F474975
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 683 | 321 | 653 | 295 |
Family's Representative Sequence
| Representative Sequence | 3300025298|Ga0209050_1000257|Ga0209050_100025786 |
| Length | 323 |
| Sequence | MRERLARQLIQDIDTTEGKNMTASKNPRVGFIGLGMMGHGMAKNLLAKGFPVSFVAHRNRSNLQDLLDAGASEQPTRAAVAVASDVVIICVTGSPQVEEIVYGTEGLLTAAAKGLTVIDTSTAEPASTARIRADFAARGVAFIDAPLARTPKEAEEGRLNTMVGAEQADFDRVRPVLAAFCENIFHVGPPGHGHVLKLINNMLAMTTAAAIAEATATAAKSGLSLQKLFEVISAGGVNSGIFQMMLGKTLQGDLAGLKFAIGNAQKDLRYYTHLTEMLPTTSFLAEAAHQSFVQAGNLGLGDKFIASLLEAQEKLNNVQIIPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 3 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 4 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 5 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 6 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 7 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 8 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 9 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 10 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 11 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 12 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 13 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 14 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 15 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 16 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 17 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 18 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 19 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 20 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 21 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 22 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 23 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 24 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 25 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 26 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 30 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 31 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 33 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 35 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 36 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 40 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 43 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 87 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 89 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 90 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 91 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 93 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 103 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 127 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 130 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 131 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 132 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 194 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 198 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 199 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 200 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 201 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 202 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 203 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 204 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 205 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 206 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 207 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 208 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 210 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 211 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 212 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 213 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 214 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 215 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 216 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 217 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 218 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 219 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 220 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 223 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 224 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 225 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 226 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 227 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 230 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 231 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 232 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 233 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 234 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 235 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 236 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 237 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 238 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 239 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 240 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 241 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 242 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 243 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 244 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 245 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 246 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 247 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 272 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 285 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 289 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 290 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 291 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 292 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 293 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 294 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 299 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 301 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 302 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 303 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 304 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 305 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 306 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 307 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 308 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 309 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 310 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 311 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 312 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 313 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 314 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 315 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 316 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 317 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 318 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 320 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.1 |
| Metatranscriptomes | 0 |
| Isolates | 1.9 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 24.01 |
| Nodule | 0.15 |
| Rhizoplane | 1.02 |
| Rhizosphere | 68.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000009 | 3300002704 | Bacteria | 224358 |
| 2 | JGI25156J39149_1000009 | 3300002705 | Bacteria | 224379 |
| 3 | JGI25154J39366_1000024 | 3300002738 | Bacteria | 211372 |
| 4 | JGI25157J39369_1000007 | 3300002741 | Bacteria | 224377 |
| 5 | JGI25152J39213_1003177 | 3300002773 | Bacteria | 5718 |
| 6 | JGI25150J39212_1017171 | 3300002774 | Bacteria | 1173 |
| 7 | JGI25159J45721_1000402 | 3300002987 | Bacteria | 20189 |
| 8 | JGI25159J45721_1000474 | 3300002987 | Bacteria | 18495 |
| 9 | JGI25159J45721_1003869 | 3300002987 | Bacteria | 5132 |
| 10 | JGI25151J46595_10002845 | 3300003187 | Bacteria | 9965 |
| 11 | JGI25151J46595_10014225 | 3300003187 | Bacteria | 3552 |
| 12 | JGI25151J46595_10017793 | 3300003187 | Bacteria | 3069 |
| 13 | JGI25153J46596_10001286 | 3300003215 | Bacteria | 15041 |
| 14 | JGI25153J46596_10003485 | 3300003215 | Bacteria | 8798 |
| 15 | rootL2_10212273 | 3300003322 | Bacteria | 2091 |
| 16 | rootH1_10066207 | 3300003323 | Bacteria | 2230 |
| 17 | JGI25160J50197_1000117 | 3300003354 | Bacteria | 72240 |
| 18 | JGI25160J50197_1000240 | 3300003354 | Bacteria | 42558 |
| 19 | JGI25161J50226_1000009 | 3300003374 | Bacteria | 224699 |
| 20 | Ga0055526_1001550 | 3300003771 | Bacteria | 16263 |
| 21 | Ga0055526_1003249 | 3300003771 | Bacteria | 10465 |
| 22 | Ga0055526_1007405 | 3300003771 | Bacteria | 5710 |
| 23 | Ga0055537_1000020 | 3300003773 | Bacteria | 117325 |
| 24 | Ga0055524_1000047 | 3300003775 | Bacteria | 150887 |
| 25 | Ga0055524_1000143 | 3300003775 | Bacteria | 84686 |
| 26 | Ga0055534_1000901 | 3300003784 | Bacteria | 13451 |
| 27 | Ga0055534_1000967 | 3300003784 | Bacteria | 12750 |
| 28 | Ga0055534_1003852 | 3300003784 | Bacteria | 4578 |
| 29 | Ga0055528_1000812 | 3300003790 | Bacteria | 21450 |
| 30 | Ga0055528_1000973 | 3300003790 | Bacteria | 19015 |
| 31 | Ga0055530_10000252 | 3300003791 | Bacteria | 48125 |
| 32 | Ga0055540_1000027 | 3300003792 | Bacteria | 187454 |
| 33 | Ga0055531_10001909 | 3300003794 | Bacteria | 14594 |
| 34 | Ga0055531_10008317 | 3300003794 | Bacteria | 5499 |
| 35 | Ga0055543_1000199 | 3300004625 | Bacteria | 49097 |
| 36 | Ga0055543_1001706 | 3300004625 | Bacteria | 8290 |
| 37 | Ga0065165_1000832 | 3300005262 | Bacteria | 40569 |
| 38 | Ga0065165_1010769 | 3300005262 | Bacteria | 3903 |
| 39 | Ga0065165_1011728 | 3300005262 | Bacteria | 3621 |
| 40 | Ga0065165_1021619 | 3300005262 | Bacteria | 2229 |
| 41 | Ga0070690_100001392 | 3300005330 | Bacteria | 12605 |
| 42 | Ga0070690_100020078 | 3300005330 | Bacteria | 4067 |
| 43 | Ga0070690_100157446 | 3300005330 | Bacteria | 1554 |
| 44 | Ga0070670_100035710 | 3300005331 | Bacteria | 4278 |
| 45 | Ga0070670_100080828 | 3300005331 | Bacteria | 2793 |
| 46 | Ga0070670_100451391 | 3300005331 | Bacteria | 1139 |
| 47 | Ga0070677_10051187 | 3300005333 | Bacteria | 1671 |
| 48 | Ga0070677_10052777 | 3300005333 | Bacteria | 1651 |
| 49 | Ga0070677_10098565 | 3300005333 | Bacteria | 1284 |
| 50 | Ga0068869_100000631 | 3300005334 | Bacteria | 19900 |
| 51 | Ga0068869_100024865 | 3300005334 | Bacteria | 4152 |
| 52 | Ga0068869_100025542 | 3300005334 | Bacteria | 4103 |
| 53 | Ga0068869_100038558 | 3300005334 | Bacteria | 3407 |
| 54 | Ga0068869_100399917 | 3300005334 | Bacteria | 1130 |
| 55 | Ga0070666_10013495 | 3300005335 | Bacteria | 5185 |
| 56 | Ga0070680_100121813 | 3300005336 | Bacteria | 2178 |
| 57 | Ga0068868_100001100 | 3300005338 | Bacteria | 18486 |
| 58 | Ga0068868_100247837 | 3300005338 | Bacteria | 1498 |
| 59 | Ga0070689_100003108 | 3300005340 | Bacteria | 10962 |
| 60 | Ga0070689_100064767 | 3300005340 | Bacteria | 2846 |
| 61 | Ga0070689_100094251 | 3300005340 | Bacteria | 2364 |
| 62 | Ga0070689_100142447 | 3300005340 | Bacteria | 1928 |
| 63 | Ga0070661_100141193 | 3300005344 | Bacteria | 1815 |
| 64 | Ga0070668_100029973 | 3300005347 | Bacteria | 4134 |
| 65 | Ga0070668_100248896 | 3300005347 | Bacteria | 1475 |
| 66 | Ga0070669_100148065 | 3300005353 | Bacteria | 1815 |
| 67 | Ga0070669_100178964 | 3300005353 | Bacteria | 1658 |
| 68 | Ga0070675_100000422 | 3300005354 | Bacteria | 28826 |
| 69 | Ga0070675_100022267 | 3300005354 | Bacteria | 5062 |
| 70 | Ga0070675_100028908 | 3300005354 | Bacteria | 4466 |
| 71 | Ga0070675_100044916 | 3300005354 | Bacteria | 3614 |
| 72 | Ga0070675_100078392 | 3300005354 | Bacteria | 2751 |
| 73 | Ga0070671_100022045 | 3300005355 | Bacteria | 5203 |
| 74 | Ga0070671_100071674 | 3300005355 | Bacteria | 2892 |
| 75 | Ga0070671_100216592 | 3300005355 | Bacteria | 1624 |
| 76 | Ga0070671_100338824 | 3300005355 | Bacteria | 1282 |
| 77 | Ga0070671_100417755 | 3300005355 | Bacteria | 1148 |
| 78 | Ga0070671_100525477 | 3300005355 | Bacteria | 1019 |
| 79 | Ga0070674_100014175 | 3300005356 | Bacteria | 4949 |
| 80 | Ga0070674_100201383 | 3300005356 | Bacteria | 1538 |
| 81 | Ga0070674_100332471 | 3300005356 | Bacteria | 1221 |
| 82 | Ga0070673_100033758 | 3300005364 | Bacteria | 3866 |
| 83 | Ga0070673_100074690 | 3300005364 | Bacteria | 2732 |
| 84 | Ga0070673_100286302 | 3300005364 | Bacteria | 1447 |
| 85 | Ga0070673_100293410 | 3300005364 | Bacteria | 1430 |
| 86 | Ga0070688_100004402 | 3300005365 | Bacteria | 7323 |
| 87 | Ga0070688_100137504 | 3300005365 | Bacteria | 1656 |
| 88 | Ga0070688_100205502 | 3300005365 | Unclassified | 1380 |
| 89 | Ga0070688_100383276 | 3300005365 | Bacteria | 1037 |
| 90 | Ga0070659_100129605 | 3300005366 | Bacteria | 2047 |
| 91 | Ga0070667_100030592 | 3300005367 | Bacteria | 4490 |
| 92 | Ga0070667_100519500 | 3300005367 | Bacteria | 1093 |
| 93 | Ga0070714_100011248 | 3300005435 | Bacteria | 7094 |
| 94 | Ga0070713_100001288 | 3300005436 | Bacteria | 16024 |
| 95 | Ga0070713_100071478 | 3300005436 | Bacteria | 2932 |
| 96 | Ga0070701_10000512 | 3300005438 | Bacteria | 13327 |
| 97 | Ga0070700_100000680 | 3300005441 | Bacteria | 16817 |
| 98 | Ga0070663_100059886 | 3300005455 | Bacteria | 2737 |
| 99 | Ga0070663_100243759 | 3300005455 | Bacteria | 1420 |
| 100 | Ga0070678_100010764 | 3300005456 | Bacteria | 5604 |
| 101 | Ga0070678_100011176 | 3300005456 | Bacteria | 5528 |
| 102 | Ga0070678_100097297 | 3300005456 | Bacteria | 2272 |
| 103 | Ga0070678_100109843 | 3300005456 | Bacteria | 2155 |
| 104 | Ga0070678_100126120 | 3300005456 | Bacteria | 2026 |
| 105 | Ga0070678_100223377 | 3300005456 | Bacteria | 1566 |
| 106 | Ga0070678_100233510 | 3300005456 | Bacteria | 1534 |
| 107 | Ga0070678_100311266 | 3300005456 | Bacteria | 1342 |
| 108 | Ga0070662_100463964 | 3300005457 | Bacteria | 1053 |
| 109 | Ga0070681_10120812 | 3300005458 | Bacteria | 2555 |
| 110 | Ga0068867_100002384 | 3300005459 | Bacteria | 13215 |
| 111 | Ga0068867_100016098 | 3300005459 | Bacteria | 5310 |
| 112 | Ga0068867_100053004 | 3300005459 | Bacteria | 2995 |
| 113 | Ga0068867_100109642 | 3300005459 | Bacteria | 2119 |
| 114 | Ga0068867_100400886 | 3300005459 | Bacteria | 1157 |
| 115 | Ga0070706_100025761 | 3300005467 | Bacteria | 5412 |
| 116 | Ga0068853_100067941 | 3300005539 | Bacteria | 3098 |
| 117 | Ga0070672_100007566 | 3300005543 | Bacteria | 7383 |
| 118 | Ga0070672_100050232 | 3300005543 | Bacteria | 3247 |
| 119 | Ga0070672_100124469 | 3300005543 | Bacteria | 2113 |
| 120 | Ga0070672_100290757 | 3300005543 | Bacteria | 1383 |
| 121 | Ga0070686_100000973 | 3300005544 | Bacteria | 16512 |
| 122 | Ga0070696_100023215 | 3300005546 | Bacteria | 4215 |
| 123 | Ga0070696_100038871 | 3300005546 | Bacteria | 3285 |
| 124 | Ga0070693_100005977 | 3300005547 | Bacteria | 5883 |
| 125 | Ga0070693_100128489 | 3300005547 | Bacteria | 1581 |
| 126 | Ga0070665_100005277 | 3300005548 | Bacteria | 13348 |
| 127 | Ga0070665_100053168 | 3300005548 | Bacteria | 4062 |
| 128 | Ga0070665_100386108 | 3300005548 | Bacteria | 1408 |
| 129 | Ga0070704_100138497 | 3300005549 | Bacteria | 1897 |
| 130 | Ga0070664_100249396 | 3300005564 | Bacteria | 1595 |
| 131 | Ga0068857_100178986 | 3300005577 | Bacteria | 1929 |
| 132 | Ga0068854_100038140 | 3300005578 | Bacteria | 3377 |
| 133 | Ga0070702_100001461 | 3300005615 | Bacteria | 9684 |
| 134 | Ga0068852_100236236 | 3300005616 | Bacteria | 1745 |
| 135 | Ga0068859_100004520 | 3300005617 | Bacteria | 14187 |
| 136 | Ga0068859_100014408 | 3300005617 | Bacteria | 7933 |
| 137 | Ga0068859_100139094 | 3300005617 | Bacteria | 2502 |
| 138 | Ga0068859_100242938 | 3300005617 | Bacteria | 1890 |
| 139 | Ga0068859_100278097 | 3300005617 | Bacteria | 1766 |
| 140 | Ga0068864_100001444 | 3300005618 | Bacteria | 19588 |
| 141 | Ga0068864_100021397 | 3300005618 | Bacteria | 5419 |
| 142 | Ga0068866_10000632 | 3300005718 | Bacteria | 15998 |
| 143 | Ga0068866_10009776 | 3300005718 | Bacteria | 4086 |
| 144 | Ga0068861_100001526 | 3300005719 | Bacteria | 14664 |
| 145 | Ga0068861_100004985 | 3300005719 | Bacteria | 8946 |
| 146 | Ga0068861_100219964 | 3300005719 | Bacteria | 1604 |
| 147 | Ga0068861_100649709 | 3300005719 | Bacteria | 974 |
| 148 | Ga0068851_10034595 | 3300005834 | Bacteria | 2523 |
| 149 | Ga0068851_10126681 | 3300005834 | Bacteria | 1377 |
| 150 | Ga0068870_10010668 | 3300005840 | Bacteria | 4228 |
| 151 | Ga0068863_100031771 | 3300005841 | Bacteria | 5037 |
| 152 | Ga0068863_100067070 | 3300005841 | Bacteria | 3395 |
| 153 | Ga0068863_100189823 | 3300005841 | Bacteria | 1974 |
| 154 | Ga0068863_100308542 | 3300005841 | Bacteria | 1536 |
| 155 | Ga0068858_100000436 | 3300005842 | Bacteria | 43518 |
| 156 | Ga0068858_100022445 | 3300005842 | Bacteria | 5890 |
| 157 | Ga0068858_100168829 | 3300005842 | Bacteria | 2062 |
| 158 | Ga0068858_100265785 | 3300005842 | Bacteria | 1632 |
| 159 | Ga0068858_100395282 | 3300005842 | Bacteria | 1328 |
| 160 | Ga0068860_100001387 | 3300005843 | Bacteria | 26293 |
| 161 | Ga0068860_100040991 | 3300005843 | Bacteria | 4424 |
| 162 | Ga0068860_100126878 | 3300005843 | Bacteria | 2446 |
| 163 | Ga0068860_100656792 | 3300005843 | Bacteria | 1057 |
| 164 | Ga0068862_100002384 | 3300005844 | Bacteria | 16717 |
| 165 | Ga0068862_100010800 | 3300005844 | Bacteria | 7541 |
| 166 | Ga0068862_100036607 | 3300005844 | Bacteria | 4160 |
| 167 | Ga0068862_100305111 | 3300005844 | Bacteria | 1465 |
| 168 | Ga0081539_10017821 | 3300005985 | Bacteria | 4961 |
| 169 | Ga0070717_10213025 | 3300006028 | Bacteria | 1696 |
| 170 | Ga0075365_10168002 | 3300006038 | Bacteria | 1531 |
| 171 | Ga0075365_10260821 | 3300006038 | Bacteria | 1218 |
| 172 | Ga0075363_100012169 | 3300006048 | Bacteria | 4140 |
| 173 | Ga0075364_10009318 | 3300006051 | Bacteria | 5883 |
| 174 | Ga0075364_10070091 | 3300006051 | Bacteria | 2307 |
| 175 | Ga0070712_100024404 | 3300006175 | Bacteria | 4007 |
| 176 | Ga0075367_10023806 | 3300006178 | Bacteria | 3449 |
| 177 | Ga0075367_10184647 | 3300006178 | Bacteria | 1300 |
| 178 | Ga0075366_10006732 | 3300006195 | Bacteria | 6311 |
| 179 | Ga0075366_10010048 | 3300006195 | Bacteria | 5305 |
| 180 | Ga0075366_10021481 | 3300006195 | Bacteria | 3752 |
| 181 | Ga0075366_10025415 | 3300006195 | Bacteria | 3459 |
| 182 | Ga0075366_10027699 | 3300006195 | Bacteria | 3326 |
| 183 | Ga0075366_10104141 | 3300006195 | Bacteria | 1705 |
| 184 | Ga0097621_100002825 | 3300006237 | Bacteria | 11902 |
| 185 | Ga0097621_100005706 | 3300006237 | Bacteria | 8794 |
| 186 | Ga0097621_100021589 | 3300006237 | Bacteria | 4984 |
| 187 | Ga0097621_100027003 | 3300006237 | Bacteria | 4510 |
| 188 | Ga0097621_100070706 | 3300006237 | Bacteria | 2882 |
| 189 | Ga0097621_100389383 | 3300006237 | Bacteria | 1246 |
| 190 | Ga0075370_10035330 | 3300006353 | Bacteria | 2805 |
| 191 | Ga0075370_10120486 | 3300006353 | Bacteria | 1527 |
| 192 | Ga0068871_100005154 | 3300006358 | Bacteria | 9137 |
| 193 | Ga0068871_100018572 | 3300006358 | Bacteria | 5289 |
| 194 | Ga0068871_100065570 | 3300006358 | Bacteria | 2974 |
| 195 | Ga0068871_100161197 | 3300006358 | Bacteria | 1918 |
| 196 | Ga0068871_100250503 | 3300006358 | Bacteria | 1542 |
| 197 | Ga0075433_10056208 | 3300006852 | Bacteria | 3437 |
| 198 | Ga0075433_10102717 | 3300006852 | Bacteria | 2532 |
| 199 | Ga0075434_100041160 | 3300006871 | Bacteria | 4576 |
| 200 | Ga0068865_100000305 | 3300006881 | Bacteria | 27101 |
| 201 | Ga0068865_100000371 | 3300006881 | Bacteria | 24845 |
| 202 | Ga0068865_100207539 | 3300006881 | Bacteria | 1524 |
| 203 | Ga0075436_100023634 | 3300006914 | Bacteria | 4222 |
| 204 | Ga0097620_100004520 | 3300006931 | Bacteria | 14187 |
| 205 | Ga0097620_100014408 | 3300006931 | Bacteria | 7933 |
| 206 | Ga0097620_100139088 | 3300006931 | Bacteria | 2502 |
| 207 | Ga0097620_100242932 | 3300006931 | Bacteria | 1890 |
| 208 | Ga0097620_100278110 | 3300006931 | Bacteria | 1766 |
| 209 | Ga0079104_1012746 | 3300006946 | Bacteria | 2623 |
| 210 | Ga0075435_100140160 | 3300007076 | Bacteria | 2028 |
| 211 | Ga0105245_10008300 | 3300009098 | Bacteria | 9072 |
| 212 | Ga0105245_10067086 | 3300009098 | Bacteria | 3249 |
| 213 | Ga0114129_10126379 | 3300009147 | Bacteria | 3515 |
| 214 | Ga0114129_10178343 | 3300009147 | Bacteria | 2892 |
| 215 | Ga0114129_10686451 | 3300009147 | Bacteria | 1317 |
| 216 | Ga0114129_10689742 | 3300009147 | Bacteria | 1314 |
| 217 | Ga0105243_10004538 | 3300009148 | Bacteria | 10971 |
| 218 | Ga0105243_10013136 | 3300009148 | Bacteria | 6259 |
| 219 | Ga0105243_10090013 | 3300009148 | Bacteria | 2524 |
| 220 | Ga0105243_10210349 | 3300009148 | Bacteria | 1712 |
| 221 | Ga0105243_10290724 | 3300009148 | Bacteria | 1476 |
| 222 | Ga0105241_10022246 | 3300009174 | Bacteria | 4694 |
| 223 | Ga0105242_10001363 | 3300009176 | Bacteria | 19278 |
| 224 | Ga0105242_10030898 | 3300009176 | Bacteria | 4278 |
| 225 | Ga0105242_10097193 | 3300009176 | Bacteria | 2489 |
| 226 | Ga0105242_10108408 | 3300009176 | Bacteria | 2363 |
| 227 | Ga0105242_10358448 | 3300009176 | Bacteria | 1349 |
| 228 | Ga0105242_10424242 | 3300009176 | Bacteria | 1247 |
| 229 | Ga0105248_10018384 | 3300009177 | Bacteria | 7722 |
| 230 | Ga0105248_10060749 | 3300009177 | Bacteria | 4243 |
| 231 | Ga0105248_10124945 | 3300009177 | Bacteria | 2902 |
| 232 | Ga0105248_10146496 | 3300009177 | Bacteria | 2664 |
| 233 | Ga0105248_10205658 | 3300009177 | Bacteria | 2218 |
| 234 | Ga0105248_10262630 | 3300009177 | Bacteria | 1944 |
| 235 | Ga0105238_10344814 | 3300009551 | Bacteria | 1478 |
| 236 | Ga0105249_10009105 | 3300009553 | Bacteria | 8683 |
| 237 | Ga0105249_10045362 | 3300009553 | Bacteria | 3998 |
| 238 | Ga0105249_10178096 | 3300009553 | Bacteria | 2067 |
| 239 | Ga0105249_10199795 | 3300009553 | Bacteria | 1956 |
| 240 | Ga0105239_10364228 | 3300010375 | Bacteria | 1633 |
| 241 | Ga0157326_1001281 | 3300012513 | Bacteria | 2794 |
| 242 | Ga0157326_1001965 | 3300012513 | Bacteria | 2232 |
| 243 | Ga0157370_10145615 | 3300013104 | Bacteria | 2206 |
| 244 | Ga0157374_10211848 | 3300013296 | Bacteria | 1900 |
| 245 | Ga0157378_10001140 | 3300013297 | Bacteria | 24155 |
| 246 | Ga0157378_10010272 | 3300013297 | Bacteria | 8174 |
| 247 | Ga0157378_10177105 | 3300013297 | Bacteria | 2004 |
| 248 | Ga0157378_10493944 | 3300013297 | Bacteria | 1221 |
| 249 | Ga0163162_10000948 | 3300013306 | Bacteria | 26987 |
| 250 | Ga0163162_10017890 | 3300013306 | Bacteria | 6933 |
| 251 | Ga0163162_10525979 | 3300013306 | Unclassified | 1312 |
| 252 | Ga0163162_10554114 | 3300013306 | Bacteria | 1278 |
| 253 | Ga0157372_10531022 | 3300013307 | Bacteria | 1371 |
| 254 | Ga0157375_10061001 | 3300013308 | Bacteria | 3742 |
| 255 | Ga0157375_10134345 | 3300013308 | Bacteria | 2596 |
| 256 | Ga0157375_10165231 | 3300013308 | Bacteria | 2358 |
| 257 | Ga0157375_10183914 | 3300013308 | Bacteria | 2242 |
| 258 | Ga0157375_10337114 | 3300013308 | Bacteria | 1673 |
| 259 | Ga0157375_10365618 | 3300013308 | Bacteria | 1609 |
| 260 | Ga0163163_10238443 | 3300014325 | Bacteria | 1868 |
| 261 | Ga0163163_10262681 | 3300014325 | Bacteria | 1777 |
| 262 | Ga0157380_10000449 | 3300014326 | Bacteria | 25167 |
| 263 | Ga0157380_10034222 | 3300014326 | Bacteria | 3918 |
| 264 | Ga0157380_10112856 | 3300014326 | Bacteria | 2287 |
| 265 | Ga0157380_10175681 | 3300014326 | Bacteria | 1876 |
| 266 | Ga0157380_10200827 | 3300014326 | Bacteria | 1769 |
| 267 | Ga0157377_10003600 | 3300014745 | Bacteria | 7016 |
| 268 | Ga0157379_10007509 | 3300014968 | Bacteria | 9437 |
| 269 | Ga0157379_10020080 | 3300014968 | Bacteria | 5905 |
| 270 | Ga0157379_10138739 | 3300014968 | Bacteria | 2191 |
| 271 | Ga0157379_10241174 | 3300014968 | Bacteria | 1640 |
| 272 | Ga0157376_10013138 | 3300014969 | Bacteria | 6170 |
| 273 | Ga0157376_10024182 | 3300014969 | Bacteria | 4766 |
| 274 | Ga0157376_10037162 | 3300014969 | Bacteria | 3950 |
| 275 | Ga0157376_10074822 | 3300014969 | Bacteria | 2888 |
| 276 | Ga0157376_10132229 | 3300014969 | Bacteria | 2228 |
| 277 | Ga0157376_10342347 | 3300014969 | Bacteria | 1428 |
| 278 | Ga0157376_10345028 | 3300014969 | Bacteria | 1423 |
| 279 | Ga0157376_10496136 | 3300014969 | Bacteria | 1199 |
| 280 | Ga0163161_10006676 | 3300017792 | Bacteria | 7987 |
| 281 | Ga0163161_10190331 | 3300017792 | Bacteria | 1577 |
| 282 | Ga0209435_100008 | 3300025206 | Bacteria | 503644 |
| 283 | Ga0209435_100051 | 3300025206 | Bacteria | 90866 |
| 284 | Ga0209436_109092 | 3300025208 | Bacteria | 1922 |
| 285 | Ga0207425_1001920 | 3300025245 | Bacteria | 7843 |
| 286 | Ga0207425_1002658 | 3300025245 | Bacteria | 6146 |
| 287 | Ga0207425_1016265 | 3300025245 | Bacteria | 1653 |
| 288 | Ga0209646_1000029 | 3300025246 | Bacteria | 386414 |
| 289 | Ga0209026_1000016 | 3300025250 | Bacteria | 386457 |
| 290 | Ga0209759_1000016 | 3300025256 | Bacteria | 386414 |
| 291 | Ga0209129_1000075 | 3300025258 | Bacteria | 201273 |
| 292 | Ga0209565_1000061 | 3300025263 | Bacteria | 185308 |
| 293 | Ga0209565_1000122 | 3300025263 | Bacteria | 111132 |
| 294 | Ga0209565_1000551 | 3300025263 | Bacteria | 26059 |
| 295 | Ga0209565_1001661 | 3300025263 | Bacteria | 9294 |
| 296 | Ga0209673_1000298 | 3300025273 | Bacteria | 91771 |
| 297 | Ga0209673_1000302 | 3300025273 | Bacteria | 91221 |
| 298 | Ga0209673_1003861 | 3300025273 | Bacteria | 8458 |
| 299 | Ga0209673_1011939 | 3300025273 | Bacteria | 3539 |
| 300 | Ga0209130_1000014 | 3300025284 | Bacteria | 412039 |
| 301 | Ga0209130_1001940 | 3300025284 | Bacteria | 11488 |
| 302 | Ga0209130_1004197 | 3300025284 | Bacteria | 5624 |
| 303 | Ga0209130_1005309 | 3300025284 | Bacteria | 4519 |
| 304 | Ga0209675_1000098 | 3300025291 | Bacteria | 130512 |
| 305 | Ga0209675_1000105 | 3300025291 | Bacteria | 121013 |
| 306 | Ga0209675_1001283 | 3300025291 | Bacteria | 14924 |
| 307 | Ga0209675_1002955 | 3300025291 | Bacteria | 8385 |
| 308 | Ga0209675_1003943 | 3300025291 | Bacteria | 6800 |
| 309 | Ga0209675_1017807 | 3300025291 | Bacteria | 2015 |
| 310 | Ga0209676_1000013 | 3300025292 | Bacteria | 816080 |
| 311 | Ga0209676_1003560 | 3300025292 | Bacteria | 9415 |
| 312 | Ga0209676_1006368 | 3300025292 | Bacteria | 5847 |
| 313 | Ga0209676_1020092 | 3300025292 | Bacteria | 2278 |
| 314 | Ga0209025_1009911 | 3300025294 | Bacteria | 6549 |
| 315 | Ga0209025_1010306 | 3300025294 | Bacteria | 6350 |
| 316 | Ga0209025_1013495 | 3300025294 | Bacteria | 5127 |
| 317 | Ga0209025_1015171 | 3300025294 | Bacteria | 4670 |
| 318 | Ga0209025_1025924 | 3300025294 | Bacteria | 2963 |
| 319 | Ga0209025_1051898 | 3300025294 | Bacteria | 1624 |
| 320 | Ga0209564_1000046 | 3300025295 | Bacteria | 373787 |
| 321 | Ga0209564_1000181 | 3300025295 | Bacteria | 151002 |
| 322 | Ga0209564_1000247 | 3300025295 | Bacteria | 116628 |
| 323 | Ga0209564_1003446 | 3300025295 | Bacteria | 10818 |
| 324 | Ga0209564_1007257 | 3300025295 | Bacteria | 5758 |
| 325 | Ga0209564_1014320 | 3300025295 | Bacteria | 3307 |
| 326 | Ga0209758_1000045 | 3300025297 | Bacteria | 369174 |
| 327 | Ga0209758_1000052 | 3300025297 | Bacteria | 338962 |
| 328 | Ga0209758_1014508 | 3300025297 | Bacteria | 4181 |
| 329 | Ga0209758_1019783 | 3300025297 | Bacteria | 3226 |
| 330 | Ga0209758_1044978 | 3300025297 | Bacteria | 1607 |
| 331 | Ga0209050_1000008 | 3300025298 | Bacteria | 1144179 |
| 332 | Ga0209050_1000257 | 3300025298 | Bacteria | 114186 |
| 333 | Ga0209050_1006029 | 3300025298 | Bacteria | 7342 |
| 334 | Ga0209050_1011391 | 3300025298 | Bacteria | 4224 |
| 335 | Ga0209050_1022835 | 3300025298 | Bacteria | 2226 |
| 336 | Ga0209050_1027531 | 3300025298 | Bacteria | 1871 |
| 337 | Ga0209256_1000039 | 3300025299 | Bacteria | 372337 |
| 338 | Ga0209256_1012968 | 3300025299 | Bacteria | 3133 |
| 339 | Ga0209256_1030082 | 3300025299 | Bacteria | 1503 |
| 340 | Ga0207426_1000224 | 3300025302 | Bacteria | 130233 |
| 341 | Ga0207426_1000242 | 3300025302 | Bacteria | 122839 |
| 342 | Ga0207426_1000816 | 3300025302 | Bacteria | 33430 |
| 343 | Ga0209051_1000005 | 3300025303 | Bacteria | 1142353 |
| 344 | Ga0209051_1009002 | 3300025303 | Bacteria | 5199 |
| 345 | Ga0209051_1026527 | 3300025303 | Bacteria | 2332 |
| 346 | Ga0209257_1000031 | 3300025304 | Bacteria | 688770 |
| 347 | Ga0209257_1009089 | 3300025304 | Bacteria | 5433 |
| 348 | Ga0209257_1011422 | 3300025304 | Bacteria | 4277 |
| 349 | Ga0207682_10010395 | 3300025893 | Bacteria | 3648 |
| 350 | Ga0207682_10012243 | 3300025893 | Bacteria | 3349 |
| 351 | Ga0207682_10016949 | 3300025893 | Bacteria | 2844 |
| 352 | Ga0207682_10027171 | 3300025893 | Bacteria | 2277 |
| 353 | Ga0207642_10006840 | 3300025899 | Bacteria | 3816 |
| 354 | Ga0207642_10050531 | 3300025899 | Bacteria | 1876 |
| 355 | Ga0207688_10094510 | 3300025901 | Bacteria | 1720 |
| 356 | Ga0207680_10068485 | 3300025903 | Bacteria | 2190 |
| 357 | Ga0207699_10110131 | 3300025906 | Bacteria | 1763 |
| 358 | Ga0207643_10028008 | 3300025908 | Bacteria | 3127 |
| 359 | Ga0207643_10158274 | 3300025908 | Bacteria | 1361 |
| 360 | Ga0207684_10014503 | 3300025910 | Bacteria | 6793 |
| 361 | Ga0207707_10307111 | 3300025912 | Bacteria | 1371 |
| 362 | Ga0207693_10056021 | 3300025915 | Bacteria | 3091 |
| 363 | Ga0207693_10283297 | 3300025915 | Bacteria | 1299 |
| 364 | Ga0207649_10363448 | 3300025920 | Bacteria | 1075 |
| 365 | Ga0207646_10025948 | 3300025922 | Bacteria | 5356 |
| 366 | Ga0207681_10112675 | 3300025923 | Bacteria | 1981 |
| 367 | Ga0207650_10051820 | 3300025925 | Bacteria | 3038 |
| 368 | Ga0207650_10084484 | 3300025925 | Bacteria | 2413 |
| 369 | Ga0207650_10191225 | 3300025925 | Bacteria | 1635 |
| 370 | Ga0207659_10000355 | 3300025926 | Bacteria | 27371 |
| 371 | Ga0207659_10037234 | 3300025926 | Bacteria | 3376 |
| 372 | Ga0207659_10048355 | 3300025926 | Bacteria | 3012 |
| 373 | Ga0207659_10234719 | 3300025926 | Bacteria | 1481 |
| 374 | Ga0207687_10000800 | 3300025927 | Bacteria | 21246 |
| 375 | Ga0207700_10000605 | 3300025928 | Bacteria | 21017 |
| 376 | Ga0207664_10000197 | 3300025929 | Bacteria | 45209 |
| 377 | Ga0207644_10002035 | 3300025931 | Bacteria | 13083 |
| 378 | Ga0207644_10010478 | 3300025931 | Bacteria | 6110 |
| 379 | Ga0207644_10070047 | 3300025931 | Bacteria | 2562 |
| 380 | Ga0207644_10070163 | 3300025931 | Bacteria | 2560 |
| 381 | Ga0207690_10215328 | 3300025932 | Bacteria | 1467 |
| 382 | Ga0207706_10039697 | 3300025933 | Bacteria | 4173 |
| 383 | Ga0207706_10099167 | 3300025933 | Bacteria | 2563 |
| 384 | Ga0207686_10002242 | 3300025934 | Bacteria | 10617 |
| 385 | Ga0207686_10008362 | 3300025934 | Bacteria | 5586 |
| 386 | Ga0207709_10005847 | 3300025935 | Bacteria | 6953 |
| 387 | Ga0207709_10192695 | 3300025935 | Bacteria | 1449 |
| 388 | Ga0207670_10036809 | 3300025936 | Bacteria | 3185 |
| 389 | Ga0207670_10232786 | 3300025936 | Bacteria | 1415 |
| 390 | Ga0207669_10262938 | 3300025937 | Bacteria | 1291 |
| 391 | Ga0207704_10001417 | 3300025938 | Bacteria | 10719 |
| 392 | Ga0207704_10035604 | 3300025938 | Bacteria | 2854 |
| 393 | Ga0207704_10087355 | 3300025938 | Bacteria | 2036 |
| 394 | Ga0207704_10141494 | 3300025938 | Bacteria | 1684 |
| 395 | Ga0207704_10158074 | 3300025938 | Bacteria | 1609 |
| 396 | Ga0207691_10015746 | 3300025940 | Bacteria | 7187 |
| 397 | Ga0207691_10025614 | 3300025940 | Bacteria | 5537 |
| 398 | Ga0207691_10026141 | 3300025940 | Bacteria | 5477 |
| 399 | Ga0207691_10060236 | 3300025940 | Bacteria | 3450 |
| 400 | Ga0207691_10102507 | 3300025940 | Bacteria | 2553 |
| 401 | Ga0207691_10165763 | 3300025940 | Bacteria | 1936 |
| 402 | Ga0207691_10211255 | 3300025940 | Bacteria | 1685 |
| 403 | Ga0207711_10020774 | 3300025941 | Bacteria | 5479 |
| 404 | Ga0207711_10075318 | 3300025941 | Bacteria | 2937 |
| 405 | Ga0207711_10094429 | 3300025941 | Bacteria | 2636 |
| 406 | Ga0207711_10176107 | 3300025941 | Bacteria | 1943 |
| 407 | Ga0207711_10176970 | 3300025941 | Bacteria | 1938 |
| 408 | Ga0207711_10377460 | 3300025941 | Bacteria | 1315 |
| 409 | Ga0207689_10000642 | 3300025942 | Bacteria | 33355 |
| 410 | Ga0207689_10005711 | 3300025942 | Bacteria | 11065 |
| 411 | Ga0207689_10015983 | 3300025942 | Bacteria | 6351 |
| 412 | Ga0207689_10016667 | 3300025942 | Bacteria | 6218 |
| 413 | Ga0207689_10249644 | 3300025942 | Bacteria | 1467 |
| 414 | Ga0207679_10320159 | 3300025945 | Bacteria | 1343 |
| 415 | Ga0207679_10352316 | 3300025945 | Bacteria | 1284 |
| 416 | Ga0207667_10115216 | 3300025949 | Bacteria | 2770 |
| 417 | Ga0207651_10004523 | 3300025960 | Bacteria | 7024 |
| 418 | Ga0207651_10104713 | 3300025960 | Bacteria | 2109 |
| 419 | Ga0207651_10115232 | 3300025960 | Bacteria | 2026 |
| 420 | Ga0207651_10194128 | 3300025960 | Bacteria | 1622 |
| 421 | Ga0207712_10023687 | 3300025961 | Bacteria | 4055 |
| 422 | Ga0207712_10071700 | 3300025961 | Bacteria | 2492 |
| 423 | Ga0207668_10215518 | 3300025972 | Bacteria | 1538 |
| 424 | Ga0207668_10229392 | 3300025972 | Bacteria | 1496 |
| 425 | Ga0207640_10154406 | 3300025981 | Bacteria | 1690 |
| 426 | Ga0207658_10004719 | 3300025986 | Bacteria | 9439 |
| 427 | Ga0207658_10558772 | 3300025986 | Bacteria | 1025 |
| 428 | Ga0207677_10002009 | 3300026023 | Bacteria | 10724 |
| 429 | Ga0207677_10209541 | 3300026023 | Bacteria | 1555 |
| 430 | Ga0207703_10015016 | 3300026035 | Bacteria | 6044 |
| 431 | Ga0207703_10018805 | 3300026035 | Bacteria | 5395 |
| 432 | Ga0207703_10059338 | 3300026035 | Bacteria | 3125 |
| 433 | Ga0207639_10017559 | 3300026041 | Bacteria | 5074 |
| 434 | Ga0207639_10086446 | 3300026041 | Bacteria | 2497 |
| 435 | Ga0207639_10207533 | 3300026041 | Bacteria | 1684 |
| 436 | Ga0207678_10034309 | 3300026067 | Bacteria | 4420 |
| 437 | Ga0207678_10188691 | 3300026067 | Bacteria | 1761 |
| 438 | Ga0207708_10000102 | 3300026075 | Bacteria | 64743 |
| 439 | Ga0207708_10096364 | 3300026075 | Bacteria | 2286 |
| 440 | Ga0207708_10125108 | 3300026075 | Bacteria | 2006 |
| 441 | Ga0207641_10004003 | 3300026088 | Bacteria | 12856 |
| 442 | Ga0207641_10612769 | 3300026088 | Bacteria | 1067 |
| 443 | Ga0207648_10005941 | 3300026089 | Bacteria | 12211 |
| 444 | Ga0207648_10011696 | 3300026089 | Bacteria | 8258 |
| 445 | Ga0207648_10021357 | 3300026089 | Bacteria | 5819 |
| 446 | Ga0207648_10022820 | 3300026089 | Bacteria | 5615 |
| 447 | Ga0207648_10080674 | 3300026089 | Bacteria | 2838 |
| 448 | Ga0207648_10088187 | 3300026089 | Bacteria | 2709 |
| 449 | Ga0207648_10330737 | 3300026089 | Bacteria | 1371 |
| 450 | Ga0207676_10002262 | 3300026095 | Bacteria | 13826 |
| 451 | Ga0207676_10042018 | 3300026095 | Bacteria | 3514 |
| 452 | Ga0207676_10110268 | 3300026095 | Bacteria | 2301 |
| 453 | Ga0207674_10028836 | 3300026116 | Bacteria | 5851 |
| 454 | Ga0207674_10319435 | 3300026116 | Bacteria | 1502 |
| 455 | Ga0207675_100000527 | 3300026118 | Bacteria | 37150 |
| 456 | Ga0207675_100009000 | 3300026118 | Bacteria | 9369 |
| 457 | Ga0207675_100034360 | 3300026118 | Bacteria | 4727 |
| 458 | Ga0207675_100160642 | 3300026118 | Bacteria | 2143 |
| 459 | Ga0207683_10005679 | 3300026121 | Bacteria | 10698 |
| 460 | Ga0207683_10019835 | 3300026121 | Bacteria | 5743 |
| 461 | Ga0207683_10062016 | 3300026121 | Bacteria | 3292 |
| 462 | Ga0207683_10154795 | 3300026121 | Bacteria | 2070 |
| 463 | Ga0207698_10129657 | 3300026142 | Bacteria | 2152 |
| 464 | Ga0207428_10016574 | 3300027907 | Bacteria | 6334 |
| 465 | Ga0268266_10006738 | 3300028379 | Bacteria | 10476 |
| 466 | Ga0268266_10129117 | 3300028379 | Bacteria | 2259 |
| 467 | Ga0268266_10246227 | 3300028379 | Bacteria | 1652 |
| 468 | Ga0268265_10009147 | 3300028380 | Bacteria | 6694 |
| 469 | Ga0268264_10133224 | 3300028381 | Bacteria | 2206 |
| 470 | Ga0268264_10721634 | 3300028381 | Bacteria | 991 |
| 471 | Ga0307517_10072154 | 3300028786 | Bacteria | 3082 |
| 472 | Ga0307517_10161776 | 3300028786 | Bacteria | 1500 |
| 473 | Ga0307515_10000047 | 3300028794 | Bacteria | 291475 |
| 474 | Ga0307515_10003694 | 3300028794 | Bacteria | 32127 |
| 475 | Ga0307515_10029308 | 3300028794 | Bacteria | 9310 |
| 476 | Ga0307511_10000036 | 3300030521 | Bacteria | 103249 |
| 477 | Ga0265327_10000194 | 3300031251 | Bacteria | 129264 |
| 478 | Ga0307513_10000013 | 3300031456 | Bacteria | 325682 |
| 479 | Ga0307513_10000025 | 3300031456 | Bacteria | 202918 |
| 480 | Ga0307513_10000194 | 3300031456 | Bacteria | 87921 |
| 481 | Ga0307513_10000219 | 3300031456 | Bacteria | 82663 |
| 482 | Ga0307513_10020743 | 3300031456 | Bacteria | 7780 |
| 483 | Ga0307408_100004950 | 3300031548 | Bacteria | 8958 |
| 484 | Ga0307408_100203326 | 3300031548 | Bacteria | 1605 |
| 485 | Ga0307516_10004231 | 3300031730 | Bacteria | 17873 |
| 486 | Ga0307516_10005929 | 3300031730 | Bacteria | 14458 |
| 487 | Ga0307516_10021022 | 3300031730 | Bacteria | 6729 |
| 488 | Ga0307413_10180440 | 3300031824 | Bacteria | 1505 |
| 489 | Ga0307410_10352792 | 3300031852 | Bacteria | 1176 |
| 490 | Ga0307406_10036044 | 3300031901 | Bacteria | 3045 |
| 491 | Ga0307407_10060005 | 3300031903 | Unclassified | 2218 |
| 492 | Ga0307407_10164558 | 3300031903 | Bacteria | 1455 |
| 493 | Ga0307407_10312713 | 3300031903 | Bacteria | 1099 |
| 494 | Ga0307412_10041991 | 3300031911 | Bacteria | 2968 |
| 495 | Ga0307412_10073366 | 3300031911 | Bacteria | 2341 |
| 496 | Ga0307409_100011985 | 3300031995 | Bacteria | 5500 |
| 497 | Ga0307416_100002194 | 3300032002 | Bacteria | 11091 |
| 498 | Ga0307416_100151740 | 3300032002 | Bacteria | 2126 |
| 499 | Ga0307416_100159849 | 3300032002 | Bacteria | 2081 |
| 500 | Ga0307416_100531985 | 3300032002 | Bacteria | 1246 |
| 501 | Ga0307411_10055114 | 3300032005 | Bacteria | 2614 |
| 502 | Ga0307411_10056654 | 3300032005 | Bacteria | 2585 |
| 503 | Ga0307411_10206859 | 3300032005 | Unclassified | 1512 |
| 504 | Ga0307415_100000510 | 3300032126 | Bacteria | 16914 |
| 505 | Ga0307510_10000170 | 3300033180 | Bacteria | 55071 |
| 506 | Ga0373955_0083037 | 3300035172 | Bacteria | 1814 |
| 507 | Ga0373924_0020148 | 3300035410 | Bacteria | 2589 |
| 508 | Ga0373935_0070484 | 3300035692 | Bacteria | 2254 |
| 509 | Ga0373935_0319231 | 3300035692 | Bacteria | 1102 |
| 510 | Ga0373927_0004742 | 3300035695 | Bacteria | 9472 |
| 511 | Ga0373927_0051770 | 3300035695 | Bacteria | 2655 |
| 512 | Ga0373933_0128933 | 3300035724 | Bacteria | 1589 |
| 513 | Ga0373947_0011443 | 3300035725 | Bacteria | 5091 |
| 514 | Ga0373937_0018936 | 3300036401 | Bacteria | 6156 |
| 515 | Ga0373937_0051353 | 3300036401 | Bacteria | 3779 |
| 516 | Ga0373937_0055964 | 3300036401 | Bacteria | 3622 |
| 517 | Ga0373937_0056959 | 3300036401 | Bacteria | 3589 |
| 518 | Ga0373937_0288174 | 3300036401 | Bacteria | 1551 |
| 519 | Ga0373925_0044409 | 3300037068 | Bacteria | 3300 |
| 520 | Ga0373925_0063380 | 3300037068 | Bacteria | 2781 |
| 521 | Ga0373925_0411574 | 3300037068 | Bacteria | 1104 |
| 522 | Ga0373925_0411885 | 3300037068 | Bacteria | 1103 |
| 523 | Ga0395905_0006927 | 3300037471 | Bacteria | 11332 |
| 524 | Ga0439436_0000196 | 3300041404 | Bacteria | 14457 |
| 525 | Ga0439447_009378 | 3300041407 | Bacteria | 2973 |
| 526 | Ga0439466_0011953 | 3300041411 | Bacteria | 3206 |
| 527 | Ga0439465_0005369 | 3300041413 | Bacteria | 4087 |
| 528 | Ga0451789_0778680 | 3300041443 | Bacteria | 1579 |
| 529 | Ga0451789_1210807 | 3300041443 | Bacteria | 1692 |
| 530 | Ga0451793_0513185 | 3300041452 | Bacteria | 2152 |
| 531 | Ga0451841_0450575 | 3300041498 | Bacteria | 1121 |
| 532 | Ga0451849_0159593 | 3300041505 | Bacteria | 1109 |
| 533 | Ga0451853_1120642 | 3300041512 | Bacteria | 1663 |
| 534 | Ga0439431_0000556 | 3300041997 | Bacteria | 7908 |
| 535 | Ga0439431_0004971 | 3300041997 | Bacteria | 2929 |
| 536 | Ga0439433_0000436 | 3300041999 | Bacteria | 7637 |
| 537 | Ga0439445_0003662 | 3300042004 | Bacteria | 3449 |
| 538 | Ga0439449_0003792 | 3300042007 | Bacteria | 5848 |
| 539 | Ga0439452_001713 | 3300042010 | Bacteria | 8607 |
| 540 | Ga0439457_010793 | 3300042014 | Bacteria | 2091 |
| 541 | Ga0439462_0001401 | 3300042015 | Bacteria | 5347 |
| 542 | Ga0450913_003568 | 3300042117 | Bacteria | 1027 |
| 543 | Ga0439446_0000943 | 3300042156 | Bacteria | 6291 |
| 544 | Ga0450909_009631 | 3300042185 | Bacteria | 1410 |
| 545 | Ga0439434_0000158 | 3300042435 | Bacteria | 18217 |
| 546 | Ga0439464_0025929 | 3300042439 | Bacteria | 1624 |
| 547 | Ga0450893_0008775 | 3300042532 | Bacteria | 1648 |
| 548 | Ga0451577_0372202 | 3300042876 | Bacteria | 1296 |
| 549 | Ga0453684_0388244 | 3300044712 | Bacteria | 1566 |
| 550 | Ga0495592_0040309 | 3300046454 | Bacteria | 3505 |
| 551 | Ga0495651_0105380 | 3300046462 | Bacteria | 2091 |
| 552 | Ga0495651_0219162 | 3300046462 | Bacteria | 1318 |
| 553 | Ga0495580_0098977 | 3300046472 | Bacteria | 2028 |
| 554 | Ga0495580_0100854 | 3300046472 | Bacteria | 2008 |
| 555 | Ga0495608_0049661 | 3300046511 | Bacteria | 2785 |
| 556 | Ga0495610_0050304 | 3300046512 | Bacteria | 2035 |
| 557 | Ga0495628_0077170 | 3300046516 | Bacteria | 2592 |
| 558 | Ga0495632_0002042 | 3300046519 | Bacteria | 15864 |
| 559 | Ga0495632_0019438 | 3300046519 | Bacteria | 3700 |
| 560 | Ga0495643_0043118 | 3300046522 | Bacteria | 2456 |
| 561 | Ga0495643_0125441 | 3300046522 | Bacteria | 1293 |
| 562 | Ga0495663_0017353 | 3300046525 | Bacteria | 2042 |
| 563 | Ga0495598_0009039 | 3300046537 | Bacteria | 2341 |
| 564 | Ga0495621_0042757 | 3300046539 | Bacteria | 1596 |
| 565 | Ga0495621_0055657 | 3300046539 | Bacteria | 1424 |
| 566 | Ga0495645_0004594 | 3300046543 | Bacteria | 9426 |
| 567 | Ga0495656_0000171 | 3300046615 | Bacteria | 22920 |
| 568 | Ga0495625_0004789 | 3300046660 | Bacteria | 12656 |
| 569 | Ga0495635_0022394 | 3300046663 | Bacteria | 4400 |
| 570 | Ga0495657_0064897 | 3300046675 | Bacteria | 2403 |
| 571 | Ga0495599_0065634 | 3300046678 | Bacteria | 2267 |
| 572 | Ga0495623_0073606 | 3300046679 | Bacteria | 2123 |
| 573 | Ga0495623_0180609 | 3300046679 | Bacteria | 1226 |
| 574 | Ga0495658_0062591 | 3300046683 | Bacteria | 2139 |
| 575 | Ga0495600_0100982 | 3300046809 | Bacteria | 1881 |
| 576 | Ga0495604_0110884 | 3300047317 | Bacteria | 2001 |
| 577 | Ga0495684_0077260 | 3300047471 | Bacteria | 2528 |
| 578 | Ga0495686_0136519 | 3300047472 | Bacteria | 1450 |
| 579 | Ga0495615_0001305 | 3300048090 | Bacteria | 3656 |
| 580 | Ga0496104_0018269 | 3300048907 | Bacteria | 6397 |
| 581 | Ga0496108_0094281 | 3300048911 | Bacteria | 2548 |
| 582 | Ga0496109_0022068 | 3300048912 | Bacteria | 5636 |
| 583 | Ga0496109_0248162 | 3300048912 | Bacteria | 1676 |
| 584 | Ga0501034_0000456 | 3300049571 | Bacteria | 67493 |
| 585 | Ga0501034_0123878 | 3300049571 | Bacteria | 2570 |
| 586 | Ga0501036_0119596 | 3300049572 | Bacteria | 2225 |
| 587 | Ga0501036_0150633 | 3300049572 | Bacteria | 1962 |
| 588 | Ga0501039_0091118 | 3300049575 | Bacteria | 2376 |
| 589 | Ga0501041_0213571 | 3300049577 | Bacteria | 1210 |
| 590 | Ga0501042_0132338 | 3300049578 | Bacteria | 1798 |
| 591 | Ga0501046_0156235 | 3300049580 | Bacteria | 1718 |
| 592 | Ga0501068_0000960 | 3300049584 | Bacteria | 15139 |
| 593 | Ga0501072_0003561 | 3300049588 | Bacteria | 11719 |
| 594 | Ga0501073_0001375 | 3300049589 | Bacteria | 17975 |
| 595 | Ga0501076_0407618 | 3300049592 | Bacteria | 1118 |
| 596 | Ga0501229_009829 | 3300049706 | Bacteria | 1204 |
| 597 | Ga0501080_0001249 | 3300049742 | Bacteria | 21171 |
| 598 | Ga0501083_0086491 | 3300049744 | Bacteria | 2073 |
| 599 | Ga0501045_0117669 | 3300049824 | Bacteria | 1972 |
| 600 | Ga0501045_0169894 | 3300049824 | Bacteria | 1624 |
| 601 | nmdc:mga03683_42803_c1 | 3300050489 | Bacteria | 1865 |
| 602 | nmdc:mga00v17_7418_c1 | 3300050491 | Bacteria | 5852 |
| 603 | nmdc:mga0yw44_125488_c1 | 3300050492 | Bacteria | 1657 |
| 604 | nmdc:mga0yw44_138815_c1 | 3300050492 | Bacteria | 1578 |
| 605 | nmdc:mga0k408_2052_c1 | 3300050493 | Bacteria | 10769 |
| 606 | nmdc:mga0k408_39179_c1 | 3300050493 | Bacteria | 2722 |
| 607 | nmdc:mga06z11_90534_c1 | 3300050494 | Bacteria | 1660 |
| 608 | nmdc:mga07m45_10514_c1 | 3300050496 | Bacteria | 4836 |
| 609 | nmdc:mga07m45_194_c1 | 3300050496 | Bacteria | 24053 |
| 610 | nmdc:mga05p37_100678_c1 | 3300050507 | Bacteria | 3559 |
| 611 | nmdc:mga08y16_10820_c1 | 3300050511 | Bacteria | 9578 |
| 612 | nmdc:mga0rr50_17231_c1 | 3300050513 | Bacteria | 4817 |
| 613 | nmdc:mga0a205_109270_c1 | 3300050515 | Bacteria | 2664 |
| 614 | nmdc:mga0a205_237476_c1 | 3300050515 | Bacteria | 1704 |
| 615 | nmdc:mga0sz30_30369_c1 | 3300050516 | Bacteria | 2232 |
| 616 | Ga0495595_0094656 | 3300053084 | Bacteria | 1436 |
| 617 | Ga0500578_0001274 | 3300053086 | Bacteria | 26109 |
| 618 | Ga0500644_0000917 | 3300053088 | Bacteria | 9381 |
| 619 | Ga0500646_0000553 | 3300053090 | Bacteria | 10805 |
| 620 | Ga0500646_0000730 | 3300053090 | Bacteria | 9288 |
| 621 | Ga0500651_0020032 | 3300053093 | Bacteria | 4164 |
| 622 | Ga0500650_0052354 | 3300053098 | Bacteria | 1898 |
| 623 | Ga0500562_001476 | 3300053108 | Bacteria | 5804 |
| 624 | Ga0500562_040360 | 3300053108 | Bacteria | 1241 |
| 625 | Ga0500593_000120 | 3300053117 | Bacteria | 30583 |
| 626 | Ga0500593_001375 | 3300053117 | Bacteria | 8756 |
| 627 | Ga0500593_005564 | 3300053117 | Bacteria | 4980 |
| 628 | Ga0500593_007263 | 3300053117 | Bacteria | 4496 |
| 629 | Ga0500628_018632 | 3300053129 | Bacteria | 1371 |
| 630 | Ga0500642_0037765 | 3300053130 | Bacteria | 2066 |
| 631 | Ga0500642_0086052 | 3300053130 | Bacteria | 1449 |
| 632 | Ga0500559_0000085 | 3300053136 | Bacteria | 73850 |
| 633 | Ga0500568_0064768 | 3300053139 | Bacteria | 1408 |
| 634 | Ga0500568_0102237 | 3300053139 | Bacteria | 1074 |
| 635 | Ga0500604_0000621 | 3300053151 | Bacteria | 9733 |
| 636 | Ga0500604_0004198 | 3300053151 | Bacteria | 3833 |
| 637 | Ga0500604_0021270 | 3300053151 | Bacteria | 1833 |
| 638 | Ga0500616_0045635 | 3300053153 | Bacteria | 2334 |
| 639 | Ga0500622_0000164 | 3300053156 | Bacteria | 70630 |
| 640 | Ga0500622_0011754 | 3300053156 | Bacteria | 4758 |
| 641 | Ga0500627_0115930 | 3300053158 | Bacteria | 1207 |
| 642 | Ga0500637_0210637 | 3300053178 | Bacteria | 1103 |
| 643 | Ga0500645_000206 | 3300053730 | Bacteria | 45626 |
| 644 | Ga0500645_002283 | 3300053730 | Bacteria | 8703 |
| 645 | Ga0500645_007558 | 3300053730 | Bacteria | 3773 |
| 646 | Ga0500645_011405 | 3300053730 | Bacteria | 2903 |
| 647 | Ga0500645_032009 | 3300053730 | Bacteria | 1579 |
| 648 | Ga0500587_001612 | 3300053739 | Bacteria | 3210 |
| 649 | Ga0501084_0241081 | 3300054114 | Bacteria | 1526 |
| 650 | Ga0500661_012513 | 3300055283 | Bacteria | 1531 |
| 651 | Ga0501082_0044702 | 3300060353 | Bacteria | 3820 |
| 652 | Ga0530510_0330913 | 3300061734 | Bacteria | 1143 |
| 653 | Ga0530510_0371091 | 3300061734 | Bacteria | 1076 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003187 | JGI25151J46595_10014225 | JGI25151J46595_100142253 | 256 |
| 2 | 3300055283 | Ga0500661_012513 | Ga0500661_012513_702_1481 | 259 |
| 3 | 3300053108 | Ga0500562_001476 | Ga0500562_001476_1241_2140 | 262 |
| 4 | 3300005355 | Ga0070671_100338824 | Ga0070671_1003388242 | 270 |
| 5 | 3300005456 | Ga0070678_100126120 | Ga0070678_1001261202 | 270 |
| 6 | 3300009176 | Ga0105242_10108408 | Ga0105242_101084082 | 270 |
| 7 | 3300025893 | Ga0207682_10027171 | Ga0207682_100271712 | 270 |
| 8 | 3300025931 | Ga0207644_10070047 | Ga0207644_100700472 | 270 |
| 9 | 3300025940 | Ga0207691_10102507 | Ga0207691_101025072 | 270 |
| 10 | 3300026116 | Ga0207674_10319435 | Ga0207674_103194352 | 270 |
| 11 | 3300005344 | Ga0070661_100141193 | Ga0070661_1001411932 | 272 |
| 12 | 3300005334 | Ga0068869_100038558 | Ga0068869_1000385583 | 273 |
| 13 | 3300005354 | Ga0070675_100028908 | Ga0070675_1000289083 | 273 |
| 14 | 3300005456 | Ga0070678_100311266 | Ga0070678_1003112662 | 273 |
| 15 | 3300005543 | Ga0070672_100050232 | Ga0070672_1000502323 | 273 |
| 16 | 3300005577 | Ga0068857_100178986 | Ga0068857_1001789862 | 273 |
| 17 | 3300025901 | Ga0207688_10094510 | Ga0207688_100945102 | 273 |
| 18 | 3300025926 | Ga0207659_10048355 | Ga0207659_100483552 | 273 |
| 19 | 3300025940 | Ga0207691_10015746 | Ga0207691_100157465 | 273 |
| 20 | 3300025942 | Ga0207689_10015983 | Ga0207689_100159833 | 273 |
| 21 | 3300026075 | Ga0207708_10125108 | Ga0207708_101251082 | 273 |
| 22 | 3300026116 | Ga0207674_10028836 | Ga0207674_100288367 | 273 |
| 23 | 3300031903 | Ga0307407_10164558 | Ga0307407_101645582 | 273 |
| 24 | 3300031911 | Ga0307412_10041991 | Ga0307412_100419911 | 273 |
| 25 | 3300031995 | Ga0307409_100011985 | Ga0307409_1000119853 | 273 |
| 26 | 3300032002 | Ga0307416_100002194 | Ga0307416_1000021945 | 273 |
| 27 | 3300032005 | Ga0307411_10055114 | Ga0307411_100551142 | 273 |
| 28 | 3300032126 | Ga0307415_100000510 | Ga0307415_10000051013 | 273 |
| 29 | 3300025908 | Ga0207643_10028008 | Ga0207643_100280082 | 274 |
| 30 | 3300032002 | Ga0307416_100151740 | Ga0307416_1001517402 | 274 |
| 31 | 3300005365 | Ga0070688_100383276 | Ga0070688_1003832761 | 275 |
| 32 | 3300013104 | Ga0157370_10145615 | Ga0157370_101456152 | 275 |
| 33 | 3300013308 | Ga0157375_10337114 | Ga0157375_103371142 | 275 |
| 34 | 3300025941 | Ga0207711_10176107 | Ga0207711_101761072 | 275 |
| 35 | 3300006195 | Ga0075366_10104141 | Ga0075366_101041412 | 276 |
| 36 | 3300049572 | Ga0501036_0119596 | Ga0501036_0119596_371_1279 | 276 |
| 37 | 3300005330 | Ga0070690_100157446 | Ga0070690_1001574462 | 277 |
| 38 | 3300005334 | Ga0068869_100024865 | Ga0068869_1000248652 | 277 |
| 39 | 3300005340 | Ga0070689_100142447 | Ga0070689_1001424472 | 277 |
| 40 | 3300005456 | Ga0070678_100223377 | Ga0070678_1002233772 | 277 |
| 41 | 3300005547 | Ga0070693_100128489 | Ga0070693_1001284893 | 277 |
| 42 | 3300005616 | Ga0068852_100236236 | Ga0068852_1002362362 | 277 |
| 43 | 3300005834 | Ga0068851_10126681 | Ga0068851_101266812 | 277 |
| 44 | 3300006237 | Ga0097621_100021589 | Ga0097621_1000215895 | 277 |
| 45 | 3300014969 | Ga0157376_10013138 | Ga0157376_100131387 | 277 |
| 46 | 3300025936 | Ga0207670_10232786 | Ga0207670_102327862 | 277 |
| 47 | 3300026118 | Ga0207675_100160642 | Ga0207675_1001606422 | 277 |
| 48 | 3300053117 | Ga0500593_001375 | Ga0500593_001375_5362_6264 | 277 |
| 49 | 3300009147 | Ga0114129_10126379 | Ga0114129_101263793 | 278 |
| 50 | 3300028786 | Ga0307517_10072154 | Ga0307517_100721542 | 278 |
| 51 | 3300031730 | Ga0307516_10004231 | Ga0307516_100042317 | 278 |
| 52 | 3300046539 | Ga0495621_0055657 | Ga0495621_0055657_157_1077 | 278 |
| 53 | 3300049575 | Ga0501039_0091118 | Ga0501039_0091118_456_1352 | 278 |
| 54 | 3300049578 | Ga0501042_0132338 | Ga0501042_0132338_656_1552 | 278 |
| 55 | 3300049592 | Ga0501076_0407618 | Ga0501076_0407618_101_997 | 278 |
| 56 | 3300049824 | Ga0501045_0117669 | Ga0501045_0117669_130_1026 | 278 |
| 57 | 3300050507 | nmdc:mga05p37_100678_c1 | nmdc:mga05p37_100678_c1_1627_2544 | 278 |
| 58 | 3300005331 | Ga0070670_100080828 | Ga0070670_1000808282 | 279 |
| 59 | 3300005841 | Ga0068863_100189823 | Ga0068863_1001898232 | 279 |
| 60 | 3300009177 | Ga0105248_10205658 | Ga0105248_102056582 | 279 |
| 61 | 3300014969 | Ga0157376_10345028 | Ga0157376_103450281 | 279 |
| 62 | 3300025941 | Ga0207711_10094429 | Ga0207711_100944293 | 279 |
| 63 | 3300026089 | Ga0207648_10330737 | Ga0207648_103307372 | 279 |
| 64 | 3300005548 | Ga0070665_100005277 | Ga0070665_1000052777 | 280 |
| 65 | 3300006051 | Ga0075364_10009318 | Ga0075364_100093182 | 280 |
| 66 | 3300006195 | Ga0075366_10010048 | Ga0075366_100100483 | 280 |
| 67 | 3300025263 | Ga0209565_1001661 | Ga0209565_10016614 | 280 |
| 68 | 3300025291 | Ga0209675_1003943 | Ga0209675_10039433 | 280 |
| 69 | 3300025299 | Ga0209256_1030082 | Ga0209256_10300822 | 280 |
| 70 | 3300028379 | Ga0268266_10006738 | Ga0268266_100067386 | 280 |
| 71 | 3300031456 | Ga0307513_10000025 | Ga0307513_1000002542 | 280 |
| 72 | 3300031730 | Ga0307516_10021022 | Ga0307516_100210223 | 280 |
| 73 | 3300049706 | Ga0501229_009829 | Ga0501229_009829_205_1107 | 280 |
| 74 | 3300050493 | nmdc:mga0k408_2052_c1 | nmdc:mga0k408_2052_c1_1743_2666 | 280 |
| 75 | 3300050496 | nmdc:mga07m45_194_c1 | nmdc:mga07m45_194_c1_15793_16716 | 280 |
| 76 | 3300053158 | Ga0500627_0115930 | Ga0500627_0115930_157_1059 | 280 |
| 77 | 3300005435 | Ga0070714_100011248 | Ga0070714_1000112486 | 281 |
| 78 | 3300005436 | Ga0070713_100071478 | Ga0070713_1000714783 | 281 |
| 79 | 3300005456 | Ga0070678_100109843 | Ga0070678_1001098432 | 281 |
| 80 | 3300005548 | Ga0070665_100053168 | Ga0070665_1000531682 | 281 |
| 81 | 3300005841 | Ga0068863_100067070 | Ga0068863_1000670703 | 281 |
| 82 | 3300006028 | Ga0070717_10213025 | Ga0070717_102130252 | 281 |
| 83 | 3300009098 | Ga0105245_10067086 | Ga0105245_100670861 | 281 |
| 84 | 3300009177 | Ga0105248_10146496 | Ga0105248_101464962 | 281 |
| 85 | 3300025906 | Ga0207699_10110131 | Ga0207699_101101312 | 281 |
| 86 | 3300025929 | Ga0207664_10000197 | Ga0207664_1000019740 | 281 |
| 87 | 3300025931 | Ga0207644_10002035 | Ga0207644_100020358 | 281 |
| 88 | 3300025933 | Ga0207706_10039697 | Ga0207706_100396972 | 281 |
| 89 | 3300025940 | Ga0207691_10165763 | Ga0207691_101657631 | 281 |
| 90 | 3300025941 | Ga0207711_10075318 | Ga0207711_100753182 | 281 |
| 91 | 3300025981 | Ga0207640_10154406 | Ga0207640_101544061 | 281 |
| 92 | 3300026095 | Ga0207676_10042018 | Ga0207676_100420183 | 281 |
| 93 | 3300031251 | Ga0265327_10000194 | Ga0265327_1000019449 | 281 |
| 94 | 3300035692 | Ga0373935_0070484 | Ga0373935_0070484_53_964 | 281 |
| 95 | 3300035725 | Ga0373947_0011443 | Ga0373947_0011443_839_1750 | 281 |
| 96 | 3300037068 | Ga0373925_0063380 | Ga0373925_0063380_508_1419 | 281 |
| 97 | 3300042876 | Ga0451577_0372202 | Ga0451577_0372202_350_1255 | 281 |
| 98 | 3300046525 | Ga0495663_0017353 | Ga0495663_0017353_859_1764 | 281 |
| 99 | 3300046615 | Ga0495656_0000171 | Ga0495656_0000171_846_1751 | 281 |
| 100 | 3300048090 | Ga0495615_0001305 | Ga0495615_0001305_2490_3395 | 281 |
| 101 | 3300048912 | Ga0496109_0248162 | Ga0496109_0248162_30_950 | 281 |
| 102 | 3300005356 | Ga0070674_100332471 | Ga0070674_1003324712 | 282 |
| 103 | 3300009148 | Ga0105243_10210349 | Ga0105243_102103492 | 282 |
| 104 | 3300009148 | Ga0105243_10290724 | Ga0105243_102907242 | 282 |
| 105 | 3300009176 | Ga0105242_10001363 | Ga0105242_1000136316 | 282 |
| 106 | 3300014969 | Ga0157376_10132229 | Ga0157376_101322292 | 282 |
| 107 | 3300025291 | Ga0209675_1017807 | Ga0209675_10178072 | 282 |
| 108 | 3300025292 | Ga0209676_1003560 | Ga0209676_10035605 | 282 |
| 109 | 3300025295 | Ga0209564_1014320 | Ga0209564_10143202 | 282 |
| 110 | 3300025298 | Ga0209050_1027531 | Ga0209050_10275312 | 282 |
| 111 | 3300025304 | Ga0209257_1009089 | Ga0209257_10090895 | 282 |
| 112 | 3300025935 | Ga0207709_10192695 | Ga0207709_101926952 | 282 |
| 113 | 3300026075 | Ga0207708_10096364 | Ga0207708_100963642 | 282 |
| 114 | 3300037068 | Ga0373925_0411885 | Ga0373925_0411885_40_948 | 282 |
| 115 | 3300050493 | nmdc:mga0k408_39179_c1 | nmdc:mga0k408_39179_c1_787_1722 | 282 |
| 116 | 3300053117 | Ga0500593_000120 | Ga0500593_000120_14714_15616 | 282 |
| 117 | 3300053730 | Ga0500645_011405 | Ga0500645_011405_164_1066 | 282 |
| 118 | 3300002704 | JGI25155J39150_1000009 | JGI25155J39150_100000975 | 283 |
| 119 | 3300002705 | JGI25156J39149_1000009 | JGI25156J39149_1000009145 | 283 |
| 120 | 3300002738 | JGI25154J39366_1000024 | JGI25154J39366_1000024145 | 283 |
| 121 | 3300002741 | JGI25157J39369_1000007 | JGI25157J39369_1000007145 | 283 |
| 122 | 3300002774 | JGI25150J39212_1017171 | JGI25150J39212_10171712 | 283 |
| 123 | 3300003773 | Ga0055537_1000020 | Ga0055537_100002080 | 283 |
| 124 | 3300003775 | Ga0055524_1000047 | Ga0055524_1000047109 | 283 |
| 125 | 3300003784 | Ga0055534_1003852 | Ga0055534_10038523 | 283 |
| 126 | 3300003790 | Ga0055528_1000973 | Ga0055528_10009734 | 283 |
| 127 | 3300005340 | Ga0070689_100064767 | Ga0070689_1000647672 | 283 |
| 128 | 3300005353 | Ga0070669_100178964 | Ga0070669_1001789642 | 283 |
| 129 | 3300005356 | Ga0070674_100201383 | Ga0070674_1002013832 | 283 |
| 130 | 3300005365 | Ga0070688_100004402 | Ga0070688_1000044021 | 283 |
| 131 | 3300006946 | Ga0079104_1012746 | Ga0079104_10127462 | 283 |
| 132 | 3300012513 | Ga0157326_1001965 | Ga0157326_10019652 | 283 |
| 133 | 3300014745 | Ga0157377_10003600 | Ga0157377_100036002 | 283 |
| 134 | 3300017792 | Ga0163161_10190331 | Ga0163161_101903312 | 283 |
| 135 | 3300025206 | Ga0209435_100008 | Ga0209435_10000851 | 283 |
| 136 | 3300025245 | Ga0207425_1002658 | Ga0207425_10026586 | 283 |
| 137 | 3300025246 | Ga0209646_1000029 | Ga0209646_1000029227 | 283 |
| 138 | 3300025250 | Ga0209026_1000016 | Ga0209026_1000016227 | 283 |
| 139 | 3300025256 | Ga0209759_1000016 | Ga0209759_1000016227 | 283 |
| 140 | 3300025263 | Ga0209565_1000061 | Ga0209565_1000061146 | 283 |
| 141 | 3300025273 | Ga0209673_1000298 | Ga0209673_100029850 | 283 |
| 142 | 3300025291 | Ga0209675_1000105 | Ga0209675_1000105116 | 283 |
| 143 | 3300025294 | Ga0209025_1025924 | Ga0209025_10259241 | 283 |
| 144 | 3300025295 | Ga0209564_1000181 | Ga0209564_100018186 | 283 |
| 145 | 3300025295 | Ga0209564_1000247 | Ga0209564_100024744 | 283 |
| 146 | 3300025299 | Ga0209256_1000039 | Ga0209256_1000039209 | 283 |
| 147 | 3300025932 | Ga0207690_10215328 | Ga0207690_102153282 | 283 |
| 148 | 3300025945 | Ga0207679_10352316 | Ga0207679_103523162 | 283 |
| 149 | 3300025960 | Ga0207651_10104713 | Ga0207651_101047132 | 283 |
| 150 | 3300028379 | Ga0268266_10129117 | Ga0268266_101291172 | 283 |
| 151 | 3300037068 | Ga0373925_0044409 | Ga0373925_0044409_1851_2771 | 283 |
| 152 | 3300046663 | Ga0495635_0022394 | Ga0495635_0022394_3113_4033 | 283 |
| 153 | 3300046683 | Ga0495658_0062591 | Ga0495658_0062591_322_1242 | 283 |
| 154 | 3300046809 | Ga0495600_0100982 | Ga0495600_0100982_537_1457 | 283 |
| 155 | 3300048907 | Ga0496104_0018269 | Ga0496104_0018269_2067_2975 | 283 |
| 156 | 3300005330 | Ga0070690_100020078 | Ga0070690_1000200782 | 284 |
| 157 | 3300005334 | Ga0068869_100025542 | Ga0068869_1000255424 | 284 |
| 158 | 3300005335 | Ga0070666_10013495 | Ga0070666_100134953 | 284 |
| 159 | 3300005338 | Ga0068868_100001100 | Ga0068868_1000011002 | 284 |
| 160 | 3300005340 | Ga0070689_100094251 | Ga0070689_1000942512 | 284 |
| 161 | 3300005354 | Ga0070675_100000422 | Ga0070675_10000042211 | 284 |
| 162 | 3300005355 | Ga0070671_100022045 | Ga0070671_1000220454 | 284 |
| 163 | 3300005364 | Ga0070673_100033758 | Ga0070673_1000337583 | 284 |
| 164 | 3300005367 | Ga0070667_100030592 | Ga0070667_1000305922 | 284 |
| 165 | 3300005456 | Ga0070678_100010764 | Ga0070678_1000107643 | 284 |
| 166 | 3300005457 | Ga0070662_100463964 | Ga0070662_1004639642 | 284 |
| 167 | 3300005459 | Ga0068867_100400886 | Ga0068867_1004008861 | 284 |
| 168 | 3300005617 | Ga0068859_100014408 | Ga0068859_1000144082 | 284 |
| 169 | 3300005618 | Ga0068864_100001444 | Ga0068864_1000014443 | 284 |
| 170 | 3300005719 | Ga0068861_100219964 | Ga0068861_1002199641 | 284 |
| 171 | 3300005841 | Ga0068863_100031771 | Ga0068863_1000317713 | 284 |
| 172 | 3300005842 | Ga0068858_100000436 | Ga0068858_10000043635 | 284 |
| 173 | 3300005844 | Ga0068862_100036607 | Ga0068862_1000366072 | 284 |
| 174 | 3300006358 | Ga0068871_100065570 | Ga0068871_1000655702 | 284 |
| 175 | 3300006931 | Ga0097620_100014408 | Ga0097620_1000144082 | 284 |
| 176 | 3300009177 | Ga0105248_10060749 | Ga0105248_100607492 | 284 |
| 177 | 3300009177 | Ga0105248_10262630 | Ga0105248_102626302 | 284 |
| 178 | 3300013306 | Ga0163162_10017890 | Ga0163162_100178902 | 284 |
| 179 | 3300013308 | Ga0157375_10183914 | Ga0157375_101839142 | 284 |
| 180 | 3300014968 | Ga0157379_10007509 | Ga0157379_100075093 | 284 |
| 181 | 3300014968 | Ga0157379_10138739 | Ga0157379_101387392 | 284 |
| 182 | 3300014969 | Ga0157376_10024182 | Ga0157376_100241824 | 284 |
| 183 | 3300025893 | Ga0207682_10016949 | Ga0207682_100169491 | 284 |
| 184 | 3300025903 | Ga0207680_10068485 | Ga0207680_100684851 | 284 |
| 185 | 3300025923 | Ga0207681_10112675 | Ga0207681_101126752 | 284 |
| 186 | 3300025926 | Ga0207659_10000355 | Ga0207659_1000035520 | 284 |
| 187 | 3300025931 | Ga0207644_10010478 | Ga0207644_100104784 | 284 |
| 188 | 3300025933 | Ga0207706_10099167 | Ga0207706_100991672 | 284 |
| 189 | 3300025934 | Ga0207686_10008362 | Ga0207686_100083625 | 284 |
| 190 | 3300025938 | Ga0207704_10087355 | Ga0207704_100873552 | 284 |
| 191 | 3300025940 | Ga0207691_10060236 | Ga0207691_100602362 | 284 |
| 192 | 3300025941 | Ga0207711_10176970 | Ga0207711_101769702 | 284 |
| 193 | 3300025942 | Ga0207689_10016667 | Ga0207689_100166672 | 284 |
| 194 | 3300025960 | Ga0207651_10004523 | Ga0207651_100045232 | 284 |
| 195 | 3300025986 | Ga0207658_10004719 | Ga0207658_100047195 | 284 |
| 196 | 3300026023 | Ga0207677_10002009 | Ga0207677_100020098 | 284 |
| 197 | 3300026035 | Ga0207703_10018805 | Ga0207703_100188051 | 284 |
| 198 | 3300026088 | Ga0207641_10004003 | Ga0207641_100040032 | 284 |
| 199 | 3300026095 | Ga0207676_10002262 | Ga0207676_1000226212 | 284 |
| 200 | 3300026121 | Ga0207683_10005679 | Ga0207683_100056798 | 284 |
| 201 | 3300028381 | Ga0268264_10721634 | Ga0268264_107216341 | 284 |
| 202 | 3300046537 | Ga0495598_0009039 | Ga0495598_0009039_86_994 | 284 |
| 203 | 3300046539 | Ga0495621_0042757 | Ga0495621_0042757_370_1278 | 284 |
| 204 | 3300048912 | Ga0496109_0022068 | Ga0496109_0022068_2892_3800 | 284 |
| 205 | 3300002987 | JGI25159J45721_1003869 | JGI25159J45721_10038694 | 285 |
| 206 | 3300003354 | JGI25160J50197_1000240 | JGI25160J50197_100024036 | 285 |
| 207 | 3300003374 | JGI25161J50226_1000009 | JGI25161J50226_100000977 | 285 |
| 208 | 3300004625 | Ga0055543_1000199 | Ga0055543_100019936 | 285 |
| 209 | 3300005262 | Ga0065165_1010769 | Ga0065165_10107692 | 285 |
| 210 | 3300005262 | Ga0065165_1011728 | Ga0065165_10117282 | 285 |
| 211 | 3300005338 | Ga0068868_100247837 | Ga0068868_1002478372 | 285 |
| 212 | 3300005364 | Ga0070673_100293410 | Ga0070673_1002934102 | 285 |
| 213 | 3300005455 | Ga0070663_100243759 | Ga0070663_1002437592 | 285 |
| 214 | 3300006237 | Ga0097621_100070706 | Ga0097621_1000707063 | 285 |
| 215 | 3300025284 | Ga0209130_1000014 | Ga0209130_1000014149 | 285 |
| 216 | 3300025297 | Ga0209758_1044978 | Ga0209758_10449782 | 285 |
| 217 | 3300025298 | Ga0209050_1011391 | Ga0209050_10113912 | 285 |
| 218 | 3300025302 | Ga0207426_1000242 | Ga0207426_100024236 | 285 |
| 219 | 3300025893 | Ga0207682_10012243 | Ga0207682_100122433 | 285 |
| 220 | 3300025942 | Ga0207689_10005711 | Ga0207689_100057116 | 285 |
| 221 | 3300025960 | Ga0207651_10194128 | Ga0207651_101941282 | 285 |
| 222 | 3300028794 | Ga0307515_10029308 | Ga0307515_100293085 | 285 |
| 223 | 3300031456 | Ga0307513_10000219 | Ga0307513_1000021955 | 285 |
| 224 | 3300031548 | Ga0307408_100203326 | Ga0307408_1002033262 | 285 |
| 225 | 3300032002 | Ga0307416_100531985 | Ga0307416_1005319851 | 285 |
| 226 | 3300041498 | Ga0451841_0450575 | Ga0451841_0450575_12_875 | 285 |
| 227 | 3300042117 | Ga0450913_003568 | Ga0450913_003568_148_1011 | 285 |
| 228 | 3300049577 | Ga0501041_0213571 | Ga0501041_0213571_316_1185 | 285 |
| 229 | 3300050489 | nmdc:mga03683_42803_c1 | nmdc:mga03683_42803_c1_324_1181 | 285 |
| 230 | 3300053088 | Ga0500644_0000917 | Ga0500644_0000917_2289_3191 | 285 |
| 231 | 3300061734 | Ga0530510_0330913 | Ga0530510_0330913_96_1022 | 285 |
| 232 | 3300061734 | Ga0530510_0371091 | Ga0530510_0371091_178_1041 | 285 |
| 233 | 3300003792 | Ga0055540_1000027 | Ga0055540_100002735 | 286 |
| 234 | 3300003794 | Ga0055531_10001909 | Ga0055531_100019092 | 286 |
| 235 | 3300005331 | Ga0070670_100035710 | Ga0070670_1000357103 | 286 |
| 236 | 3300005333 | Ga0070677_10051187 | Ga0070677_100511871 | 286 |
| 237 | 3300005354 | Ga0070675_100044916 | Ga0070675_1000449163 | 286 |
| 238 | 3300005355 | Ga0070671_100071674 | Ga0070671_1000716742 | 286 |
| 239 | 3300005355 | Ga0070671_100525477 | Ga0070671_1005254771 | 286 |
| 240 | 3300005364 | Ga0070673_100074690 | Ga0070673_1000746902 | 286 |
| 241 | 3300005456 | Ga0070678_100233510 | Ga0070678_1002335102 | 286 |
| 242 | 3300005543 | Ga0070672_100124469 | Ga0070672_1001244692 | 286 |
| 243 | 3300005564 | Ga0070664_100249396 | Ga0070664_1002493962 | 286 |
| 244 | 3300005618 | Ga0068864_100021397 | Ga0068864_1000213975 | 286 |
| 245 | 3300005834 | Ga0068851_10034595 | Ga0068851_100345952 | 286 |
| 246 | 3300005841 | Ga0068863_100308542 | Ga0068863_1003085422 | 286 |
| 247 | 3300006178 | Ga0075367_10184647 | Ga0075367_101846472 | 286 |
| 248 | 3300006195 | Ga0075366_10021481 | Ga0075366_100214812 | 286 |
| 249 | 3300006195 | Ga0075366_10027699 | Ga0075366_100276993 | 286 |
| 250 | 3300006237 | Ga0097621_100027003 | Ga0097621_1000270033 | 286 |
| 251 | 3300006358 | Ga0068871_100250503 | Ga0068871_1002505032 | 286 |
| 252 | 3300013307 | Ga0157372_10531022 | Ga0157372_105310222 | 286 |
| 253 | 3300013308 | Ga0157375_10165231 | Ga0157375_101652312 | 286 |
| 254 | 3300014325 | Ga0163163_10238443 | Ga0163163_102384432 | 286 |
| 255 | 3300014326 | Ga0157380_10200827 | Ga0157380_102008272 | 286 |
| 256 | 3300014969 | Ga0157376_10037162 | Ga0157376_100371622 | 286 |
| 257 | 3300025284 | Ga0209130_1005309 | Ga0209130_10053094 | 286 |
| 258 | 3300025292 | Ga0209676_1000013 | Ga0209676_1000013610 | 286 |
| 259 | 3300025298 | Ga0209050_1000008 | Ga0209050_1000008610 | 286 |
| 260 | 3300025302 | Ga0207426_1000816 | Ga0207426_10008162 | 286 |
| 261 | 3300025303 | Ga0209051_1000005 | Ga0209051_1000005610 | 286 |
| 262 | 3300025304 | Ga0209257_1000031 | Ga0209257_1000031200 | 286 |
| 263 | 3300025899 | Ga0207642_10050531 | Ga0207642_100505312 | 286 |
| 264 | 3300025920 | Ga0207649_10363448 | Ga0207649_103634481 | 286 |
| 265 | 3300025925 | Ga0207650_10051820 | Ga0207650_100518202 | 286 |
| 266 | 3300025926 | Ga0207659_10234719 | Ga0207659_102347192 | 286 |
| 267 | 3300025931 | Ga0207644_10070163 | Ga0207644_100701633 | 286 |
| 268 | 3300025940 | Ga0207691_10025614 | Ga0207691_100256146 | 286 |
| 269 | 3300025945 | Ga0207679_10320159 | Ga0207679_103201592 | 286 |
| 270 | 3300025960 | Ga0207651_10115232 | Ga0207651_101152322 | 286 |
| 271 | 3300026023 | Ga0207677_10209541 | Ga0207677_102095412 | 286 |
| 272 | 3300026095 | Ga0207676_10110268 | Ga0207676_101102682 | 286 |
| 273 | 3300026121 | Ga0207683_10154795 | Ga0207683_101547952 | 286 |
| 274 | 3300026142 | Ga0207698_10129657 | Ga0207698_101296572 | 286 |
| 275 | 3300048911 | Ga0496108_0094281 | Ga0496108_0094281_522_1433 | 286 |
| 276 | 3300050492 | nmdc:mga0yw44_138815_c1 | nmdc:mga0yw44_138815_c1_690_1550 | 286 |
| 277 | 3300053129 | Ga0500628_018632 | Ga0500628_018632_173_1075 | 286 |
| 278 | 3300053151 | Ga0500604_0021270 | Ga0500604_0021270_123_1025 | 286 |
| 279 | 3300005333 | Ga0070677_10098565 | Ga0070677_100985651 | 287 |
| 280 | 3300005354 | Ga0070675_100022267 | Ga0070675_1000222673 | 287 |
| 281 | 3300005355 | Ga0070671_100417755 | Ga0070671_1004177551 | 287 |
| 282 | 3300005365 | Ga0070688_100137504 | Ga0070688_1001375042 | 287 |
| 283 | 3300005367 | Ga0070667_100519500 | Ga0070667_1005195001 | 287 |
| 284 | 3300005543 | Ga0070672_100290757 | Ga0070672_1002907571 | 287 |
| 285 | 3300005843 | Ga0068860_100656792 | Ga0068860_1006567921 | 287 |
| 286 | 3300013306 | Ga0163162_10554114 | Ga0163162_105541141 | 287 |
| 287 | 3300025925 | Ga0207650_10084484 | Ga0207650_100844842 | 287 |
| 288 | 3300025938 | Ga0207704_10158074 | Ga0207704_101580742 | 287 |
| 289 | 3300025940 | Ga0207691_10211255 | Ga0207691_102112552 | 287 |
| 290 | 3300028379 | Ga0268266_10246227 | Ga0268266_102462272 | 287 |
| 291 | 3300005331 | Ga0070670_100451391 | Ga0070670_1004513912 | 288 |
| 292 | 3300005347 | Ga0070668_100248896 | Ga0070668_1002488962 | 288 |
| 293 | 3300005355 | Ga0070671_100216592 | Ga0070671_1002165922 | 288 |
| 294 | 3300005459 | Ga0068867_100109642 | Ga0068867_1001096422 | 288 |
| 295 | 3300005548 | Ga0070665_100386108 | Ga0070665_1003861082 | 288 |
| 296 | 3300009148 | Ga0105243_10090013 | Ga0105243_100900132 | 288 |
| 297 | 3300009176 | Ga0105242_10424242 | Ga0105242_104242422 | 288 |
| 298 | 3300025893 | Ga0207682_10010395 | Ga0207682_100103953 | 288 |
| 299 | 3300025972 | Ga0207668_10229392 | Ga0207668_102293922 | 288 |
| 300 | 3300026067 | Ga0207678_10034309 | Ga0207678_100343094 | 288 |
| 301 | 3300026088 | Ga0207641_10612769 | Ga0207641_106127692 | 288 |
| 302 | 3300026089 | Ga0207648_10022820 | Ga0207648_100228205 | 288 |
| 303 | 3300031852 | Ga0307410_10352792 | Ga0307410_103527921 | 288 |
| 304 | 3300031903 | Ga0307407_10312713 | Ga0307407_103127131 | 288 |
| 305 | 3300031911 | Ga0307412_10073366 | Ga0307412_100733661 | 288 |
| 306 | 3300032005 | Ga0307411_10056654 | Ga0307411_100566542 | 288 |
| 307 | 3300036401 | Ga0373937_0051353 | Ga0373937_0051353_1286_2188 | 288 |
| 308 | 3300041404 | Ga0439436_0000196 | Ga0439436_0000196_4301_5239 | 288 |
| 309 | 3300041407 | Ga0439447_009378 | Ga0439447_009378_880_1818 | 288 |
| 310 | 3300041411 | Ga0439466_0011953 | Ga0439466_0011953_519_1457 | 288 |
| 311 | 3300041413 | Ga0439465_0005369 | Ga0439465_0005369_1863_2801 | 288 |
| 312 | 3300041997 | Ga0439431_0000556 | Ga0439431_0000556_2471_3409 | 288 |
| 313 | 3300041999 | Ga0439433_0000436 | Ga0439433_0000436_31_969 | 288 |
| 314 | 3300042004 | Ga0439445_0003662 | Ga0439445_0003662_2028_2966 | 288 |
| 315 | 3300042007 | Ga0439449_0003792 | Ga0439449_0003792_327_1265 | 288 |
| 316 | 3300042010 | Ga0439452_001713 | Ga0439452_001713_2969_3907 | 288 |
| 317 | 3300042014 | Ga0439457_010793 | Ga0439457_010793_182_1120 | 288 |
| 318 | 3300042015 | Ga0439462_0001401 | Ga0439462_0001401_2194_3132 | 288 |
| 319 | 3300042156 | Ga0439446_0000943 | Ga0439446_0000943_4501_5439 | 288 |
| 320 | 3300042185 | Ga0450909_009631 | Ga0450909_009631_445_1383 | 288 |
| 321 | 3300042435 | Ga0439434_0000158 | Ga0439434_0000158_2057_2995 | 288 |
| 322 | 3300046454 | Ga0495592_0040309 | Ga0495592_0040309_1765_2667 | 288 |
| 323 | 3300046462 | Ga0495651_0105380 | Ga0495651_0105380_140_1042 | 288 |
| 324 | 3300046511 | Ga0495608_0049661 | Ga0495608_0049661_1244_2146 | 288 |
| 325 | 3300046516 | Ga0495628_0077170 | Ga0495628_0077170_169_1071 | 288 |
| 326 | 3300046543 | Ga0495645_0004594 | Ga0495645_0004594_655_1557 | 288 |
| 327 | 3300046675 | Ga0495657_0064897 | Ga0495657_0064897_870_1772 | 288 |
| 328 | 3300046678 | Ga0495599_0065634 | Ga0495599_0065634_709_1611 | 288 |
| 329 | 3300046679 | Ga0495623_0073606 | Ga0495623_0073606_883_1785 | 288 |
| 330 | 3300047317 | Ga0495604_0110884 | Ga0495604_0110884_95_997 | 288 |
| 331 | 3300047471 | Ga0495684_0077260 | Ga0495684_0077260_323_1225 | 288 |
| 332 | 3300053084 | Ga0495595_0094656 | Ga0495595_0094656_416_1318 | 288 |
| 333 | 3300053093 | Ga0500651_0020032 | Ga0500651_0020032_43_960 | 288 |
| 334 | 3300053136 | Ga0500559_0000085 | Ga0500559_0000085_43439_44356 | 288 |
| 335 | 3300053139 | Ga0500568_0064768 | Ga0500568_0064768_197_1114 | 288 |
| 336 | 3300053156 | Ga0500622_0011754 | Ga0500622_0011754_3742_4659 | 288 |
| 337 | 3300002773 | JGI25152J39213_1003177 | JGI25152J39213_10031772 | 290 |
| 338 | 3300003215 | JGI25153J46596_10001286 | JGI25153J46596_100012862 | 290 |
| 339 | 3300003323 | rootH1_10066207 | rootH1_100662071 | 290 |
| 340 | 3300003771 | Ga0055526_1001550 | Ga0055526_100155011 | 290 |
| 341 | 3300005333 | Ga0070677_10052777 | Ga0070677_100527772 | 290 |
| 342 | 3300025245 | Ga0207425_1001920 | Ga0207425_100192010 | 290 |
| 343 | 3300025258 | Ga0209129_1000075 | Ga0209129_1000075109 | 290 |
| 344 | 3300025273 | Ga0209673_1003861 | Ga0209673_10038615 | 290 |
| 345 | 3300025295 | Ga0209564_1000046 | Ga0209564_1000046273 | 290 |
| 346 | 3300025297 | Ga0209758_1000052 | Ga0209758_1000052190 | 290 |
| 347 | 3300025299 | Ga0209256_1012968 | Ga0209256_10129682 | 290 |
| 348 | 3300025942 | Ga0207689_10249644 | Ga0207689_102496442 | 290 |
| 349 | 3300030521 | Ga0307511_10000036 | Ga0307511_1000003680 | 291 |
| 350 | 3300053730 | Ga0500645_007558 | Ga0500645_007558_1808_2710 | 291 |
| 351 | 3300053178 | Ga0500637_0210637 | Ga0500637_0210637_93_1022 | 292 |
| 352 | 3300005719 | Ga0068861_100649709 | Ga0068861_1006497091 | 293 |
| 353 | 3300025925 | Ga0207650_10191225 | Ga0207650_101912253 | 293 |
| 354 | 3300033180 | Ga0307510_10000170 | Ga0307510_100001706 | 293 |
| 355 | 3300041512 | Ga0451853_1120642 | Ga0451853_1120642_434_1333 | 293 |
| 356 | 3300044712 | Ga0453684_0388244 | Ga0453684_0388244_139_1032 | 293 |
| 357 | iso_pu_bacteria | 2511231002 | 2511246587 | 293 |
| 358 | iso_pu_bacteria | 2511231002 | 2511246662 | 293 |
| 359 | iso_pu_bacteria | 2585428062 | 2587757932 | 293 |
| 360 | 3300005436 | Ga0070713_100001288 | Ga0070713_1000012882 | 294 |
| 361 | 3300006175 | Ga0070712_100024404 | Ga0070712_1000244045 | 294 |
| 362 | 3300014326 | Ga0157380_10112856 | Ga0157380_101128562 | 294 |
| 363 | 3300025915 | Ga0207693_10056021 | Ga0207693_100560213 | 294 |
| 364 | 3300025928 | Ga0207700_10000605 | Ga0207700_1000060518 | 294 |
| 365 | 3300035724 | Ga0373933_0128933 | Ga0373933_0128933_179_1090 | 294 |
| 366 | 3300036401 | Ga0373937_0288174 | Ga0373937_0288174_552_1463 | 294 |
| 367 | 3300053090 | Ga0500646_0000730 | Ga0500646_0000730_3545_4489 | 294 |
| 368 | 3300053151 | Ga0500604_0000621 | Ga0500604_0000621_1290_2234 | 294 |
| 369 | iso_pu_bacteria | 2738543012 | 2739244075 | 294 |
| 370 | iso_pu_bacteria | 2816332133 | 2816472400 | 294 |
| 371 | iso_pu_bacteria | 2919704043 | 2919706699 | 294 |
| 372 | 3300003187 | JGI25151J46595_10017793 | JGI25151J46595_100177932 | 295 |
| 373 | 3300005330 | Ga0070690_100001392 | Ga0070690_1000013926 | 295 |
| 374 | 3300005334 | Ga0068869_100000631 | Ga0068869_10000063113 | 295 |
| 375 | 3300005334 | Ga0068869_100399917 | Ga0068869_1003999171 | 295 |
| 376 | 3300005336 | Ga0070680_100121813 | Ga0070680_1001218133 | 295 |
| 377 | 3300005340 | Ga0070689_100003108 | Ga0070689_1000031086 | 295 |
| 378 | 3300005347 | Ga0070668_100029973 | Ga0070668_1000299732 | 295 |
| 379 | 3300005353 | Ga0070669_100148065 | Ga0070669_1001480652 | 295 |
| 380 | 3300005354 | Ga0070675_100078392 | Ga0070675_1000783922 | 295 |
| 381 | 3300005364 | Ga0070673_100286302 | Ga0070673_1002863022 | 295 |
| 382 | 3300005365 | Ga0070688_100205502 | Ga0070688_1002055021 | 295 |
| 383 | 3300005366 | Ga0070659_100129605 | Ga0070659_1001296051 | 295 |
| 384 | 3300005438 | Ga0070701_10000512 | Ga0070701_1000051211 | 295 |
| 385 | 3300005441 | Ga0070700_100000680 | Ga0070700_10000068011 | 295 |
| 386 | 3300005455 | Ga0070663_100059886 | Ga0070663_1000598862 | 295 |
| 387 | 3300005456 | Ga0070678_100011176 | Ga0070678_1000111765 | 295 |
| 388 | 3300005456 | Ga0070678_100097297 | Ga0070678_1000972971 | 295 |
| 389 | 3300005458 | Ga0070681_10120812 | Ga0070681_101208121 | 295 |
| 390 | 3300005459 | Ga0068867_100002384 | Ga0068867_10000238411 | 295 |
| 391 | 3300005459 | Ga0068867_100016098 | Ga0068867_1000160983 | 295 |
| 392 | 3300005459 | Ga0068867_100053004 | Ga0068867_1000530042 | 295 |
| 393 | 3300005543 | Ga0070672_100007566 | Ga0070672_1000075663 | 295 |
| 394 | 3300005544 | Ga0070686_100000973 | Ga0070686_10000097313 | 295 |
| 395 | 3300005546 | Ga0070696_100023215 | Ga0070696_1000232152 | 295 |
| 396 | 3300005546 | Ga0070696_100038871 | Ga0070696_1000388713 | 295 |
| 397 | 3300005547 | Ga0070693_100005977 | Ga0070693_1000059773 | 295 |
| 398 | 3300005615 | Ga0070702_100001461 | Ga0070702_1000014614 | 295 |
| 399 | 3300005617 | Ga0068859_100004520 | Ga0068859_1000045203 | 295 |
| 400 | 3300005617 | Ga0068859_100139094 | Ga0068859_1001390942 | 295 |
| 401 | 3300005617 | Ga0068859_100242938 | Ga0068859_1002429382 | 295 |
| 402 | 3300005617 | Ga0068859_100278097 | Ga0068859_1002780973 | 295 |
| 403 | 3300005718 | Ga0068866_10000632 | Ga0068866_100006325 | 295 |
| 404 | 3300005718 | Ga0068866_10009776 | Ga0068866_100097763 | 295 |
| 405 | 3300005719 | Ga0068861_100001526 | Ga0068861_10000152611 | 295 |
| 406 | 3300005719 | Ga0068861_100004985 | Ga0068861_1000049853 | 295 |
| 407 | 3300005840 | Ga0068870_10010668 | Ga0068870_100106682 | 295 |
| 408 | 3300005842 | Ga0068858_100022445 | Ga0068858_1000224454 | 295 |
| 409 | 3300005842 | Ga0068858_100168829 | Ga0068858_1001688291 | 295 |
| 410 | 3300005842 | Ga0068858_100265785 | Ga0068858_1002657852 | 295 |
| 411 | 3300005842 | Ga0068858_100395282 | Ga0068858_1003952821 | 295 |
| 412 | 3300005843 | Ga0068860_100001387 | Ga0068860_1000013877 | 295 |
| 413 | 3300005843 | Ga0068860_100040991 | Ga0068860_1000409914 | 295 |
| 414 | 3300005843 | Ga0068860_100126878 | Ga0068860_1001268781 | 295 |
| 415 | 3300005844 | Ga0068862_100002384 | Ga0068862_1000023847 | 295 |
| 416 | 3300005844 | Ga0068862_100010800 | Ga0068862_1000108007 | 295 |
| 417 | 3300005844 | Ga0068862_100305111 | Ga0068862_1003051112 | 295 |
| 418 | 3300005985 | Ga0081539_10017821 | Ga0081539_100178212 | 295 |
| 419 | 3300006038 | Ga0075365_10168002 | Ga0075365_101680022 | 295 |
| 420 | 3300006048 | Ga0075363_100012169 | Ga0075363_1000121694 | 295 |
| 421 | 3300006195 | Ga0075366_10006732 | Ga0075366_100067325 | 295 |
| 422 | 3300006237 | Ga0097621_100002825 | Ga0097621_1000028257 | 295 |
| 423 | 3300006237 | Ga0097621_100005706 | Ga0097621_1000057068 | 295 |
| 424 | 3300006237 | Ga0097621_100389383 | Ga0097621_1003893831 | 295 |
| 425 | 3300006358 | Ga0068871_100005154 | Ga0068871_1000051545 | 295 |
| 426 | 3300006358 | Ga0068871_100018572 | Ga0068871_1000185722 | 295 |
| 427 | 3300006358 | Ga0068871_100161197 | Ga0068871_1001611972 | 295 |
| 428 | 3300006852 | Ga0075433_10102717 | Ga0075433_101027173 | 295 |
| 429 | 3300006881 | Ga0068865_100000305 | Ga0068865_1000003058 | 295 |
| 430 | 3300006881 | Ga0068865_100000371 | Ga0068865_1000003718 | 295 |
| 431 | 3300006931 | Ga0097620_100004520 | Ga0097620_10000452012 | 295 |
| 432 | 3300006931 | Ga0097620_100139088 | Ga0097620_1001390882 | 295 |
| 433 | 3300006931 | Ga0097620_100242932 | Ga0097620_1002429322 | 295 |
| 434 | 3300006931 | Ga0097620_100278110 | Ga0097620_1002781103 | 295 |
| 435 | 3300009098 | Ga0105245_10008300 | Ga0105245_100083006 | 295 |
| 436 | 3300009147 | Ga0114129_10689742 | Ga0114129_106897421 | 295 |
| 437 | 3300009148 | Ga0105243_10004538 | Ga0105243_100045383 | 295 |
| 438 | 3300009148 | Ga0105243_10013136 | Ga0105243_100131366 | 295 |
| 439 | 3300009174 | Ga0105241_10022246 | Ga0105241_100222464 | 295 |
| 440 | 3300009176 | Ga0105242_10030898 | Ga0105242_100308985 | 295 |
| 441 | 3300009176 | Ga0105242_10097193 | Ga0105242_100971932 | 295 |
| 442 | 3300009176 | Ga0105242_10358448 | Ga0105242_103584482 | 295 |
| 443 | 3300009177 | Ga0105248_10018384 | Ga0105248_100183845 | 295 |
| 444 | 3300009177 | Ga0105248_10124945 | Ga0105248_101249453 | 295 |
| 445 | 3300009551 | Ga0105238_10344814 | Ga0105238_103448142 | 295 |
| 446 | 3300009553 | Ga0105249_10009105 | Ga0105249_100091053 | 295 |
| 447 | 3300009553 | Ga0105249_10178096 | Ga0105249_101780962 | 295 |
| 448 | 3300009553 | Ga0105249_10199795 | Ga0105249_101997952 | 295 |
| 449 | 3300010375 | Ga0105239_10364228 | Ga0105239_103642282 | 295 |
| 450 | 3300013297 | Ga0157378_10001140 | Ga0157378_100011406 | 295 |
| 451 | 3300013297 | Ga0157378_10010272 | Ga0157378_100102722 | 295 |
| 452 | 3300013297 | Ga0157378_10177105 | Ga0157378_101771052 | 295 |
| 453 | 3300013297 | Ga0157378_10493944 | Ga0157378_104939441 | 295 |
| 454 | 3300013306 | Ga0163162_10000948 | Ga0163162_100009482 | 295 |
| 455 | 3300013306 | Ga0163162_10525979 | Ga0163162_105259791 | 295 |
| 456 | 3300013308 | Ga0157375_10061001 | Ga0157375_100610012 | 295 |
| 457 | 3300013308 | Ga0157375_10134345 | Ga0157375_101343452 | 295 |
| 458 | 3300013308 | Ga0157375_10365618 | Ga0157375_103656182 | 295 |
| 459 | 3300014325 | Ga0163163_10262681 | Ga0163163_102626813 | 295 |
| 460 | 3300014326 | Ga0157380_10000449 | Ga0157380_1000044913 | 295 |
| 461 | 3300014326 | Ga0157380_10034222 | Ga0157380_100342222 | 295 |
| 462 | 3300014326 | Ga0157380_10175681 | Ga0157380_101756812 | 295 |
| 463 | 3300014968 | Ga0157379_10020080 | Ga0157379_100200805 | 295 |
| 464 | 3300014968 | Ga0157379_10241174 | Ga0157379_102411742 | 295 |
| 465 | 3300014969 | Ga0157376_10074822 | Ga0157376_100748223 | 295 |
| 466 | 3300014969 | Ga0157376_10342347 | Ga0157376_103423472 | 295 |
| 467 | 3300014969 | Ga0157376_10496136 | Ga0157376_104961362 | 295 |
| 468 | 3300017792 | Ga0163161_10006676 | Ga0163161_100066764 | 295 |
| 469 | 3300025899 | Ga0207642_10006840 | Ga0207642_100068403 | 295 |
| 470 | 3300025908 | Ga0207643_10158274 | Ga0207643_101582741 | 295 |
| 471 | 3300025912 | Ga0207707_10307111 | Ga0207707_103071112 | 295 |
| 472 | 3300025926 | Ga0207659_10037234 | Ga0207659_100372342 | 295 |
| 473 | 3300025927 | Ga0207687_10000800 | Ga0207687_100008002 | 295 |
| 474 | 3300025934 | Ga0207686_10002242 | Ga0207686_100022429 | 295 |
| 475 | 3300025935 | Ga0207709_10005847 | Ga0207709_100058472 | 295 |
| 476 | 3300025936 | Ga0207670_10036809 | Ga0207670_100368092 | 295 |
| 477 | 3300025938 | Ga0207704_10001417 | Ga0207704_100014178 | 295 |
| 478 | 3300025938 | Ga0207704_10035604 | Ga0207704_100356042 | 295 |
| 479 | 3300025938 | Ga0207704_10141494 | Ga0207704_101414942 | 295 |
| 480 | 3300025940 | Ga0207691_10026141 | Ga0207691_100261412 | 295 |
| 481 | 3300025941 | Ga0207711_10020774 | Ga0207711_100207745 | 295 |
| 482 | 3300025941 | Ga0207711_10377460 | Ga0207711_103774602 | 295 |
| 483 | 3300025942 | Ga0207689_10000642 | Ga0207689_1000064219 | 295 |
| 484 | 3300025949 | Ga0207667_10115216 | Ga0207667_101152161 | 295 |
| 485 | 3300025961 | Ga0207712_10023687 | Ga0207712_100236872 | 295 |
| 486 | 3300025961 | Ga0207712_10071700 | Ga0207712_100717002 | 295 |
| 487 | 3300025972 | Ga0207668_10215518 | Ga0207668_102155182 | 295 |
| 488 | 3300025986 | Ga0207658_10558772 | Ga0207658_105587721 | 295 |
| 489 | 3300026035 | Ga0207703_10015016 | Ga0207703_100150164 | 295 |
| 490 | 3300026035 | Ga0207703_10059338 | Ga0207703_100593383 | 295 |
| 491 | 3300026041 | Ga0207639_10086446 | Ga0207639_100864462 | 295 |
| 492 | 3300026067 | Ga0207678_10188691 | Ga0207678_101886912 | 295 |
| 493 | 3300026075 | Ga0207708_10000102 | Ga0207708_1000010245 | 295 |
| 494 | 3300026089 | Ga0207648_10005941 | Ga0207648_100059417 | 295 |
| 495 | 3300026089 | Ga0207648_10011696 | Ga0207648_100116962 | 295 |
| 496 | 3300026089 | Ga0207648_10021357 | Ga0207648_100213573 | 295 |
| 497 | 3300026089 | Ga0207648_10080674 | Ga0207648_100806742 | 295 |
| 498 | 3300026089 | Ga0207648_10088187 | Ga0207648_100881872 | 295 |
| 499 | 3300026118 | Ga0207675_100000527 | Ga0207675_10000052720 | 295 |
| 500 | 3300026118 | Ga0207675_100009000 | Ga0207675_1000090003 | 295 |
| 501 | 3300026118 | Ga0207675_100034360 | Ga0207675_1000343602 | 295 |
| 502 | 3300026121 | Ga0207683_10019835 | Ga0207683_100198352 | 295 |
| 503 | 3300026121 | Ga0207683_10062016 | Ga0207683_100620165 | 295 |
| 504 | 3300027907 | Ga0207428_10016574 | Ga0207428_100165748 | 295 |
| 505 | 3300028380 | Ga0268265_10009147 | Ga0268265_100091472 | 295 |
| 506 | 3300028381 | Ga0268264_10133224 | Ga0268264_101332243 | 295 |
| 507 | 3300028786 | Ga0307517_10161776 | Ga0307517_101617761 | 295 |
| 508 | 3300028794 | Ga0307515_10003694 | Ga0307515_1000369433 | 295 |
| 509 | 3300031456 | Ga0307513_10020743 | Ga0307513_100207434 | 295 |
| 510 | 3300031730 | Ga0307516_10005929 | Ga0307516_100059296 | 295 |
| 511 | 3300031903 | Ga0307407_10060005 | Ga0307407_100600052 | 295 |
| 512 | 3300032005 | Ga0307411_10206859 | Ga0307411_102068591 | 295 |
| 513 | 3300035692 | Ga0373935_0319231 | Ga0373935_0319231_62_964 | 295 |
| 514 | 3300035695 | Ga0373927_0004742 | Ga0373927_0004742_1062_1970 | 295 |
| 515 | 3300035695 | Ga0373927_0051770 | Ga0373927_0051770_1010_1918 | 295 |
| 516 | 3300036401 | Ga0373937_0055964 | Ga0373937_0055964_1617_2525 | 295 |
| 517 | 3300037068 | Ga0373925_0411574 | Ga0373925_0411574_105_1019 | 295 |
| 518 | 3300041443 | Ga0451789_0778680 | Ga0451789_0778680_327_1226 | 295 |
| 519 | 3300041997 | Ga0439431_0004971 | Ga0439431_0004971_1273_2175 | 295 |
| 520 | 3300042532 | Ga0450893_0008775 | Ga0450893_0008775_139_1041 | 295 |
| 521 | 3300046472 | Ga0495580_0098977 | Ga0495580_0098977_1052_1960 | 295 |
| 522 | 3300046472 | Ga0495580_0100854 | Ga0495580_0100854_926_1834 | 295 |
| 523 | 3300046512 | Ga0495610_0050304 | Ga0495610_0050304_86_1000 | 295 |
| 524 | 3300046519 | Ga0495632_0019438 | Ga0495632_0019438_334_1248 | 295 |
| 525 | 3300046522 | Ga0495643_0043118 | Ga0495643_0043118_819_1763 | 295 |
| 526 | 3300046522 | Ga0495643_0125441 | Ga0495643_0125441_252_1151 | 295 |
| 527 | 3300046660 | Ga0495625_0004789 | Ga0495625_0004789_4667_5566 | 295 |
| 528 | 3300047472 | Ga0495686_0136519 | Ga0495686_0136519_133_1047 | 295 |
| 529 | 3300049571 | Ga0501034_0000456 | Ga0501034_0000456_63283_64191 | 295 |
| 530 | 3300049571 | Ga0501034_0123878 | Ga0501034_0123878_1011_1919 | 295 |
| 531 | 3300049584 | Ga0501068_0000960 | Ga0501068_0000960_4913_5821 | 295 |
| 532 | 3300049588 | Ga0501072_0003561 | Ga0501072_0003561_1855_2763 | 295 |
| 533 | 3300049589 | Ga0501073_0001375 | Ga0501073_0001375_7430_8338 | 295 |
| 534 | 3300049742 | Ga0501080_0001249 | Ga0501080_0001249_9356_10264 | 295 |
| 535 | 3300049744 | Ga0501083_0086491 | Ga0501083_0086491_415_1323 | 295 |
| 536 | 3300050491 | nmdc:mga00v17_7418_c1 | nmdc:mga00v17_7418_c1_1963_2865 | 295 |
| 537 | 3300050492 | nmdc:mga0yw44_125488_c1 | nmdc:mga0yw44_125488_c1_283_1185 | 295 |
| 538 | 3300050496 | nmdc:mga07m45_10514_c1 | nmdc:mga07m45_10514_c1_3445_4347 | 295 |
| 539 | 3300050511 | nmdc:mga08y16_10820_c1 | nmdc:mga08y16_10820_c1_8313_9215 | 295 |
| 540 | 3300050515 | nmdc:mga0a205_237476_c1 | nmdc:mga0a205_237476_c1_338_1240 | 295 |
| 541 | 3300050516 | nmdc:mga0sz30_30369_c1 | nmdc:mga0sz30_30369_c1_1163_2065 | 295 |
| 542 | 3300053090 | Ga0500646_0000553 | Ga0500646_0000553_7721_8623 | 295 |
| 543 | 3300053130 | Ga0500642_0086052 | Ga0500642_0086052_271_1173 | 295 |
| 544 | 3300053151 | Ga0500604_0004198 | Ga0500604_0004198_1489_2391 | 295 |
| 545 | 3300053730 | Ga0500645_032009 | Ga0500645_032009_503_1405 | 295 |
| 546 | 3300053739 | Ga0500587_001612 | Ga0500587_001612_575_1489 | 295 |
| 547 | 3300054114 | Ga0501084_0241081 | Ga0501084_0241081_223_1137 | 295 |
| 548 | 3300060353 | Ga0501082_0044702 | Ga0501082_0044702_1546_2454 | 295 |
| 549 | iso_pu_bacteria | 2738543013 | 2739252133 | 295 |
| 550 | 3300003215 | JGI25153J46596_10003485 | JGI25153J46596_100034853 | 296 |
| 551 | 3300003322 | rootL2_10212273 | rootL2_102122733 | 296 |
| 552 | 3300003784 | Ga0055534_1000901 | Ga0055534_100090110 | 296 |
| 553 | 3300005262 | Ga0065165_1000832 | Ga0065165_100083221 | 296 |
| 554 | 3300005356 | Ga0070674_100014175 | Ga0070674_1000141753 | 296 |
| 555 | 3300005467 | Ga0070706_100025761 | Ga0070706_1000257614 | 296 |
| 556 | 3300005549 | Ga0070704_100138497 | Ga0070704_1001384971 | 296 |
| 557 | 3300005578 | Ga0068854_100038140 | Ga0068854_1000381402 | 296 |
| 558 | 3300006051 | Ga0075364_10070091 | Ga0075364_100700912 | 296 |
| 559 | 3300006178 | Ga0075367_10023806 | Ga0075367_100238063 | 296 |
| 560 | 3300006195 | Ga0075366_10025415 | Ga0075366_100254152 | 296 |
| 561 | 3300006353 | Ga0075370_10035330 | Ga0075370_100353303 | 296 |
| 562 | 3300006852 | Ga0075433_10056208 | Ga0075433_100562083 | 296 |
| 563 | 3300006871 | Ga0075434_100041160 | Ga0075434_1000411606 | 296 |
| 564 | 3300006881 | Ga0068865_100207539 | Ga0068865_1002075391 | 296 |
| 565 | 3300006914 | Ga0075436_100023634 | Ga0075436_1000236344 | 296 |
| 566 | 3300007076 | Ga0075435_100140160 | Ga0075435_1001401602 | 296 |
| 567 | 3300009147 | Ga0114129_10178343 | Ga0114129_101783432 | 296 |
| 568 | 3300009147 | Ga0114129_10686451 | Ga0114129_106864512 | 296 |
| 569 | 3300009553 | Ga0105249_10045362 | Ga0105249_100453622 | 296 |
| 570 | 3300013296 | Ga0157374_10211848 | Ga0157374_102118482 | 296 |
| 571 | 3300025245 | Ga0207425_1016265 | Ga0207425_10162652 | 296 |
| 572 | 3300025273 | Ga0209673_1011939 | Ga0209673_10119392 | 296 |
| 573 | 3300025284 | Ga0209130_1004197 | Ga0209130_10041972 | 296 |
| 574 | 3300025291 | Ga0209675_1001283 | Ga0209675_100128310 | 296 |
| 575 | 3300025291 | Ga0209675_1002955 | Ga0209675_10029558 | 296 |
| 576 | 3300025292 | Ga0209676_1020092 | Ga0209676_10200922 | 296 |
| 577 | 3300025294 | Ga0209025_1013495 | Ga0209025_10134953 | 296 |
| 578 | 3300025297 | Ga0209758_1000045 | Ga0209758_1000045274 | 296 |
| 579 | 3300025297 | Ga0209758_1014508 | Ga0209758_10145084 | 296 |
| 580 | 3300025298 | Ga0209050_1000257 | Ga0209050_100025786 | 296 |
| 581 | 3300025303 | Ga0209051_1009002 | Ga0209051_10090022 | 296 |
| 582 | 3300025303 | Ga0209051_1026527 | Ga0209051_10265272 | 296 |
| 583 | 3300025910 | Ga0207684_10014503 | Ga0207684_100145035 | 296 |
| 584 | 3300025915 | Ga0207693_10283297 | Ga0207693_102832971 | 296 |
| 585 | 3300025922 | Ga0207646_10025948 | Ga0207646_100259482 | 296 |
| 586 | 3300025937 | Ga0207669_10262938 | Ga0207669_102629382 | 296 |
| 587 | 3300026041 | Ga0207639_10017559 | Ga0207639_100175593 | 296 |
| 588 | 3300028794 | Ga0307515_10000047 | Ga0307515_10000047255 | 296 |
| 589 | 3300031824 | Ga0307413_10180440 | Ga0307413_101804401 | 296 |
| 590 | 3300032002 | Ga0307416_100159849 | Ga0307416_1001598492 | 296 |
| 591 | 3300035172 | Ga0373955_0083037 | Ga0373955_0083037_468_1379 | 296 |
| 592 | 3300035410 | Ga0373924_0020148 | Ga0373924_0020148_1552_2460 | 296 |
| 593 | 3300036401 | Ga0373937_0018936 | Ga0373937_0018936_790_1692 | 296 |
| 594 | 3300036401 | Ga0373937_0056959 | Ga0373937_0056959_1806_2717 | 296 |
| 595 | 3300037471 | Ga0395905_0006927 | Ga0395905_0006927_8651_9559 | 296 |
| 596 | 3300041443 | Ga0451789_1210807 | Ga0451789_1210807_482_1393 | 296 |
| 597 | 3300041452 | Ga0451793_0513185 | Ga0451793_0513185_807_1718 | 296 |
| 598 | 3300041505 | Ga0451849_0159593 | Ga0451849_0159593_81_983 | 296 |
| 599 | 3300042439 | Ga0439464_0025929 | Ga0439464_0025929_50_958 | 296 |
| 600 | 3300046462 | Ga0495651_0219162 | Ga0495651_0219162_306_1217 | 296 |
| 601 | 3300046519 | Ga0495632_0002042 | Ga0495632_0002042_9686_10597 | 296 |
| 602 | 3300046679 | Ga0495623_0180609 | Ga0495623_0180609_101_1012 | 296 |
| 603 | 3300049572 | Ga0501036_0150633 | Ga0501036_0150633_638_1546 | 296 |
| 604 | 3300049580 | Ga0501046_0156235 | Ga0501046_0156235_157_1065 | 296 |
| 605 | 3300049824 | Ga0501045_0169894 | Ga0501045_0169894_559_1467 | 296 |
| 606 | 3300050494 | nmdc:mga06z11_90534_c1 | nmdc:mga06z11_90534_c1_441_1349 | 296 |
| 607 | 3300050513 | nmdc:mga0rr50_17231_c1 | nmdc:mga0rr50_17231_c1_3669_4580 | 296 |
| 608 | 3300050515 | nmdc:mga0a205_109270_c1 | nmdc:mga0a205_109270_c1_135_1046 | 296 |
| 609 | 3300053086 | Ga0500578_0001274 | Ga0500578_0001274_6476_7447 | 296 |
| 610 | 3300053098 | Ga0500650_0052354 | Ga0500650_0052354_335_1246 | 296 |
| 611 | 3300053108 | Ga0500562_040360 | Ga0500562_040360_241_1152 | 296 |
| 612 | 3300053117 | Ga0500593_005564 | Ga0500593_005564_2232_3140 | 296 |
| 613 | 3300053130 | Ga0500642_0037765 | Ga0500642_0037765_300_1211 | 296 |
| 614 | 3300053139 | Ga0500568_0102237 | Ga0500568_0102237_30_941 | 296 |
| 615 | 3300053153 | Ga0500616_0045635 | Ga0500616_0045635_1307_2263 | 296 |
| 616 | 3300053156 | Ga0500622_0000164 | Ga0500622_0000164_66414_67325 | 296 |
| 617 | iso_pu_bacteria | 2585428057 | 2587730005 | 296 |
| 618 | iso_pu_bacteria | 2585428058 | 2587734879 | 296 |
| 619 | iso_pu_bacteria | 2588253510 | 2588293170 | 296 |
| 620 | iso_pu_bacteria | 2643221592 | 2643968400 | 296 |
| 621 | iso_pu_bacteria | 2643221625 | 2644141808 | 296 |
| 622 | iso_pu_bacteria | 2643221648 | 2644272522 | 296 |
| 623 | 3300002704 | JGI25155J39150_1000009 | JGI25155J39150_1000009151 | 297 |
| 624 | 3300002705 | JGI25156J39149_1000009 | JGI25156J39149_100000969 | 297 |
| 625 | 3300002738 | JGI25154J39366_1000024 | JGI25154J39366_100002469 | 297 |
| 626 | 3300002741 | JGI25157J39369_1000007 | JGI25157J39369_100000769 | 297 |
| 627 | 3300002987 | JGI25159J45721_1000402 | JGI25159J45721_10004027 | 297 |
| 628 | 3300002987 | JGI25159J45721_1000474 | JGI25159J45721_10004744 | 297 |
| 629 | 3300003187 | JGI25151J46595_10002845 | JGI25151J46595_100028457 | 297 |
| 630 | 3300003354 | JGI25160J50197_1000117 | JGI25160J50197_100011749 | 297 |
| 631 | 3300003374 | JGI25161J50226_1000009 | JGI25161J50226_1000009160 | 297 |
| 632 | 3300003771 | Ga0055526_1003249 | Ga0055526_10032498 | 297 |
| 633 | 3300003771 | Ga0055526_1007405 | Ga0055526_10074055 | 297 |
| 634 | 3300003775 | Ga0055524_1000047 | Ga0055524_100004730 | 297 |
| 635 | 3300003775 | Ga0055524_1000143 | Ga0055524_100014325 | 297 |
| 636 | 3300003784 | Ga0055534_1000967 | Ga0055534_100096719 | 297 |
| 637 | 3300003790 | Ga0055528_1000812 | Ga0055528_100081226 | 297 |
| 638 | 3300003791 | Ga0055530_10000252 | Ga0055530_1000025230 | 297 |
| 639 | 3300003792 | Ga0055540_1000027 | Ga0055540_1000027114 | 297 |
| 640 | 3300003794 | Ga0055531_10008317 | Ga0055531_100083173 | 297 |
| 641 | 3300004625 | Ga0055543_1001706 | Ga0055543_10017062 | 297 |
| 642 | 3300005262 | Ga0065165_1021619 | Ga0065165_10216192 | 297 |
| 643 | 3300005539 | Ga0068853_100067941 | Ga0068853_1000679412 | 297 |
| 644 | 3300006038 | Ga0075365_10260821 | Ga0075365_102608212 | 297 |
| 645 | 3300006353 | Ga0075370_10120486 | Ga0075370_101204861 | 297 |
| 646 | 3300012513 | Ga0157326_1001281 | Ga0157326_10012812 | 297 |
| 647 | 3300025206 | Ga0209435_100051 | Ga0209435_10005127 | 297 |
| 648 | 3300025208 | Ga0209436_109092 | Ga0209436_1090922 | 297 |
| 649 | 3300025246 | Ga0209646_1000029 | Ga0209646_1000029303 | 297 |
| 650 | 3300025250 | Ga0209026_1000016 | Ga0209026_1000016303 | 297 |
| 651 | 3300025256 | Ga0209759_1000016 | Ga0209759_1000016303 | 297 |
| 652 | 3300025263 | Ga0209565_1000122 | Ga0209565_100012243 | 297 |
| 653 | 3300025263 | Ga0209565_1000551 | Ga0209565_100055125 | 297 |
| 654 | 3300025273 | Ga0209673_1000302 | Ga0209673_100030229 | 297 |
| 655 | 3300025284 | Ga0209130_1000014 | Ga0209130_100001468 | 297 |
| 656 | 3300025284 | Ga0209130_1001940 | Ga0209130_100194011 | 297 |
| 657 | 3300025291 | Ga0209675_1000098 | Ga0209675_100009870 | 297 |
| 658 | 3300025292 | Ga0209676_1000013 | Ga0209676_1000013687 | 297 |
| 659 | 3300025292 | Ga0209676_1006368 | Ga0209676_10063682 | 297 |
| 660 | 3300025294 | Ga0209025_1009911 | Ga0209025_10099114 | 297 |
| 661 | 3300025294 | Ga0209025_1010306 | Ga0209025_10103064 | 297 |
| 662 | 3300025294 | Ga0209025_1015171 | Ga0209025_10151713 | 297 |
| 663 | 3300025294 | Ga0209025_1051898 | Ga0209025_10518982 | 297 |
| 664 | 3300025295 | Ga0209564_1000181 | Ga0209564_10001818 | 297 |
| 665 | 3300025295 | Ga0209564_1003446 | Ga0209564_10034468 | 297 |
| 666 | 3300025295 | Ga0209564_1007257 | Ga0209564_10072573 | 297 |
| 667 | 3300025297 | Ga0209758_1019783 | Ga0209758_10197832 | 297 |
| 668 | 3300025298 | Ga0209050_1000008 | Ga0209050_1000008687 | 297 |
| 669 | 3300025298 | Ga0209050_1006029 | Ga0209050_10060296 | 297 |
| 670 | 3300025298 | Ga0209050_1022835 | Ga0209050_10228352 | 297 |
| 671 | 3300025299 | Ga0209256_1000039 | Ga0209256_1000039286 | 297 |
| 672 | 3300025302 | Ga0207426_1000224 | Ga0207426_100022468 | 297 |
| 673 | 3300025303 | Ga0209051_1000005 | Ga0209051_1000005687 | 297 |
| 674 | 3300025304 | Ga0209257_1000031 | Ga0209257_1000031277 | 297 |
| 675 | 3300025304 | Ga0209257_1011422 | Ga0209257_10114226 | 297 |
| 676 | 3300026041 | Ga0207639_10207533 | Ga0207639_102075332 | 297 |
| 677 | 3300031456 | Ga0307513_10000013 | Ga0307513_10000013102 | 297 |
| 678 | 3300031456 | Ga0307513_10000194 | Ga0307513_1000019441 | 297 |
| 679 | 3300031548 | Ga0307408_100004950 | Ga0307408_1000049507 | 297 |
| 680 | 3300031901 | Ga0307406_10036044 | Ga0307406_100360445 | 297 |
| 681 | 3300053117 | Ga0500593_007263 | Ga0500593_007263_1934_2827 | 297 |
| 682 | 3300053730 | Ga0500645_000206 | Ga0500645_000206_32175_33068 | 297 |
| 683 | 3300053730 | Ga0500645_002283 | Ga0500645_002283_3898_4791 | 297 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF14833
NAD_binding_11
NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase
191
311
0.93
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3cky-assembly1.cif.gz_A | structural and kinetic properties of a beta-hydroxyacid dehydrogenase involved in nicotinate fermentation | 0.9325 | 1 | 297 |
| 2uyy-assembly1.cif.gz_D | structure of the cytokine-like nuclear factor n-pac | 0.9169 | 2 | 285 |
| 3cky-assembly2.cif.gz_D | structural and kinetic properties of a beta-hydroxyacid dehydrogenase involved in nicotinate fermentation | 0.9156 | 50 | 297 |
| 3pdu-assembly1.cif.gz_D | crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with nadp+ | 0.9148 | 1 | 286 |
| 3pef-assembly1.cif.gz_D | crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with nadp+ | 0.913 | 1 | 287 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_F1QE62_28_195_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9613 | 2 | 164 | 3.40.50.720 |
| af_Q9C991_11_173_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9529 | 2 | 159 | 3.40.50.720 |
| af_Q9XTI0_3_164_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9471 | 4 | 164 | 3.40.50.720 |
| 5je8D01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9467 | 1 | 163 | 3.40.50.720 |
| 3ckyB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9466 | 1 | 163 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4U6MEY8-F1-model_v4 | Sulfolactaldehyde 3-reductase | 0.9915 | 94 | 165 |
GO:0016616
GO:0050661 |
| AF-A0A7U3E5M3-F1-model_v4 | deleted | 0.9769 | 2 | 297 |
|
| AF-A0A352S2Q2-F1-model_v4 | 2-hydroxy-3-oxopropionate reductase | 0.9745 | 72 | 159 |
GO:0050661
|
| AF-A0A7X6ISJ6-F1-model_v4 | deleted | 0.9744 | 58 | 175 |
|
| AF-A0A435TWV6-F1-model_v4 | deleted | 0.9732 | 50 | 297 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar