10094510 Ga0207688_100945102 273
18 3300025926 Ga0207659_10048355 Ga0207659_100483552 273
19 3300025940 Ga0207691_10015746 Ga0207691_100157465 273
20 3300025942 Ga0207689_10015983 Ga0207689_100159833 273
21 3300026075 Ga0207708_10125108 Ga0207708_101251082 273
22 3300026116 Ga0207674_10028836 Ga0207674_100288367 273
23 3300031903 Ga0307407_10164558 Ga0307407_101645582 273
24 3300031911 Ga0307412_10041991 Ga0307412_100419911 273
25 3300031995 Ga0307409_100011985 Ga0307409_1000119853 273
26 3300032002 Ga0307416_100002194 Ga0307416_1000021945 273
27 3300032005 Ga0307411_10055114 Ga0307411_100551142 273
28 3300032126 Ga0307415_100000510 Ga0307415_10000051013 273
29 3300025908 Ga0207643_10028008 Ga0207643_100280082 274
30 3300032002 Ga0307416_100151740 Ga0307416_1001517402 274
31 3300005365 Ga0070688_100383276 Ga0070688_1003832761 275
32 3300013104 Ga0157370_10145615 Ga0157370_101456152 275
33 3300013308 Ga0157375_10337114 Ga0157375_103371142 275
34 3300025941 Ga0207711_10176107 Ga0207711_101761072 275
35 3300006195 Ga0075366_10104141 Ga0075366_101041412 276
36 3300049572 Ga0501036_0119596 Ga0501036_0119596_371_1279 276
37 3300005330 Ga0070690_100157446 Ga0070690_1001574462 277
38 3300005334 Ga0068869_100024865 Ga0068869_1000248652 277
39 3300005340 Ga0070689_100142447 Ga0070689_1001424472 277
40 3300005456 Ga0070678_100223377 Ga0070678_1002233772 277
41 3300005547 Ga0070693_100128489 Ga0070693_1001284893 277
42 3300005616 Ga0068852_100236236 Ga0068852_1002362362 277
43 3300005834 Ga0068851_10126681 Ga0068851_101266812 277
44 3300006237 Ga0097621_100021589 Ga0097621_1000215895 277
45 3300014969 Ga0157376_10013138 Ga0157376_100131387 277
46 3300025936 Ga0207670_10232786 Ga0207670_102327862 277
47 3300026118 Ga0207675_100160642 Ga0207675_1001606422 277
48 3300053117 Ga0500593_001375 Ga0500593_001375_5362_6264 277
49 3300009147 Ga0114129_10126379 Ga0114129_101263793 278
50 3300028786 Ga0307517_10072154 Ga0307517_100721542 278
51 3300031730 Ga0307516_10004231 Ga0307516_100042317 278
52 3300046539 Ga0495621_0055657 Ga0495621_0055657_157_1077 278
53 3300049575 Ga0501039_0091118 Ga0501039_0091118_456_1352 278
54 3300049578 Ga0501042_0132338 Ga0501042_0132338_656_1552 278
55 3300049592 Ga0501076_0407618 Ga0501076_0407618_101_997 278
56 3300049824 Ga0501045_0117669 Ga0501045_0117669_130_1026 278
57 3300050507 nmdc:mga05p37_100678_c1 nmdc:mga05p37_100678_c1_1627_2544 278
58 3300005331 Ga0070670_100080828 Ga0070670_1000808282 279
59 3300005841 Ga0068863_100189823 Ga0068863_1001898232 279
60 3300009177 Ga0105248_10205658 Ga0105248_102056582 279
61 3300014969 Ga0157376_10345028 Ga0157376_103450281 279
62 3300025941 Ga0207711_10094429 Ga0207711_100944293 279
63 3300026089 Ga0207648_10330737 Ga0207648_103307372 279
64 3300005548 Ga0070665_100005277 Ga0070665_1000052777 280
65 3300006051 Ga0075364_10009318 Ga0075364_100093182 280
66 3300006195 Ga0075366_10010048 Ga0075366_100100483 280
67 3300025263 Ga0209565_1001661 Ga0209565_10016614 280
68 3300025291 Ga0209675_1003943 Ga0209675_10039433 280
69 3300025299 Ga0209256_1030082 Ga0209256_10300822 280
70 3300028379 Ga0268266_10006738 Ga0268266_100067386 280
71 3300031456 Ga0307513_10000025 Ga0307513_1000002542 280
72 3300031730 Ga0307516_10021022 Ga0307516_100210223 280
73 3300049706 Ga0501229_009829 Ga0501229_009829_205_1107 280
74 3300050493 nmdc:mga0k408_2052_c1 nmdc:mga0k408_2052_c1_1743_2666 280
75 3300050496 nmdc:mga07m45_194_c1 nmdc:mga07m45_194_c1_15793_16716 280
76 3300053158 Ga0500627_0115930 Ga0500627_0115930_157_1059 280
77 3300005435 Ga0070714_100011248 Ga0070714_1000112486 281
78 3300005436 Ga0070713_100071478 Ga0070713_1000714783 281
79 3300005456 Ga0070678_100109843 Ga0070678_1001098432 281
80 3300005548 Ga0070665_100053168 Ga0070665_1000531682 281
81 3300005841 Ga0068863_100067070 Ga0068863_1000670703 281
82 3300006028 Ga0070717_10213025 Ga0070717_102130252 281
83 3300009098 Ga0105245_10067086 Ga0105245_100670861 281
84 3300009177 Ga0105248_10146496 Ga0105248_101464962 281
85 3300025906 Ga0207699_10110131 Ga0207699_101101312 281
86 3300025929 Ga0207664_10000197 Ga0207664_1000019740 281
87 3300025931 Ga0207644_10002035 Ga0207644_100020358 281
88 3300025933 Ga0207706_10039697 Ga0207706_100396972 281
89 3300025940 Ga0207691_10165763 Ga0207691_101657631 281
90 3300025941 Ga0207711_10075318 Ga0207711_100753182 281
91 3300025981 Ga0207640_10154406 Ga0207640_101544061 281
92 3300026095 Ga0207676_10042018 Ga0207676_100420183 281
93 3300031251 Ga0265327_10000194 Ga0265327_1000019449 281
94 3300035692 Ga0373935_0070484 Ga0373935_0070484_53_964 281
95 3300035725 Ga0373947_0011443 Ga0373947_0011443_839_1750 281
96 3300037068 Ga0373925_0063380 Ga0373925_0063380_508_1419 281
97 3300042876 Ga0451577_0372202 Ga0451577_0372202_350_1255 281
98 3300046525 Ga0495663_0017353 Ga0495663_0017353_859_1764 281
99 3300046615 Ga0495656_0000171 Ga0495656_0000171_846_1751 281
100 3300048090 Ga0495615_0001305 Ga0495615_0001305_2490_3395 281
101 3300048912 Ga0496109_0248162 Ga0496109_0248162_30_950 281
102 3300005356 Ga0070674_100332471 Ga0070674_1003324712 282
103 3300009148 Ga0105243_10210349 Ga0105243_102103492 282
104 3300009148 Ga0105243_10290724 Ga0105243_102907242 282
105 3300009176 Ga0105242_10001363 Ga0105242_1000136316 282
106 3300014969 Ga0157376_10132229 Ga0157376_101322292 282
107 3300025291 Ga0209675_1017807 Ga0209675_10178072 282
108 3300025292 Ga0209676_1003560 Ga0209676_10035605 282
109 3300025295 Ga0209564_1014320 Ga0209564_10143202 282
110 3300025298 Ga0209050_1027531 Ga0209050_10275312 282
111 3300025304 Ga0209257_1009089 Ga0209257_10090895 282
112 3300025935 Ga0207709_10192695 Ga0207709_101926952 282
113 3300026075 Ga0207708_10096364 Ga0207708_100963642 282
114 3300037068 Ga0373925_0411885 Ga0373925_0411885_40_948 282
115 3300050493 nmdc:mga0k408_39179_c1 nmdc:mga0k408_39179_c1_787_1722 282
116 3300053117 Ga0500593_000120 Ga0500593_000120_14714_15616 282
117 3300053730 Ga0500645_011405 Ga0500645_011405_164_1066 282
118 3300002704 JGI25155J39150_1000009 JGI25155J39150_100000975 283
119 3300002705 JGI25156J39149_1000009 JGI25156J39149_1000009145 283
120 3300002738 JGI25154J39366_1000024 JGI25154J39366_1000024145 283
121 3300002741 JGI25157J39369_1000007 JGI25157J39369_1000007145 283
122 3300002774 JGI25150J39212_1017171 JGI25150J39212_10171712 283
123 3300003773 Ga0055537_1000020 Ga0055537_100002080 283
124 3300003775 Ga0055524_1000047 Ga0055524_1000047109 283
125 3300003784 Ga0055534_1003852 Ga0055534_10038523 283
126 3300003790 Ga0055528_1000973 Ga0055528_10009734 283
127 3300005340 Ga0070689_100064767 Ga0070689_1000647672 283
128 3300005353 Ga0070669_100178964 Ga0070669_1001789642 283
129 3300005356 Ga0070674_100201383 Ga0070674_1002013832 283
130 3300005365 Ga0070688_100004402 Ga0070688_1000044021 283
131 3300006946 Ga0079104_1012746 Ga0079104_10127462 283
132 3300012513 Ga0157326_1001965 Ga0157326_10019652 283
133 3300014745 Ga0157377_10003600 Ga0157377_100036002 283
134 3300017792 Ga0163161_10190331 Ga0163161_101903312 283
135 3300025206 Ga0209435_100008 Ga0209435_10000851 283
136 3300025245 Ga0207425_1002658 Ga0207425_10026586 283
137 3300025246 Ga0209646_1000029 Ga0209646_1000029227 283
138 3300025250 Ga0209026_1000016 Ga0209026_1000016227 283
139 3300025256 Ga0209759_1000016 Ga0209759_1000016227 283
140 3300025263 Ga0209565_1000061 Ga0209565_1000061146 283
141 3300025273 Ga0209673_1000298 Ga0209673_100029850 283
142 3300025291 Ga0209675_1000105 Ga0209675_1000105116 283
143 3300025294 Ga0209025_1025924 Ga0209025_10259241 283
144 3300025295 Ga0209564_1000181 Ga0209564_100018186 283
145 3300025295 Ga0209564_1000247 Ga0209564_100024744 283
146 3300025299 Ga0209256_1000039 Ga0209256_1000039209 283
147 3300025932 Ga0207690_10215328 Ga0207690_102153282 283
148 3300025945 Ga0207679_10352316 Ga0207679_103523162 283
149 3300025960 Ga0207651_10104713 Ga0207651_101047132 283
150 3300028379 Ga0268266_10129117 Ga0268266_101291172 283
151 3300037068 Ga0373925_0044409 Ga0373925_0044409_1851_2771 283
152 3300046663 Ga0495635_0022394 Ga0495635_0022394_3113_4033 283
153 3300046683 Ga0495658_0062591 Ga0495658_0062591_322_1242 283
154 3300046809 Ga0495600_0100982 Ga0495600_0100982_537_1457 283
155 3300048907 Ga0496104_0018269 Ga0496104_0018269_2067_2975 283
156 3300005330 Ga0070690_100020078 Ga0070690_1000200782 284
157 3300005334 Ga0068869_100025542 Ga0068869_1000255424 284
158 3300005335 Ga0070666_10013495 Ga0070666_100134953 284
159 3300005338 Ga0068868_100001100 Ga0068868_1000011002 284
160 3300005340 Ga0070689_100094251 Ga0070689_1000942512 284
161 3300005354 Ga0070675_100000422 Ga0070675_10000042211 284
162 3300005355 Ga0070671_100022045 Ga0070671_1000220454 284
163 3300005364 Ga0070673_100033758 Ga0070673_1000337583 284
164 3300005367 Ga0070667_100030592 Ga0070667_1000305922 284
165 3300005456 Ga0070678_100010764 Ga0070678_1000107643 284
166 3300005457 Ga0070662_100463964 Ga0070662_1004639642 284
167 3300005459 Ga0068867_100400886 Ga0068867_1004008861 284
168 3300005617 Ga0068859_100014408 Ga0068859_1000144082 284
169 3300005618 Ga0068864_100001444 Ga0068864_1000014443 284
170 3300005719 Ga0068861_100219964 Ga0068861_1002199641 284
171 3300005841 Ga0068863_100031771 Ga0068863_1000317713 284
172 3300005842 Ga0068858_100000436 Ga0068858_10000043635 284
173 3300005844 Ga0068862_100036607 Ga0068862_1000366072 284
174 3300006358 Ga0068871_100065570 Ga0068871_1000655702 284
175 3300006931 Ga0097620_100014408 Ga0097620_1000144082 284
176 3300009177 Ga0105248_10060749 Ga0105248_100607492 284
177 3300009177 Ga0105248_10262630 Ga0105248_102626302 284
178 3300013306 Ga0163162_10017890 Ga0163162_100178902 284
179 3300013308 Ga0157375_10183914 Ga0157375_101839142 284
180 3300014968 Ga0157379_10007509 Ga0157379_100075093 284
181 3300014968 Ga0157379_10138739 Ga0157379_101387392 284
182 3300014969 Ga0157376_10024182 Ga0157376_100241824 284
183 3300025893 Ga0207682_10016949 Ga0207682_100169491 284
184 3300025903 Ga0207680_10068485 Ga0207680_100684851 284
185 3300025923 Ga0207681_10112675 Ga0207681_101126752 284
186 3300025926 Ga0207659_10000355 Ga0207659_1000035520 284
187 3300025931 Ga0207644_10010478 Ga0207644_100104784 284
188 3300025933 Ga0207706_10099167 Ga0207706_100991672 284
189 3300025934 Ga0207686_10008362 Ga0207686_100083625 284
190 3300025938 Ga0207704_10087355 Ga0207704_100873552 284
191 3300025940 Ga0207691_10060236 Ga0207691_100602362 284
192 3300025941 Ga0207711_10176970 Ga0207711_101769702 284
193 3300025942 Ga0207689_10016667 Ga0207689_100166672 284
194 3300025960 Ga0207651_10004523 Ga0207651_100045232 284
195 3300025986 Ga0207658_10004719 Ga0207658_100047195 284
196 3300026023 Ga0207677_10002009 Ga0207677_100020098 284
197 3300026035 Ga0207703_10018805 Ga0207703_100188051 284
198 3300026088 Ga0207641_10004003 Ga0207641_100040032 284
199 3300026095 Ga0207676_10002262 Ga0207676_1000226212 284
200 3300026121 Ga0207683_10005679 Ga0207683_100056798 284
201 3300028381 Ga0268264_10721634 Ga0268264_107216341 284
202 3300046537 Ga0495598_0009039 Ga0495598_0009039_86_994 284
203 3300046539 Ga0495621_0042757 Ga0495621_0042757_370_1278 284
204 3300048912 Ga0496109_0022068 Ga0496109_0022068_2892_3800 284
205 3300002987 JGI25159J45721_1003869 JGI25159J45721_10038694 285
206 3300003354 JGI25160J50197_1000240 JGI25160J50197_100024036 285
207 3300003374 JGI25161J50226_1000009 JGI25161J50226_100000977 285
208 3300004625 Ga0055543_1000199 Ga0055543_100019936 285
209 3300005262 Ga0065165_1010769 Ga0065165_10107692 285
210 3300005262 Ga0065165_1011728 Ga0065165_10117282 285
211 3300005338 Ga0068868_100247837 Ga0068868_1002478372 285
212 3300005364 Ga0070673_100293410 Ga0070673_1002934102 285
213 3300005455 Ga0070663_100243759 Ga0070663_1002437592 285
214 3300006237 Ga0097621_100070706 Ga0097621_1000707063 285
215 3300025284 Ga0209130_1000014 Ga0209130_1000014149 285
216 3300025297 Ga0209758_1044978 Ga0209758_10449782 285
217 3300025298 Ga0209050_1011391 Ga0209050_10113912 285
218 3300025302 Ga0207426_1000242 Ga0207426_100024236 285
219 3300025893 Ga0207682_10012243 Ga0207682_100122433 285
220 3300025942 Ga0207689_10005711 Ga0207689_100057116 285
221 3300025960 Ga0207651_10194128 Ga0207651_101941282 285
222 3300028794 Ga0307515_10029308 Ga0307515_100293085 285
223 3300031456 Ga0307513_10000219 Ga0307513_1000021955 285
224 3300031548 Ga0307408_100203326 Ga0307408_1002033262 285
225 3300032002 Ga0307416_100531985 Ga0307416_1005319851 285
226 3300041498 Ga0451841_0450575 Ga0451841_0450575_12_875 285
227 3300042117 Ga0450913_003568 Ga0450913_003568_148_1011 285
228 3300049577 Ga0501041_0213571 Ga0501041_0213571_316_1185 285
229 3300050489 nmdc:mga03683_42803_c1 nmdc:mga03683_42803_c1_324_1181 285
230 3300053088 Ga0500644_0000917 Ga0500644_0000917_2289_3191 285
231 3300061734 Ga0530510_0330913 Ga0530510_0330913_96_1022 285
232 3300061734 Ga0530510_0371091 Ga0530510_0371091_178_1041 285
233 3300003792 Ga0055540_1000027 Ga0055540_100002735 286
234 3300003794 Ga0055531_10001909 Ga0055531_100019092 286
235 3300005331 Ga0070670_100035710 Ga0070670_1000357103 286
236 3300005333 Ga0070677_10051187 Ga0070677_100511871 286
237 3300005354 Ga0070675_100044916 Ga0070675_1000449163 286
238 3300005355 Ga0070671_100071674 Ga0070671_1000716742 286
239 3300005355 Ga0070671_100525477 Ga0070671_1005254771 286
240 3300005364 Ga0070673_100074690 Ga0070673_1000746902 286
241 3300005456 Ga0070678_100233510 Ga0070678_1002335102 286
242 3300005543 Ga0070672_100124469 Ga0070672_1001244692 286
243 3300005564 Ga0070664_100249396 Ga0070664_1002493962 286
244 3300005618 Ga0068864_100021397 Ga0068864_1000213975 286
245 3300005834 Ga0068851_10034595 Ga0068851_100345952 286
246 3300005841 Ga0068863_100308542 Ga0068863_1003085422 286
247 3300006178 Ga0075367_10184647 Ga0075367_101846472 286
248 3300006195 Ga0075366_10021481 Ga0075366_100214812 286
249 3300006195 Ga0075366_10027699 Ga0075366_100276993 286
250 3300006237 Ga0097621_100027003 Ga0097621_1000270033 286
251 3300006358 Ga0068871_100250503 Ga0068871_1002505032 286
252 3300013307 Ga0157372_10531022 Ga0157372_105310222 286
253 3300013308 Ga0157375_10165231 Ga0157375_101652312 286
254 3300014325 Ga0163163_10238443 Ga0163163_102384432 286
255 3300014326 Ga0157380_10200827 Ga0157380_102008272 286
256 3300014969 Ga0157376_10037162 Ga0157376_100371622 286
257 3300025284 Ga0209130_1005309 Ga0209130_10053094 286
258 3300025292 Ga0209676_1000013 Ga0209676_1000013610 286
259 3300025298 Ga0209050_1000008 Ga0209050_1000008610 286
260 3300025302 Ga0207426_1000816 Ga0207426_10008162 286
261 3300025303 Ga0209051_1000005 Ga0209051_1000005610 286
262 3300025304 Ga0209257_1000031 Ga0209257_1000031200 286
263 3300025899 Ga0207642_10050531 Ga0207642_100505312 286
264 3300025920 Ga0207649_10363448 Ga0207649_103634481 286
265 3300025925 Ga0207650_10051820 Ga0207650_100518202 286
266 3300025926 Ga0207659_10234719 Ga0207659_102347192 286
267 3300025931 Ga0207644_10070163 Ga0207644_100701633 286
268 3300025940 Ga0207691_10025614 Ga0207691_100256146 286
269 3300025945 Ga0207679_10320159 Ga0207679_103201592 286
270 3300025960 Ga0207651_10115232 Ga0207651_101152322 286
271 3300026023 Ga0207677_10209541 Ga0207677_102095412 286
272 3300026095 Ga0207676_10110268 Ga0207676_101102682 286
273 3300026121 Ga0207683_10154795 Ga0207683_101547952 286
274 3300026142 Ga0207698_10129657 Ga0207698_101296572 286
275 3300048911 Ga0496108_0094281 Ga0496108_0094281_522_1433 286
276 3300050492 nmdc:mga0yw44_138815_c1 nmdc:mga0yw44_138815_c1_690_1550 286
277 3300053129 Ga0500628_018632 Ga0500628_018632_173_1075 286
278 3300053151 Ga0500604_0021270 Ga0500604_0021270_123_1025 286
279 3300005333 Ga0070677_10098565 Ga0070677_100985651 287
280 3300005354 Ga0070675_100022267 Ga0070675_1000222673 287
281 3300005355 Ga0070671_100417755 Ga0070671_1004177551 287
282 3300005365 Ga0070688_100137504 Ga0070688_1001375042 287
283 3300005367 Ga0070667_100519500 Ga0070667_1005195001 287
284 3300005543 Ga0070672_100290757 Ga0070672_1002907571 287
285 3300005843 Ga0068860_100656792 Ga0068860_1006567921 287
286 3300013306 Ga0163162_10554114 Ga0163162_105541141 287
287 3300025925 Ga0207650_10084484 Ga0207650_100844842 287
288 3300025938 Ga0207704_10158074 Ga0207704_101580742 287
289 3300025940 Ga0207691_10211255 Ga0207691_102112552 287
290 3300028379 Ga0268266_10246227 Ga0268266_102462272 287
291 3300005331 Ga0070670_100451391 Ga0070670_1004513912 288
292 3300005347 Ga0070668_100248896 Ga0070668_1002488962 288
293 3300005355 Ga0070671_100216592 Ga0070671_1002165922 288
294 3300005459 Ga0068867_100109642 Ga0068867_1001096422 288
295 3300005548 Ga0070665_100386108 Ga0070665_1003861082 288
296 3300009148 Ga0105243_10090013 Ga0105243_100900132 288
297 3300009176 Ga0105242_10424242 Ga0105242_104242422 288
298 3300025893 Ga0207682_10010395 Ga0207682_100103953 288
299 3300025972 Ga0207668_10229392 Ga0207668_102293922 288
300 3300026067 Ga0207678_10034309 Ga0207678_100343094 288
301 3300026088 Ga0207641_10612769 Ga0207641_106127692 288
302 3300026089 Ga0207648_10022820 Ga0207648_100228205 288
303 3300031852 Ga0307410_10352792 Ga0307410_103527921 288
304 3300031903 Ga0307407_10312713 Ga0307407_103127131 288
305 3300031911 Ga0307412_10073366 Ga0307412_100733661 288
306 3300032005 Ga0307411_10056654 Ga0307411_100566542 288
307 3300036401 Ga0373937_0051353 Ga0373937_0051353_1286_2188 288
308 3300041404 Ga0439436_0000196 Ga0439436_0000196_4301_5239 288
309 3300041407 Ga0439447_009378 Ga0439447_009378_880_1818 288
310 3300041411 Ga0439466_0011953 Ga0439466_0011953_519_1457 288
311 3300041413 Ga0439465_0005369 Ga0439465_0005369_1863_2801 288
312 3300041997 Ga0439431_0000556 Ga0439431_0000556_2471_3409 288
313 3300041999 Ga0439433_0000436 Ga0439433_0000436_31_969 288
314 3300042004 Ga0439445_0003662 Ga0439445_0003662_2028_2966 288
315 3300042007 Ga0439449_0003792 Ga0439449_0003792_327_1265 288
316 3300042010 Ga0439452_001713 Ga0439452_001713_2969_3907 288
317 3300042014 Ga0439457_010793 Ga0439457_010793_182_1120 288
318 3300042015 Ga0439462_0001401 Ga0439462_0001401_2194_3132 288
319 3300042156 Ga0439446_0000943 Ga0439446_0000943_4501_5439 288
320 3300042185 Ga0450909_009631 Ga0450909_009631_445_1383 288
321 3300042435 Ga0439434_0000158 Ga0439434_0000158_2057_2995 288
322 3300046454 Ga0495592_0040309 Ga0495592_0040309_1765_2667 288
323 3300046462 Ga0495651_0105380 Ga0495651_0105380_140_1042 288
324 3300046511 Ga0495608_0049661 Ga0495608_0049661_1244_2146 288
325 3300046516 Ga0495628_0077170 Ga0495628_0077170_169_1071 288
326 3300046543 Ga0495645_0004594 Ga0495645_0004594_655_1557 288
327 3300046675 Ga0495657_0064897 Ga0495657_0064897_870_1772 288
328 3300046678 Ga0495599_0065634 Ga0495599_0065634_709_1611 288
329 3300046679 Ga0495623_0073606 Ga0495623_0073606_883_1785 288
330 3300047317 Ga0495604_0110884 Ga0495604_0110884_95_997 288
331 3300047471 Ga0495684_0077260 Ga0495684_0077260_323_1225 288
332 3300053084 Ga0495595_0094656 Ga0495595_0094656_416_1318 288
333 3300053093 Ga0500651_0020032 Ga0500651_0020032_43_960 288
334 3300053136 Ga0500559_0000085 Ga0500559_0000085_43439_44356 288
335 3300053139 Ga0500568_0064768 Ga0500568_0064768_197_1114 288
336 3300053156 Ga0500622_0011754 Ga0500622_0011754_3742_4659 288
337 3300002773 JGI25152J39213_1003177 JGI25152J39213_10031772 290
338 3300003215 JGI25153J46596_10001286 JGI25153J46596_100012862 290
339 3300003323 rootH1_10066207 rootH1_100662071 290
340 3300003771 Ga0055526_1001550 Ga0055526_100155011 290
341 3300005333 Ga0070677_10052777 Ga0070677_100527772 290
342 3300025245 Ga0207425_1001920 Ga0207425_100192010 290
343 3300025258 Ga0209129_1000075 Ga0209129_1000075109 290
344 3300025273 Ga0209673_1003861 Ga0209673_10038615 290
345 3300025295 Ga0209564_1000046 Ga0209564_1000046273 290
346 3300025297 Ga0209758_1000052 Ga0209758_1000052190 290
347 3300025299 Ga0209256_1012968 Ga0209256_10129682 290
348 3300025942 Ga0207689_10249644 Ga0207689_102496442 290
349 3300030521 Ga0307511_10000036 Ga0307511_1000003680 291
350 3300053730 Ga0500645_007558 Ga0500645_007558_1808_2710 291
351 3300053178 Ga0500637_0210637 Ga0500637_0210637_93_1022 292
352 3300005719 Ga0068861_100649709 Ga0068861_1006497091 293
353 3300025925 Ga0207650_10191225 Ga0207650_101912253 293
354 3300033180 Ga0307510_10000170 Ga0307510_100001706 293
355 3300041512 Ga0451853_1120642 Ga0451853_1120642_434_1333 293
356 3300044712 Ga0453684_0388244 Ga0453684_0388244_139_1032 293
357 iso_pu_bacteria 2511231002 2511246587 293
358 iso_pu_bacteria 2511231002 2511246662 293
359 iso_pu_bacteria 2585428062 2587757932 293
360 3300005436 Ga0070713_100001288 Ga0070713_1000012882 294
361 3300006175 Ga0070712_100024404 Ga0070712_1000244045 294
362 3300014326 Ga0157380_10112856 Ga0157380_101128562 294
363 3300025915 Ga0207693_10056021 Ga0207693_100560213 294
364 3300025928 Ga0207700_10000605 Ga0207700_1000060518 294
365 3300035724 Ga0373933_0128933 Ga0373933_0128933_179_1090 294
366 3300036401 Ga0373937_0288174 Ga0373937_0288174_552_1463 294
367 3300053090 Ga0500646_0000730 Ga0500646_0000730_3545_4489 294
368 3300053151 Ga0500604_0000621 Ga0500604_0000621_1290_2234 294
369 iso_pu_bacteria 2738543012 2739244075 294
370 iso_pu_bacteria 2816332133 2816472400 294
371 iso_pu_bacteria 2919704043 2919706699 294
372 3300003187 JGI25151J46595_10017793 JGI25151J46595_100177932 295
373 3300005330 Ga0070690_100001392 Ga0070690_1000013926 295
374 3300005334 Ga0068869_100000631 Ga0068869_10000063113 295
375 3300005334 Ga0068869_100399917 Ga0068869_1003999171 295
376 3300005336 Ga0070680_100121813 Ga0070680_1001218133 295
377 3300005340 Ga0070689_100003108 Ga0070689_1000031086 295
378 3300005347 Ga0070668_100029973 Ga0070668_1000299732 295
379 3300005353 Ga0070669_100148065 Ga0070669_1001480652 295
380 3300005354 Ga0070675_100078392 Ga0070675_1000783922 295
381 3300005364 Ga0070673_100286302 Ga0070673_1002863022 295
382 3300005365 Ga0070688_100205502 Ga0070688_1002055021 295
383 3300005366 Ga0070659_100129605 Ga0070659_1001296051 295
384 3300005438 Ga0070701_10000512 Ga0070701_1000051211 295
385 3300005441 Ga0070700_100000680 Ga0070700_10000068011 295
386 3300005455 Ga0070663_100059886 Ga0070663_1000598862 295
387 3300005456 Ga0070678_100011176 Ga0070678_1000111765 295
388 3300005456 Ga0070678_100097297 Ga0070678_1000972971 295
389 3300005458 Ga0070681_10120812 Ga0070681_101208121 295
390 3300005459 Ga0068867_100002384 Ga0068867_10000238411 295
391 3300005459 Ga0068867_100016098 Ga0068867_1000160983 295
392 3300005459 Ga0068867_100053004 Ga0068867_1000530042 295
393 3300005543 Ga0070672_100007566 Ga0070672_1000075663 295
394 3300005544 Ga0070686_100000973 Ga0070686_10000097313 295
395 3300005546 Ga0070696_100023215 Ga0070696_1000232152 295
396 3300005546 Ga0070696_100038871 Ga0070696_1000388713 295
397 3300005547 Ga0070693_100005977 Ga0070693_1000059773 295
398 3300005615 Ga0070702_100001461 Ga0070702_1000014614 295
399 3300005617 Ga0068859_100004520 Ga0068859_1000045203 295
400 3300005617 Ga0068859_100139094 Ga0068859_1001390942 295
401 3300005617 Ga0068859_100242938 Ga0068859_1002429382 295
402 3300005617 Ga0068859_100278097 Ga0068859_1002780973 295
403 3300005718 Ga0068866_10000632 Ga0068866_100006325 295
404 3300005718 Ga0068866_10009776 Ga0068866_100097763 295
405 3300005719 Ga0068861_100001526 Ga0068861_10000152611 295
406 3300005719 Ga0068861_100004985 Ga0068861_1000049853 295
407 3300005840 Ga0068870_10010668 Ga0068870_100106682 295
408 3300005842 Ga0068858_100022445 Ga0068858_1000224454 295
409 3300005842 Ga0068858_100168829 Ga0068858_1001688291 295
410 3300005842 Ga0068858_100265785 Ga0068858_1002657852 295
411 3300005842 Ga0068858_100395282 Ga0068858_1003952821 295
412 3300005843 Ga0068860_100001387 Ga0068860_1000013877 295
413 3300005843 Ga0068860_100040991 Ga0068860_1000409914 295
414 3300005843 Ga0068860_100126878 Ga0068860_1001268781 295
415 3300005844 Ga0068862_100002384 Ga0068862_1000023847 295
416 3300005844 Ga0068862_100010800 Ga0068862_1000108007 295
417 3300005844 Ga0068862_100305111 Ga0068862_1003051112 295
418 3300005985 Ga0081539_10017821 Ga0081539_100178212 295
419 3300006038 Ga0075365_10168002 Ga0075365_101680022 295
420 3300006048 Ga0075363_100012169 Ga0075363_1000121694 295
421 3300006195 Ga0075366_10006732 Ga0075366_100067325 295
422 3300006237 Ga0097621_100002825 Ga0097621_1000028257 295
423 3300006237 Ga0097621_100005706 Ga0097621_1000057068 295
424 3300006237 Ga0097621_100389383 Ga0097621_1003893831 295
425 3300006358 Ga0068871_100005154 Ga0068871_1000051545 295
426 3300006358 Ga0068871_100018572 Ga0068871_1000185722 295
427 3300006358 Ga0068871_100161197 Ga0068871_1001611972 295
428 3300006852 Ga0075433_10102717 Ga0075433_101027173 295
429 3300006881 Ga0068865_100000305 Ga0068865_1000003058 295
430 3300006881 Ga0068865_100000371 Ga0068865_1000003718 295
431 3300006931 Ga0097620_100004520 Ga0097620_10000452012 295
432 3300006931 Ga0097620_100139088 Ga0097620_1001390882 295
433 3300006931 Ga0097620_100242932 Ga0097620_1002429322 295
434 3300006931 Ga0097620_100278110 Ga0097620_1002781103 295
435 3300009098 Ga0105245_10008300 Ga0105245_100083006 295
436 3300009147 Ga0114129_10689742 Ga0114129_106897421 295
437 3300009148 Ga0105243_10004538 Ga0105243_100045383 295
438 3300009148 Ga0105243_10013136 Ga0105243_100131366 295
439 3300009174 Ga0105241_10022246 Ga0105241_100222464 295
440 3300009176 Ga0105242_10030898 Ga0105242_100308985 295
441 3300009176 Ga0105242_10097193 Ga0105242_100971932 295
442 3300009176 Ga0105242_10358448 Ga0105242_103584482 295
443 3300009177 Ga0105248_10018384 Ga0105248_100183845 295
444 3300009177 Ga0105248_10124945 Ga0105248_101249453 295
445 3300009551 Ga0105238_10344814 Ga0105238_103448142 295
446 3300009553 Ga0105249_10009105 Ga0105249_100091053 295
447 3300009553 Ga0105249_10178096 Ga0105249_101780962 295
448 3300009553 Ga0105249_10199795 Ga0105249_101997952 295
449 3300010375 Ga0105239_10364228 Ga0105239_103642282 295
450 3300013297 Ga0157378_10001140 Ga0157378_100011406 295
451 3300013297 Ga0157378_10010272 Ga0157378_100102722 295
452 3300013297 Ga0157378_10177105 Ga0157378_101771052 295
453 3300013297 Ga0157378_10493944 Ga0157378_104939441 295
454 3300013306 Ga0163162_10000948 Ga0163162_100009482 295
455 3300013306 Ga0163162_10525979 Ga0163162_105259791 295
456 3300013308 Ga0157375_10061001 Ga0157375_100610012 295
457 3300013308 Ga0157375_10134345 Ga0157375_101343452 295
458 3300013308 Ga0157375_10365618 Ga0157375_103656182 295
459 3300014325 Ga0163163_10262681 Ga0163163_102626813 295
460 3300014326 Ga0157380_10000449 Ga0157380_1000044913 295
461 3300014326 Ga0157380_10034222 Ga0157380_100342222 295
462 3300014326 Ga0157380_10175681 Ga0157380_101756812 295
463 3300014968 Ga0157379_10020080 Ga0157379_100200805 295
464 3300014968 Ga0157379_10241174 Ga0157379_102411742 295
465 3300014969 Ga0157376_10074822 Ga0157376_100748223 295
466 3300014969 Ga0157376_10342347 Ga0157376_103423472 295
467 3300014969 Ga0157376_10496136 Ga0157376_104961362 295
468 3300017792 Ga0163161_10006676 Ga0163161_100066764 295
469 3300025899 Ga0207642_10006840 Ga0207642_100068403 295
470 3300025908 Ga0207643_10158274 Ga0207643_101582741 295
471 3300025912 Ga0207707_10307111 Ga0207707_103071112 295
472 3300025926 Ga0207659_10037234 Ga0207659_100372342 295
473 3300025927 Ga0207687_10000800 Ga0207687_100008002 295
474 3300025934 Ga0207686_10002242 Ga0207686_100022429 295
475 3300025935 Ga0207709_10005847 Ga0207709_100058472 295
476 3300025936 Ga0207670_10036809 Ga0207670_100368092 295
477 3300025938 Ga0207704_10001417 Ga0207704_100014178 295
478 3300025938 Ga0207704_10035604 Ga0207704_100356042 295
479 3300025938 Ga0207704_10141494 Ga0207704_101414942 295
480 3300025940 Ga0207691_10026141 Ga0207691_100261412 295
481 3300025941 Ga0207711_10020774 Ga0207711_100207745 295
482 3300025941 Ga0207711_10377460 Ga0207711_103774602 295
483 3300025942 Ga0207689_10000642 Ga0207689_1000064219 295
484 3300025949 Ga0207667_10115216 Ga0207667_101152161 295
485 3300025961 Ga0207712_10023687 Ga0207712_100236872 295
486 3300025961 Ga0207712_10071700 Ga0207712_100717002 295
487 3300025972 Ga0207668_10215518 Ga0207668_102155182 295
488 3300025986 Ga0207658_10558772 Ga0207658_105587721 295
489 3300026035 Ga0207703_10015016 Ga0207703_100150164 295
490 3300026035 Ga0207703_10059338 Ga0207703_100593383 295
491 3300026041 Ga0207639_10086446 Ga0207639_100864462 295
492 3300026067 Ga0207678_10188691 Ga0207678_101886912 295
493 3300026075 Ga0207708_10000102 Ga0207708_1000010245 295
494 3300026089 Ga0207648_10005941 Ga0207648_100059417 295
495 3300026089 Ga0207648_10011696 Ga0207648_100116962 295
496 3300026089 Ga0207648_10021357 Ga0207648_100213573 295
497 3300026089 Ga0207648_10080674 Ga0207648_100806742 295
498 3300026089 Ga0207648_10088187 Ga0207648_100881872 295
499 3300026118 Ga0207675_100000527 Ga0207675_10000052720 295
500 3300026118 Ga0207675_100009000 Ga0207675_1000090003 295
501 3300026118 Ga0207675_100034360 Ga0207675_1000343602 295
502 3300026121 Ga0207683_10019835 Ga0207683_100198352 295
503 3300026121 Ga0207683_10062016 Ga0207683_100620165 295
504 3300027907 Ga0207428_10016574 Ga0207428_100165748 295
505 3300028380 Ga0268265_10009147 Ga0268265_100091472 295
506 3300028381 Ga0268264_10133224 Ga0268264_101332243 295
507 3300028786 Ga0307517_10161776 Ga0307517_101617761 295
508 3300028794 Ga0307515_10003694 Ga0307515_1000369433 295
509 3300031456 Ga0307513_10020743 Ga0307513_100207434 295
510 3300031730 Ga0307516_10005929 Ga0307516_100059296 295
511 3300031903 Ga0307407_10060005 Ga0307407_100600052 295
512 3300032005 Ga0307411_10206859 Ga0307411_102068591 295
513 3300035692 Ga0373935_0319231 Ga0373935_0319231_62_964 295
514 3300035695 Ga0373927_0004742 Ga0373927_0004742_1062_1970 295
515 3300035695 Ga0373927_0051770 Ga0373927_0051770_1010_1918 295
516 3300036401 Ga0373937_0055964 Ga0373937_0055964_1617_2525 295
517 3300037068 Ga0373925_0411574 Ga0373925_0411574_105_1019 295
518 3300041443 Ga0451789_0778680 Ga0451789_0778680_327_1226 295
519 3300041997 Ga0439431_0004971 Ga0439431_0004971_1273_2175 295
520 3300042532 Ga0450893_0008775 Ga0450893_0008775_139_1041 295
521 3300046472 Ga0495580_0098977 Ga0495580_0098977_1052_1960 295
522 3300046472 Ga0495580_0100854 Ga0495580_0100854_926_1834 295
523 3300046512 Ga0495610_0050304 Ga0495610_0050304_86_1000 295
524 3300046519 Ga0495632_0019438 Ga0495632_0019438_334_1248 295
525 3300046522 Ga0495643_0043118 Ga0495643_0043118_819_1763 295
526 3300046522 Ga0495643_0125441 Ga0495643_0125441_252_1151 295
527 3300046660 Ga0495625_0004789 Ga0495625_0004789_4667_5566 295
528 3300047472 Ga0495686_0136519 Ga0495686_0136519_133_1047 295
529 3300049571 Ga0501034_0000456 Ga0501034_0000456_63283_64191 295
530 3300049571 Ga0501034_0123878 Ga0501034_0123878_1011_1919 295
531 3300049584 Ga0501068_0000960 Ga0501068_0000960_4913_5821 295
532 3300049588 Ga0501072_0003561 Ga0501072_0003561_1855_2763 295
533 3300049589 Ga0501073_0001375 Ga0501073_0001375_7430_8338 295
534 3300049742 Ga0501080_0001249 Ga0501080_0001249_9356_10264 295
535 3300049744 Ga0501083_0086491 Ga0501083_0086491_415_1323 295
536 3300050491 nmdc:mga00v17_7418_c1 nmdc:mga00v17_7418_c1_1963_2865 295
537 3300050492 nmdc:mga0yw44_125488_c1 nmdc:mga0yw44_125488_c1_283_1185 295
538 3300050496 nmdc:mga07m45_10514_c1 nmdc:mga07m45_10514_c1_3445_4347 295
539 3300050511 nmdc:mga08y16_10820_c1 nmdc:mga08y16_10820_c1_8313_9215 295
540 3300050515 nmdc:mga0a205_237476_c1 nmdc:mga0a205_237476_c1_338_1240 295
541 3300050516 nmdc:mga0sz30_30369_c1 nmdc:mga0sz30_30369_c1_1163_2065 295
542 3300053090 Ga0500646_0000553 Ga0500646_0000553_7721_8623 295
543 3300053130 Ga0500642_0086052 Ga0500642_0086052_271_1173 295
544 3300053151 Ga0500604_0004198 Ga0500604_0004198_1489_2391 295
545 3300053730 Ga0500645_032009 Ga0500645_032009_503_1405 295
546 3300053739 Ga0500587_001612 Ga0500587_001612_575_1489 295
547 3300054114 Ga0501084_0241081 Ga0501084_0241081_223_1137 295
548 3300060353 Ga0501082_0044702 Ga0501082_0044702_1546_2454 295
549 iso_pu_bacteria 2738543013 2739252133 295
550 3300003215 JGI25153J46596_10003485 JGI25153J46596_100034853 296
551 3300003322 rootL2_10212273 rootL2_102122733 296
552 3300003784 Ga0055534_1000901 Ga0055534_100090110 296
553 3300005262 Ga0065165_1000832 Ga0065165_100083221 296
554 3300005356 Ga0070674_100014175 Ga0070674_1000141753 296
555 3300005467 Ga0070706_100025761 Ga0070706_1000257614 296
556 3300005549 Ga0070704_100138497 Ga0070704_1001384971 296
557 3300005578 Ga0068854_100038140 Ga0068854_1000381402 296
558 3300006051 Ga0075364_10070091 Ga0075364_100700912 296
559 3300006178 Ga0075367_10023806 Ga0075367_100238063 296
560 3300006195 Ga0075366_10025415 Ga0075366_100254152 296
561 3300006353 Ga0075370_10035330 Ga0075370_100353303 296
562 3300006852 Ga0075433_10056208 Ga0075433_100562083 296
563 3300006871 Ga0075434_100041160 Ga0075434_1000411606 296
564 3300006881 Ga0068865_100207539 Ga0068865_1002075391 296
565 3300006914 Ga0075436_100023634 Ga0075436_1000236344 296
566 3300007076 Ga0075435_100140160 Ga0075435_1001401602 296
567 3300009147 Ga0114129_10178343 Ga0114129_101783432 296
568 3300009147 Ga0114129_10686451 Ga0114129_106864512 296
569 3300009553 Ga0105249_10045362 Ga0105249_100453622 296
570 3300013296 Ga0157374_10211848 Ga0157374_102118482 296
571 3300025245 Ga0207425_1016265 Ga0207425_10162652 296
572 3300025273 Ga0209673_1011939 Ga0209673_10119392 296
573 3300025284 Ga0209130_1004197 Ga0209130_10041972 296
574 3300025291 Ga0209675_1001283 Ga0209675_100128310 296
575 3300025291 Ga0209675_1002955 Ga0209675_10029558 296
576 3300025292 Ga0209676_1020092 Ga0209676_10200922 296
577 3300025294 Ga0209025_1013495 Ga0209025_10134953 296
578 3300025297 Ga0209758_1000045 Ga0209758_1000045274 296
579 3300025297 Ga0209758_1014508 Ga0209758_10145084 296
580 3300025298 Ga0209050_1000257 Ga0209050_100025786 296
581 3300025303 Ga0209051_1009002 Ga0209051_10090022 296
582 3300025303 Ga0209051_1026527 Ga0209051_10265272 296
583 3300025910 Ga0207684_10014503 Ga0207684_100145035 296
584 3300025915 Ga0207693_10283297 Ga0207693_102832971 296
585 3300025922 Ga0207646_10025948 Ga0207646_100259482 296
586 3300025937 Ga0207669_10262938 Ga0207669_102629382 296
587 3300026041 Ga0207639_10017559 Ga0207639_100175593 296
588 3300028794 Ga0307515_10000047 Ga0307515_10000047255 296
589 3300031824 Ga0307413_10180440 Ga0307413_101804401 296
590 3300032002 Ga0307416_100159849 Ga0307416_1001598492 296
591 3300035172 Ga0373955_0083037 Ga0373955_0083037_468_1379 296
592 3300035410 Ga0373924_0020148 Ga0373924_0020148_1552_2460 296
593 3300036401 Ga0373937_0018936 Ga0373937_0018936_790_1692 296
594 3300036401 Ga0373937_0056959 Ga0373937_0056959_1806_2717 296
595 3300037471 Ga0395905_0006927 Ga0395905_0006927_8651_9559 296
596 3300041443 Ga0451789_1210807 Ga0451789_1210807_482_1393 296
597 3300041452 Ga0451793_0513185 Ga0451793_0513185_807_1718 296
598 3300041505 Ga0451849_0159593 Ga0451849_0159593_81_983 296
599 3300042439 Ga0439464_0025929 Ga0439464_0025929_50_958 296
600 3300046462 Ga0495651_0219162 Ga0495651_0219162_306_1217 296
601 3300046519 Ga0495632_0002042 Ga0495632_0002042_9686_10597 296
602 3300046679 Ga0495623_0180609 Ga0495623_0180609_101_1012 296
603 3300049572 Ga0501036_0150633 Ga0501036_0150633_638_1546 296
604 3300049580 Ga0501046_0156235 Ga0501046_0156235_157_1065 296
605 3300049824 Ga0501045_0169894 Ga0501045_0169894_559_1467 296
606 3300050494 nmdc:mga06z11_90534_c1 nmdc:mga06z11_90534_c1_441_1349 296
607 3300050513 nmdc:mga0rr50_17231_c1 nmdc:mga0rr50_17231_c1_3669_4580 296
608 3300050515 nmdc:mga0a205_109270_c1 nmdc:mga0a205_109270_c1_135_1046 296
609 3300053086 Ga0500578_0001274 Ga0500578_0001274_6476_7447 296
610 3300053098 Ga0500650_0052354 Ga0500650_0052354_335_1246 296
611 3300053108 Ga0500562_040360 Ga0500562_040360_241_1152 296
612 3300053117 Ga0500593_005564 Ga0500593_005564_2232_3140 296
613 3300053130 Ga0500642_0037765 Ga0500642_0037765_300_1211 296
614 3300053139 Ga0500568_0102237 Ga0500568_0102237_30_941 296
615 3300053153 Ga0500616_0045635 Ga0500616_0045635_1307_2263 296
616 3300053156 Ga0500622_0000164 Ga0500622_0000164_66414_67325 296
617 iso_pu_bacteria 2585428057 2587730005 296
618 iso_pu_bacteria 2585428058 2587734879 296
619 iso_pu_bacteria 2588253510 2588293170 296
620 iso_pu_bacteria 2643221592 2643968400 296
621 iso_pu_bacteria 2643221625 2644141808 296
622 iso_pu_bacteria 2643221648 2644272522 296
623 3300002704 JGI25155J39150_1000009 JGI25155J39150_1000009151 297
624 3300002705 JGI25156J39149_1000009 JGI25156J39149_100000969 297
625 3300002738 JGI25154J39366_1000024 JGI25154J39366_100002469 297
626 3300002741 JGI25157J39369_1000007 JGI25157J39369_100000769 297
627 3300002987 JGI25159J45721_1000402 JGI25159J45721_10004027 297
628 3300002987 JGI25159J45721_1000474 JGI25159J45721_10004744 297
629 3300003187 JGI25151J46595_10002845 JGI25151J46595_100028457 297
630 3300003354 JGI25160J50197_1000117 JGI25160J50197_100011749 297
631 3300003374 JGI25161J50226_1000009 JGI25161J50226_1000009160 297
632 3300003771 Ga0055526_1003249 Ga0055526_10032498 297
633 3300003771 Ga0055526_1007405 Ga0055526_10074055 297
634 3300003775 Ga0055524_1000047 Ga0055524_100004730 297
635 3300003775 Ga0055524_1000143 Ga0055524_100014325 297
636 3300003784 Ga0055534_1000967 Ga0055534_100096719 297
637 3300003790 Ga0055528_1000812 Ga0055528_100081226 297
638 3300003791 Ga0055530_10000252 Ga0055530_1000025230 297
639 3300003792 Ga0055540_1000027 Ga0055540_1000027114 297
640 3300003794 Ga0055531_10008317 Ga0055531_100083173 297
641 3300004625 Ga0055543_1001706 Ga0055543_10017062 297
642 3300005262 Ga0065165_1021619 Ga0065165_10216192 297
643 3300005539 Ga0068853_100067941 Ga0068853_1000679412 297
644 3300006038 Ga0075365_10260821 Ga0075365_102608212 297
645 3300006353 Ga0075370_10120486 Ga0075370_101204861 297
646 3300012513 Ga0157326_1001281 Ga0157326_10012812 297
647 3300025206 Ga0209435_100051 Ga0209435_10005127 297
648 3300025208 Ga0209436_109092 Ga0209436_1090922 297
649 3300025246 Ga0209646_1000029 Ga0209646_1000029303 297
650 3300025250 Ga0209026_1000016 Ga0209026_1000016303 297
651 3300025256 Ga0209759_1000016 Ga0209759_1000016303 297
652 3300025263 Ga0209565_1000122 Ga0209565_100012243 297
653 3300025263 Ga0209565_1000551 Ga0209565_100055125 297
654 3300025273 Ga0209673_1000302 Ga0209673_100030229 297
655 3300025284 Ga0209130_1000014 Ga0209130_100001468 297
656 3300025284 Ga0209130_1001940 Ga0209130_100194011 297
657 3300025291 Ga0209675_1000098 Ga0209675_100009870 297
658 3300025292 Ga0209676_1000013 Ga0209676_1000013687 297
659 3300025292 Ga0209676_1006368 Ga0209676_10063682 297
660 3300025294 Ga0209025_1009911 Ga0209025_10099114 297
661 3300025294 Ga0209025_1010306 Ga0209025_10103064 297
662 3300025294 Ga0209025_1015171 Ga0209025_10151713 297
663 3300025294 Ga0209025_1051898 Ga0209025_10518982 297
664 3300025295 Ga0209564_1000181 Ga0209564_10001818 297
665 3300025295 Ga0209564_1003446 Ga0209564_10034468 297
666 3300025295 Ga0209564_1007257 Ga0209564_10072573 297
667 3300025297 Ga0209758_1019783 Ga0209758_10197832 297
668 3300025298 Ga0209050_1000008 Ga0209050_1000008687 297
669 3300025298 Ga0209050_1006029 Ga0209050_10060296 297
670 3300025298 Ga0209050_1022835 Ga0209050_10228352 297
671 3300025299 Ga0209256_1000039 Ga0209256_1000039286 297
672 3300025302 Ga0207426_1000224 Ga0207426_100022468 297
673 3300025303 Ga0209051_1000005 Ga0209051_1000005687 297
674 3300025304 Ga0209257_1000031 Ga0209257_1000031277 297
675 3300025304 Ga0209257_1011422 Ga0209257_10114226 297
676 3300026041 Ga0207639_10207533 Ga0207639_102075332 297
677 3300031456 Ga0307513_10000013 Ga0307513_10000013102 297
678 3300031456 Ga0307513_10000194 Ga0307513_1000019441 297
679 3300031548 Ga0307408_100004950 Ga0307408_1000049507 297
680 3300031901 Ga0307406_10036044 Ga0307406_100360445 297
681 3300053117 Ga0500593_007263 Ga0500593_007263_1934_2827 297
682 3300053730 Ga0500645_000206 Ga0500645_000206_32175_33068 297
683 3300053730 Ga0500645_002283 Ga0500645_002283_3898_4791 297

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

28

188

0.97

PF14833

NAD_binding_11

NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase

191

311

0.93

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

28

123

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cky-assembly1.cif.gz_A structural and kinetic properties of a beta-hydroxyacid dehydrogenase involved in nicotinate fermentation 0.9325 1 297
2uyy-assembly1.cif.gz_D structure of the cytokine-like nuclear factor n-pac 0.9169 2 285
3cky-assembly2.cif.gz_D structural and kinetic properties of a beta-hydroxyacid dehydrogenase involved in nicotinate fermentation 0.9156 50 297
3pdu-assembly1.cif.gz_D crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with nadp+ 0.9148 1 286
3pef-assembly1.cif.gz_D crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with nadp+ 0.913 1 287
ID Description Score Start End Superfamily
af_F1QE62_28_195_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9613 2 164 3.40.50.720
af_Q9C991_11_173_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9529 2 159 3.40.50.720
af_Q9XTI0_3_164_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9471 4 164 3.40.50.720
5je8D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9467 1 163 3.40.50.720
3ckyB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9466 1 163 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4U6MEY8-F1-model_v4 Sulfolactaldehyde 3-reductase 0.9915 94 165 GO:0016616
GO:0050661
AF-A0A7U3E5M3-F1-model_v4 deleted 0.9769 2 297
AF-A0A352S2Q2-F1-model_v4 2-hydroxy-3-oxopropionate reductase 0.9745 72 159 GO:0050661
AF-A0A7X6ISJ6-F1-model_v4 deleted 0.9744 58 175
AF-A0A435TWV6-F1-model_v4 deleted 0.9732 50 297

Feature Viewer

pLDDT pTM Quality
96.65 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map