F474967

General Info

Members Datasets Scaffolds Average Seq Length
683 276 1366 448

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100014359|Ga0075434_1000143598
Length 462
Sequence METVMFLTKRHIPRRTFLRGAGVTLALPLLESMLPAFTPTRLTAAAPVRRFVGIWHPHGASPGYWSPLQAGKDFEFSFITKPLETFRNRVVLISGLDMPEAMATNEEPGGDHARGAVLLSGARPRRNAVSPYLGTTIDQMIAAKYGQDTILSSLQLGVEDMGNFGNCNWGYSCAYTNSISWGSATEPLPTQVNPRVVFERLFGDGTSPEERLRDRKRNASILDAVVGQLGPFKSNLGAGDKARIDTYVDNIRELERRIKIAMEHSIKEPASEDVPFGLPENKHLHFRLMYDLMALAFEGDITRSITFMLGRDLSGASFPESGFTGGWHGTSHHGDKPENIANYAKVNRYHVQNLAYFVDKLSKIPDGDGTVLDHVLIYKGSNMGNSHRHAHEKVPVILVGGIDGTFKGNRHLVFPDNTQRTSNMLVSLLHLYGIDQWATPDGKAMTDKLGTSTGRLQPLEMV

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
108 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
173 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
177 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
182 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
183 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
184 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
185 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
186 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
187 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
188 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
189 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
191 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
192 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
193 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
194 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
195 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
196 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
197 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
208 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
209 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
210 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
213 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
214 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
215 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
216 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
217 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
218 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
219 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
220 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
221 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
222 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
223 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
224 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
225 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
226 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
227 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
228 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
229 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
230 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
231 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
232 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
233 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
234 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
235 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
254 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
255 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
256 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
257 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
258 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
259 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
262 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
263 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
272 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
273 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
276 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.63
Metatranscriptomes 3.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 1.32
Rhizosphere 97.66
Stem 0
Stem Tuber 0
Unclassified 9.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100014359 3300006871 Bacteria 7570
2 JGI24746J21847_1001922 3300001977 Bacteria 3313
3 JGI25406J46586_10004947 3300003203 Bacteria 6189
4 JGI25406J46586_10007213 3300003203 Bacteria 5086
5 Ga0058863_10005104 3300004799 Bacteria 2208
6 Ga0058863_11659439 3300004799 Unclassified 3411
7 Ga0058863_11963286 3300004799 Bacteria 5174
8 Ga0058861_10008326 3300004800 Bacteria 2671
9 Ga0058861_11859261 3300004800 Unclassified 2987
10 Ga0058861_12043805 3300004800 Unclassified 3836
11 Ga0058860_10028757 3300004801 Bacteria 2307
12 Ga0058862_10144628 3300004803 Bacteria 1770
13 Ga0058862_10162591 3300004803 Unclassified 2739
14 Ga0058862_12772827 3300004803 Bacteria 6253
15 Ga0058862_12819301 3300004803 Bacteria 1899
16 Ga0065712_10073962 3300005290 Bacteria 4219
17 Ga0065712_10074085 3300005290 Bacteria 4190
18 Ga0065707_10107490 3300005295 Bacteria 2552
19 Ga0070676_10002464 3300005328 Bacteria 9476
20 Ga0070676_10100680 3300005328 Bacteria 1784
21 Ga0070683_100003267 3300005329 Bacteria 13106
22 Ga0070683_100081639 3300005329 Bacteria 3027
23 Ga0070690_100009087 3300005330 Bacteria 5749
24 Ga0070690_100027560 3300005330 Bacteria 3513
25 Ga0070670_100001248 3300005331 Bacteria 20248
26 Ga0070670_100004490 3300005331 Bacteria 11690
27 Ga0070670_100004593 3300005331 Bacteria 11591
28 Ga0070670_100056297 3300005331 Bacteria 3375
29 Ga0068869_100013828 3300005334 Bacteria 5379
30 Ga0068869_100025087 3300005334 Bacteria 4136
31 Ga0070666_10000509 3300005335 Bacteria 23456
32 Ga0070666_10004052 3300005335 Bacteria 8894
33 Ga0070666_10050666 3300005335 Bacteria 2793
34 Ga0070680_100025858 3300005336 Bacteria 4694
35 Ga0068868_100004131 3300005338 Bacteria 10147
36 Ga0068868_100018183 3300005338 Bacteria 5250
37 Ga0068868_100026985 3300005338 Unclassified 4379
38 Ga0070689_100012196 3300005340 Bacteria 6182
39 Ga0070689_100014543 3300005340 Bacteria 5719
40 Ga0070689_100022276 3300005340 Bacteria 4730
41 Ga0070689_100054270 3300005340 Bacteria 3102
42 Ga0070689_100118247 3300005340 Bacteria 2115
43 Ga0070691_10000499 3300005341 Bacteria 14752
44 Ga0070661_100080391 3300005344 Bacteria 2406
45 Ga0070661_100124759 3300005344 Bacteria 1931
46 Ga0070669_100003267 3300005353 Bacteria 11652
47 Ga0070669_100036321 3300005353 Bacteria 3570
48 Ga0070675_100000668 3300005354 Bacteria 23745
49 Ga0070675_100001599 3300005354 Bacteria 16703
50 Ga0070675_100004298 3300005354 Bacteria 10854
51 Ga0070675_100005310 3300005354 Bacteria 9843
52 Ga0070675_100013818 3300005354 Bacteria 6356
53 Ga0070675_100019490 3300005354 Bacteria 5408
54 Ga0070675_100031716 3300005354 Unclassified 4274
55 Ga0070675_100138949 3300005354 Bacteria 2075
56 Ga0070675_100175089 3300005354 Bacteria 1852
57 Ga0070671_100012402 3300005355 Bacteria 6865
58 Ga0070671_100023055 3300005355 Bacteria 5088
59 Ga0070671_100111319 3300005355 Bacteria 2300
60 Ga0070674_100004642 3300005356 Bacteria 7848
61 Ga0070674_100029698 3300005356 Bacteria 3606
62 Ga0070673_100003584 3300005364 Bacteria 9699
63 Ga0070673_100006750 3300005364 Bacteria 7490
64 Ga0070673_100009678 3300005364 Bacteria 6482
65 Ga0070673_100017294 3300005364 Bacteria 5122
66 Ga0070673_100028903 3300005364 Bacteria 4128
67 Ga0070673_100067675 3300005364 Bacteria 2857
68 Ga0070673_100102156 3300005364 Bacteria 2363
69 Ga0070688_100025393 3300005365 Unclassified 3507
70 Ga0070688_100029591 3300005365 Bacteria 3281
71 Ga0070659_100117145 3300005366 Unclassified 2154
72 Ga0070667_100001600 3300005367 Bacteria 20255
73 Ga0070667_100006223 3300005367 Bacteria 9932
74 Ga0070667_100030462 3300005367 Bacteria 4500
75 Ga0070667_100057952 3300005367 Bacteria 3274
76 Ga0070667_100127475 3300005367 Bacteria 2219
77 Ga0070714_100001826 3300005435 Bacteria 15478
78 Ga0070713_100000935 3300005436 Bacteria 18648
79 Ga0070713_100003116 3300005436 Bacteria 10909
80 Ga0070713_100012227 3300005436 Bacteria 6288
81 Ga0070713_100085404 3300005436 Bacteria 2703
82 Ga0070713_100087411 3300005436 Unclassified 2674
83 Ga0070711_100030775 3300005439 Bacteria 3557
84 Ga0070705_100028991 3300005440 Bacteria 3038
85 Ga0070678_100093319 3300005456 Bacteria 2314
86 Ga0070678_100142200 3300005456 Bacteria 1921
87 Ga0070678_100177965 3300005456 Archaea 1738
88 Ga0070678_100230493 3300005456 Bacteria 1544
89 Ga0070662_100051173 3300005457 Unclassified 2982
90 Ga0070662_100056908 3300005457 Bacteria 2839
91 Ga0068867_100076809 3300005459 Bacteria 2508
92 Ga0070685_10054992 3300005466 Bacteria 2311
93 Ga0070707_100002149 3300005468 Bacteria 18873
94 Ga0070707_100121718 3300005468 Bacteria 2534
95 Ga0070698_100100333 3300005471 Bacteria 2868
96 Ga0070699_100014478 3300005518 Bacteria 6782
97 Ga0070699_100017195 3300005518 Bacteria 6210
98 Ga0070699_100174841 3300005518 Bacteria 1904
99 Ga0070699_100290615 3300005518 Bacteria 1465
100 Ga0070679_100001946 3300005530 Bacteria 18558
101 Ga0068853_100012196 3300005539 Bacteria 6991
102 Ga0068853_100036192 3300005539 Unclassified 4196
103 Ga0070672_100006720 3300005543 Bacteria 7756
104 Ga0070672_100007393 3300005543 Bacteria 7448
105 Ga0070672_100031848 3300005543 Bacteria 3974
106 Ga0070686_100002791 3300005544 Bacteria 9619
107 Ga0070695_100012160 3300005545 Bacteria 5161
108 Ga0070696_100184443 3300005546 Bacteria 1550
109 Ga0070665_100036905 3300005548 Bacteria 4914
110 Ga0070665_100204382 3300005548 Bacteria 1976
111 Ga0070704_100270136 3300005549 Bacteria 1405
112 Ga0068855_100014204 3300005563 Bacteria 9593
113 Ga0068855_100039227 3300005563 Bacteria 5622
114 Ga0068855_100060600 3300005563 Bacteria 4425
115 Ga0070664_100000258 3300005564 Bacteria 38234
116 Ga0070664_100002614 3300005564 Bacteria 14536
117 Ga0070664_100004462 3300005564 Bacteria 11240
118 Ga0070664_100007111 3300005564 Bacteria 9028
119 Ga0068857_100122823 3300005577 Bacteria 2339
120 Ga0068857_100151104 3300005577 Unclassified 2104
121 Ga0068856_100004659 3300005614 Bacteria 13627
122 Ga0068856_100023682 3300005614 Bacteria 5970
123 Ga0068856_100031403 3300005614 Bacteria 5196
124 Ga0068852_100090071 3300005616 Bacteria 2743
125 Ga0068859_100006552 3300005617 Bacteria 11819
126 Ga0068859_100034415 3300005617 Bacteria 5084
127 Ga0068859_100042936 3300005617 Bacteria 4543
128 Ga0068859_100045829 3300005617 Bacteria 4392
129 Ga0068859_100074448 3300005617 Bacteria 3435
130 Ga0068859_100086829 3300005617 Bacteria 3176
131 Ga0068859_100184036 3300005617 Unclassified 2172
132 Ga0068864_100004037 3300005618 Bacteria 12060
133 Ga0068864_100089256 3300005618 Bacteria 2716
134 Ga0068864_100109351 3300005618 Bacteria 2461
135 Ga0068861_100016297 3300005719 Bacteria 5255
136 Ga0068861_100075940 3300005719 Bacteria 2617
137 Ga0068851_10064920 3300005834 Unclassified 1877
138 Ga0068870_10010370 3300005840 Bacteria 4279
139 Ga0068863_100001234 3300005841 Bacteria 25509
140 Ga0068863_100002880 3300005841 Bacteria 17034
141 Ga0068863_100030948 3300005841 Bacteria 5111
142 Ga0068863_100055857 3300005841 Bacteria 3738
143 Ga0068863_100106155 3300005841 Bacteria 2672
144 Ga0068858_100010457 3300005842 Bacteria 8791
145 Ga0068858_100021936 3300005842 Bacteria 5963
146 Ga0068858_100066574 3300005842 Bacteria 3335
147 Ga0068858_100069595 3300005842 Bacteria 3262
148 Ga0068858_100108592 3300005842 Bacteria 2590
149 Ga0068858_100172690 3300005842 Bacteria 2039
150 Ga0068858_100175715 3300005842 Bacteria 2020
151 Ga0068860_100029897 3300005843 Bacteria 5241
152 Ga0068860_100237700 3300005843 Bacteria 1771
153 Ga0068862_100097442 3300005844 Unclassified 2568
154 Ga0081455_10041399 3300005937 Bacteria 4051
155 Ga0081539_10000013 3300005985 Bacteria 432395
156 Ga0081539_10000106 3300005985 Bacteria 195771
157 Ga0081539_10002718 3300005985 Bacteria 23943
158 Ga0070717_10073756 3300006028 Bacteria 2853
159 Ga0070717_10160680 3300006028 Bacteria 1949
160 Ga0097621_100007138 3300006237 Bacteria 7961
161 Ga0097621_100019275 3300006237 Bacteria 5233
162 Ga0097621_100019311 3300006237 Bacteria 5228
163 Ga0097621_100023906 3300006237 Bacteria 4764
164 Ga0097621_100033469 3300006237 Bacteria 4093
165 Ga0068871_100001072 3300006358 Bacteria 18335
166 Ga0068871_100001819 3300006358 Bacteria 14395
167 Ga0068871_100003612 3300006358 Bacteria 10624
168 Ga0068871_100015622 3300006358 Bacteria 5689
169 Ga0068871_100027301 3300006358 Bacteria 4464
170 Ga0068871_100051179 3300006358 Bacteria 3343
171 Ga0068871_100088707 3300006358 Bacteria 2574
172 Ga0068871_100110323 3300006358 Bacteria 2313
173 Ga0068871_100249366 3300006358 Bacteria 1546
174 Ga0075428_100012448 3300006844 Bacteria 9461
175 Ga0075428_100012530 3300006844 Bacteria 9430
176 Ga0075428_100017579 3300006844 Bacteria 7898
177 Ga0075428_100042750 3300006844 Unclassified 4982
178 Ga0075428_100164093 3300006844 Bacteria 2410
179 Ga0075428_100165530 3300006844 Unclassified 2399
180 Ga0075430_100000233 3300006846 Bacteria 38585
181 Ga0075430_100012210 3300006846 Bacteria 7313
182 Ga0075430_100028830 3300006846 Bacteria 4714
183 Ga0075431_100000207 3300006847 Bacteria 43553
184 Ga0075431_100004033 3300006847 Bacteria 14304
185 Ga0075431_100098401 3300006847 Unclassified 3020
186 Ga0075431_100123541 3300006847 Bacteria 2671
187 Ga0075433_10000518 3300006852 Bacteria 25186
188 Ga0075433_10003508 3300006852 Bacteria 12118
189 Ga0075433_10020698 3300006852 Bacteria 5506
190 Ga0075433_10084652 3300006852 Bacteria 2799
191 Ga0075433_10118629 3300006852 Unclassified 2348
192 Ga0075433_10185570 3300006852 Bacteria 1850
193 Ga0075434_100000050 3300006871 Bacteria 57279
194 Ga0075434_100001931 3300006871 Bacteria 17976
195 Ga0075434_100010445 3300006871 Bacteria 8704
196 Ga0075434_100025735 3300006871 Bacteria 5759
197 Ga0075434_100032027 3300006871 Bacteria 5182
198 Ga0075434_100042785 3300006871 Bacteria 4491
199 Ga0075434_100091972 3300006871 Unclassified 3035
200 Ga0075434_100107835 3300006871 Unclassified 2796
201 Ga0075434_100273216 3300006871 Unclassified 1709
202 Ga0075429_100020228 3300006880 Bacteria 5771
203 Ga0075429_100038142 3300006880 Unclassified 4183
204 Ga0075429_100046986 3300006880 Bacteria 3756
205 Ga0075429_100062606 3300006880 Bacteria 3241
206 Ga0075429_100116991 3300006880 Unclassified 2330
207 Ga0068865_100045805 3300006881 Bacteria 2999
208 Ga0068865_100053696 3300006881 Bacteria 2796
209 Ga0068865_100055792 3300006881 Bacteria 2750
210 Ga0068865_100079769 3300006881 Bacteria 2345
211 Ga0075436_100000097 3300006914 Bacteria 51842
212 Ga0075436_100010524 3300006914 Bacteria 6342
213 Ga0075436_100101352 3300006914 Bacteria 2005
214 Ga0097620_100006552 3300006931 Bacteria 11819
215 Ga0097620_100034414 3300006931 Bacteria 5084
216 Ga0097620_100042937 3300006931 Bacteria 4543
217 Ga0097620_100045830 3300006931 Bacteria 4392
218 Ga0097620_100074446 3300006931 Bacteria 3435
219 Ga0097620_100086826 3300006931 Bacteria 3176
220 Ga0097620_100184043 3300006931 Unclassified 2172
221 Ga0075435_100000005 3300007076 Bacteria 121698
222 Ga0075435_100003353 3300007076 Bacteria 10855
223 Ga0075435_100005133 3300007076 Bacteria 9102
224 Ga0075435_100007324 3300007076 Bacteria 7857
225 Ga0075435_100017712 3300007076 Bacteria 5398
226 Ga0105240_10007198 3300009093 Bacteria 16204
227 Ga0105240_10015331 3300009093 Bacteria 10425
228 Ga0105240_10020851 3300009093 Bacteria 8729
229 Ga0105240_10040521 3300009093 Bacteria 5955
230 Ga0111539_10001202 3300009094 Bacteria 34464
231 Ga0111539_10001398 3300009094 Bacteria 32123
232 Ga0111539_10004695 3300009094 Bacteria 17858
233 Ga0111539_10006472 3300009094 Bacteria 15088
234 Ga0111539_10013878 3300009094 Bacteria 10074
235 Ga0111539_10020559 3300009094 Bacteria 8130
236 Ga0111539_10021927 3300009094 Bacteria 7851
237 Ga0111539_10064511 3300009094 Bacteria 4332
238 Ga0111539_10180793 3300009094 Bacteria 2463
239 Ga0111539_10298527 3300009094 Bacteria 1875
240 Ga0105245_10000192 3300009098 Bacteria 57750
241 Ga0105247_10018000 3300009101 Bacteria 4238
242 Ga0105247_10029785 3300009101 Bacteria 3309
243 Ga0114129_10000202 3300009147 Bacteria 66203
244 Ga0114129_10001832 3300009147 Bacteria 28940
245 Ga0114129_10007610 3300009147 Bacteria 15415
246 Ga0114129_10007946 3300009147 Bacteria 15099
247 Ga0114129_10011000 3300009147 Bacteria 12892
248 Ga0114129_10011415 3300009147 Bacteria 12654
249 Ga0114129_10035470 3300009147 Bacteria 7045
250 Ga0114129_10189421 3300009147 Bacteria 2794
251 Ga0114129_10258160 3300009147 Bacteria 2337
252 Ga0114129_10373647 3300009147 Bacteria 1884
253 Ga0114129_10566737 3300009147 Bacteria 1475
254 Ga0105243_10034059 3300009148 Bacteria 3941
255 Ga0105243_10322512 3300009148 Bacteria 1408
256 Ga0105241_10002747 3300009174 Bacteria 13196
257 Ga0105241_10025511 3300009174 Bacteria 4392
258 Ga0105241_10057383 3300009174 Unclassified 2986
259 Ga0105242_10007762 3300009176 Bacteria 8255
260 Ga0105242_10033202 3300009176 Bacteria 4131
261 Ga0105242_10209810 3300009176 Bacteria 1735
262 Ga0105248_10001514 3300009177 Bacteria 25857
263 Ga0105248_10001742 3300009177 Bacteria 24193
264 Ga0105248_10002253 3300009177 Bacteria 21371
265 Ga0105248_10003628 3300009177 Bacteria 17122
266 Ga0105248_10020644 3300009177 Bacteria 7300
267 Ga0105248_10022386 3300009177 Bacteria 7010
268 Ga0105248_10107935 3300009177 Bacteria 3139
269 Ga0105248_10116113 3300009177 Bacteria 3019
270 Ga0105237_10001090 3300009545 Bacteria 36343
271 Ga0105237_10002070 3300009545 Bacteria 25422
272 Ga0105237_10199315 3300009545 Unclassified 2001
273 Ga0105238_10009391 3300009551 Bacteria 9789
274 Ga0105238_10046444 3300009551 Unclassified 4383
275 Ga0105249_10000661 3300009553 Bacteria 31267
276 Ga0105239_10002379 3300010375 Bacteria 23988
277 Ga0105239_10073405 3300010375 Bacteria 3761
278 Ga0105239_10101833 3300010375 Bacteria 3178
279 Ga0105239_10155113 3300010375 Bacteria 2557
280 Ga0105239_10360867 3300010375 Unclassified 1641
281 Ga0105246_10098795 3300011119 Unclassified 2121
282 Ga0105246_10191811 3300011119 Bacteria 1582
283 Ga0157370_10008316 3300013104 Bacteria 11191
284 Ga0157370_10011635 3300013104 Bacteria 9185
285 Ga0157369_10018158 3300013105 Bacteria 7889
286 Ga0157369_10021399 3300013105 Bacteria 7234
287 Ga0157369_10030421 3300013105 Bacteria 5955
288 Ga0157374_10051471 3300013296 Bacteria 3833
289 Ga0157374_10086754 3300013296 Bacteria 2978
290 Ga0157374_10108905 3300013296 Unclassified 2663
291 Ga0157374_10226333 3300013296 Unclassified 1837
292 Ga0157378_10230123 3300013297 Bacteria 1766
293 Ga0163162_10002970 3300013306 Bacteria 16193
294 Ga0163162_10020723 3300013306 Bacteria 6462
295 Ga0163162_10029470 3300013306 Bacteria 5431
296 Ga0163162_10039877 3300013306 Bacteria 4694
297 Ga0163162_10154237 3300013306 Bacteria 2416
298 Ga0157372_10008945 3300013307 Bacteria 10642
299 Ga0157372_10016119 3300013307 Bacteria 8018
300 Ga0157375_10001431 3300013308 Bacteria 20540
301 Ga0157375_10004194 3300013308 Bacteria 12512
302 Ga0157375_10009979 3300013308 Bacteria 8348
303 Ga0157375_10073006 3300013308 Bacteria 3449
304 Ga0157375_10365285 3300013308 Bacteria 1609
305 Ga0163163_10002197 3300014325 Bacteria 16415
306 Ga0163163_10005398 3300014325 Bacteria 11048
307 Ga0163163_10011171 3300014325 Bacteria 8132
308 Ga0163163_10014941 3300014325 Bacteria 7155
309 Ga0163163_10123118 3300014325 Bacteria 2629
310 Ga0157380_10024681 3300014326 Bacteria 4553
311 Ga0157380_10028491 3300014326 Bacteria 4258
312 Ga0157380_10044619 3300014326 Bacteria 3475
313 Ga0157377_10014885 3300014745 Bacteria 3968
314 Ga0157379_10004571 3300014968 Bacteria 11871
315 Ga0157379_10047285 3300014968 Bacteria 3839
316 Ga0157379_10050726 3300014968 Bacteria 3705
317 Ga0157376_10001229 3300014969 Bacteria 16879
318 Ga0157376_10091505 3300014969 Unclassified 2635
319 Ga0157376_10094014 3300014969 Bacteria 2604
320 Ga0157376_10124574 3300014969 Bacteria 2289
321 Ga0157376_10125259 3300014969 Bacteria 2284
322 Ga0157376_10146335 3300014969 Bacteria 2125
323 Ga0157376_10147268 3300014969 Bacteria 2119
324 Ga0163161_10031268 3300017792 Bacteria 3792
325 Ga0184599_153230 3300019188 Unclassified 2104
326 Ga0197907_10812394 3300020069 Unclassified 4926
327 Ga0206356_11025438 3300020070 Bacteria 2812
328 Ga0206356_11150613 3300020070 Unclassified 2562
329 Ga0206356_11532100 3300020070 Bacteria 2469
330 Ga0206352_11225336 3300020078 Bacteria 4034
331 Ga0213875_10003762 3300021388 Bacteria 8546
332 Ga0224712_10023088 3300022467 Bacteria 2155
333 Ga0224712_10033054 3300022467 Bacteria 1890
334 Ga0207697_10002795 3300025315 Bacteria 8895
335 Ga0207682_10002390 3300025893 Bacteria 8443
336 Ga0207682_10021981 3300025893 Bacteria 2511
337 Ga0207642_10039720 3300025899 Bacteria 2047
338 Ga0207710_10041488 3300025900 Bacteria 2041
339 Ga0207688_10002056 3300025901 Bacteria 10808
340 Ga0207680_10005731 3300025903 Bacteria 5954
341 Ga0207680_10006964 3300025903 Bacteria 5483
342 Ga0207680_10009288 3300025903 Bacteria 4872
343 Ga0207680_10014187 3300025903 Bacteria 4115
344 Ga0207680_10067164 3300025903 Bacteria 2208
345 Ga0207699_10032189 3300025906 Bacteria 2953
346 Ga0207699_10066263 3300025906 Bacteria 2192
347 Ga0207645_10006522 3300025907 Bacteria 8361
348 Ga0207643_10000200 3300025908 Bacteria 41454
349 Ga0207643_10005620 3300025908 Bacteria 6702
350 Ga0207654_10007257 3300025911 Bacteria 5585
351 Ga0207654_10029300 3300025911 Unclassified 3012
352 Ga0207707_10003218 3300025912 Bacteria 14505
353 Ga0207707_10045370 3300025912 Bacteria 3830
354 Ga0207695_10000470 3300025913 Bacteria 87551
355 Ga0207695_10013492 3300025913 Bacteria 9740
356 Ga0207695_10032018 3300025913 Bacteria 5759
357 Ga0207695_10056583 3300025913 Bacteria 4080
358 Ga0207671_10012216 3300025914 Bacteria 6923
359 Ga0207671_10034343 3300025914 Bacteria 3769
360 Ga0207671_10081571 3300025914 Unclassified 2426
361 Ga0207663_10102760 3300025916 Unclassified 1923
362 Ga0207663_10171477 3300025916 Bacteria 1541
363 Ga0207662_10044111 3300025918 Bacteria 2632
364 Ga0207657_10025700 3300025919 Bacteria 5424
365 Ga0207649_10001490 3300025920 Bacteria 13748
366 Ga0207649_10016492 3300025920 Bacteria 4168
367 Ga0207652_10007454 3300025921 Bacteria 8818
368 Ga0207646_10029051 3300025922 Bacteria 5027
369 Ga0207681_10019669 3300025923 Bacteria 4270
370 Ga0207681_10021078 3300025923 Bacteria 4137
371 Ga0207681_10157464 3300025923 Bacteria 1708
372 Ga0207694_10027524 3300025924 Bacteria 4330
373 Ga0207650_10001019 3300025925 Bacteria 21032
374 Ga0207650_10004733 3300025925 Bacteria 9297
375 Ga0207650_10006251 3300025925 Bacteria 8116
376 Ga0207650_10058341 3300025925 Bacteria 2874
377 Ga0207659_10004644 3300025926 Bacteria 8319
378 Ga0207659_10010837 3300025926 Bacteria 5740
379 Ga0207659_10028473 3300025926 Bacteria 3797
380 Ga0207659_10030179 3300025926 Unclassified 3701
381 Ga0207659_10051731 3300025926 Bacteria 2923
382 Ga0207659_10091177 3300025926 Bacteria 2276
383 Ga0207659_10128903 3300025926 Bacteria 1949
384 Ga0207687_10002264 3300025927 Bacteria 13113
385 Ga0207687_10109323 3300025927 Unclassified 2048
386 Ga0207700_10001152 3300025928 Bacteria 15186
387 Ga0207700_10023155 3300025928 Bacteria 4277
388 Ga0207700_10049642 3300025928 Bacteria 3122
389 Ga0207664_10002665 3300025929 Bacteria 11838
390 Ga0207644_10004202 3300025931 Bacteria 9345
391 Ga0207644_10021478 3300025931 Unclassified 4399
392 Ga0207644_10034176 3300025931 Bacteria 3557
393 Ga0207690_10085108 3300025932 Unclassified 2218
394 Ga0207706_10027308 3300025933 Bacteria 5105
395 Ga0207706_10122638 3300025933 Bacteria 2286
396 Ga0207706_10219569 3300025933 Unclassified 1664
397 Ga0207686_10063439 3300025934 Bacteria 2350
398 Ga0207686_10088086 3300025934 Unclassified 2043
399 Ga0207686_10089079 3300025934 Bacteria 2033
400 Ga0207686_10127217 3300025934 Bacteria 1743
401 Ga0207670_10007981 3300025936 Bacteria 5948
402 Ga0207669_10011083 3300025937 Bacteria 4372
403 Ga0207704_10002081 3300025938 Bacteria 8961
404 Ga0207704_10040543 3300025938 Bacteria 2723
405 Ga0207691_10004572 3300025940 Bacteria 13399
406 Ga0207691_10005131 3300025940 Bacteria 12639
407 Ga0207691_10013717 3300025940 Bacteria 7743
408 Ga0207691_10016325 3300025940 Bacteria 7049
409 Ga0207691_10017117 3300025940 Bacteria 6877
410 Ga0207691_10192390 3300025940 Bacteria 1779
411 Ga0207711_10001094 3300025941 Bacteria 25858
412 Ga0207711_10005825 3300025941 Bacteria 10410
413 Ga0207711_10015927 3300025941 Bacteria 6236
414 Ga0207711_10041366 3300025941 Bacteria 3925
415 Ga0207711_10050409 3300025941 Bacteria 3564
416 Ga0207711_10060847 3300025941 Bacteria 3255
417 Ga0207711_10066730 3300025941 Unclassified 3112
418 Ga0207689_10003931 3300025942 Bacteria 13530
419 Ga0207689_10004899 3300025942 Bacteria 12075
420 Ga0207689_10124012 3300025942 Bacteria 2125
421 Ga0207689_10154392 3300025942 Bacteria 1892
422 Ga0207661_10037911 3300025944 Bacteria 3774
423 Ga0207661_10151713 3300025944 Bacteria 2004
424 Ga0207679_10004003 3300025945 Bacteria 9153
425 Ga0207679_10014144 3300025945 Bacteria 5239
426 Ga0207679_10014649 3300025945 Bacteria 5160
427 Ga0207679_10036164 3300025945 Bacteria 3500
428 Ga0207679_10043704 3300025945 Bacteria 3228
429 Ga0207679_10068237 3300025945 Bacteria 2671
430 Ga0207667_10000145 3300025949 Bacteria 107389
431 Ga0207667_10007064 3300025949 Bacteria 13569
432 Ga0207667_10013508 3300025949 Bacteria 9337
433 Ga0207667_10033467 3300025949 Bacteria 5525
434 Ga0207651_10011200 3300025960 Bacteria 5009
435 Ga0207651_10015966 3300025960 Bacteria 4382
436 Ga0207651_10018516 3300025960 Bacteria 4147
437 Ga0207651_10043156 3300025960 Bacteria 3007
438 Ga0207651_10060580 3300025960 Unclassified 2628
439 Ga0207712_10010900 3300025961 Bacteria 5785
440 Ga0207640_10012685 3300025981 Unclassified 4807
441 Ga0207640_10118548 3300025981 Bacteria 1891
442 Ga0207658_10005857 3300025986 Bacteria 8406
443 Ga0207658_10008910 3300025986 Bacteria 6806
444 Ga0207658_10049837 3300025986 Bacteria 3079
445 Ga0207658_10077570 3300025986 Bacteria 2535
446 Ga0207658_10079997 3300025986 Bacteria 2502
447 Ga0207677_10003190 3300026023 Bacteria 8647
448 Ga0207703_10015647 3300026035 Bacteria 5917
449 Ga0207703_10081156 3300026035 Bacteria 2703
450 Ga0207703_10138770 3300026035 Unclassified 2108
451 Ga0207639_10006620 3300026041 Bacteria 7878
452 Ga0207639_10028840 3300026041 Bacteria 4057
453 Ga0207678_10013425 3300026067 Bacteria 7190
454 Ga0207708_10044876 3300026075 Bacteria 3368
455 Ga0207708_10057331 3300026075 Unclassified 2972
456 Ga0207702_10002090 3300026078 Bacteria 19275
457 Ga0207702_10016397 3300026078 Bacteria 6133
458 Ga0207702_10017628 3300026078 Bacteria 5909
459 Ga0207641_10006903 3300026088 Bacteria 9499
460 Ga0207641_10015626 3300026088 Bacteria 6220
461 Ga0207641_10054382 3300026088 Bacteria 3396
462 Ga0207648_10022934 3300026089 Bacteria 5598
463 Ga0207648_10116927 3300026089 Bacteria 2343
464 Ga0207676_10006861 3300026095 Bacteria 8065
465 Ga0207676_10014676 3300026095 Bacteria 5642
466 Ga0207676_10102381 3300026095 Bacteria 2377
467 Ga0207676_10134806 3300026095 Bacteria 2105
468 Ga0207676_10147599 3300026095 Bacteria 2021
469 Ga0207674_10005855 3300026116 Bacteria 14577
470 Ga0207674_10016274 3300026116 Bacteria 8145
471 Ga0207674_10092689 3300026116 Bacteria 3010
472 Ga0207675_100005851 3300026118 Bacteria 11748
473 Ga0207675_100073199 3300026118 Bacteria 3206
474 Ga0207675_100099654 3300026118 Bacteria 2736
475 Ga0207675_100115098 3300026118 Bacteria 2541
476 Ga0207683_10024597 3300026121 Bacteria 5188
477 Ga0207683_10039664 3300026121 Bacteria 4109
478 Ga0207683_10117301 3300026121 Bacteria 2387
479 Ga0207683_10154505 3300026121 Bacteria 2072
480 Ga0207683_10241642 3300026121 Bacteria 1647
481 Ga0207698_10009500 3300026142 Bacteria 6205
482 Ga0207698_10171562 3300026142 Bacteria 1911
483 Ga0207428_10000329 3300027907 Bacteria 61608
484 Ga0207428_10003194 3300027907 Bacteria 16028
485 Ga0207428_10009006 3300027907 Bacteria 8986
486 Ga0207428_10037800 3300027907 Bacteria 3927
487 Ga0207428_10130648 3300027907 Bacteria 1922
488 Ga0207428_10202472 3300027907 Bacteria 1493
489 Ga0268266_10031305 3300028379 Bacteria 4517
490 Ga0268266_10036889 3300028379 Bacteria 4164
491 Ga0268266_10051713 3300028379 Bacteria 3527
492 Ga0268266_10206712 3300028379 Bacteria 1799
493 Ga0268265_10283453 3300028380 Bacteria 1483
494 Ga0268264_10001798 3300028381 Bacteria 19614
495 Ga0268264_10092646 3300028381 Bacteria 2609
496 Ga0268264_10148614 3300028381 Bacteria 2098
497 Ga0265767_100741 3300030836 Unclassified 1459
498 Ga0265777_100657 3300030877 Unclassified 1662
499 Ga0307408_100212698 3300031548 Bacteria 1572
500 Ga0265313_10002536 3300031595 Bacteria 15664
501 Ga0265314_10018408 3300031711 Bacteria 5445
502 Ga0307405_10050880 3300031731 Bacteria 2568
503 Ga0307413_10091684 3300031824 Bacteria 1981
504 Ga0307410_10084682 3300031852 Bacteria 2236
505 Ga0307406_10050271 3300031901 Bacteria 2642
506 Ga0307409_100001236 3300031995 Bacteria 12305
507 Ga0307411_10009542 3300032005 Bacteria 5111
508 Ga0307411_10080297 3300032005 Bacteria 2242
509 Ga0307411_10178281 3300032005 Bacteria 1610
510 Ga0307415_100027887 3300032126 Bacteria 3584
511 Ga0373948_0003700 3300034817 Bacteria 2371
512 Ga0373950_0000756 3300034818 Bacteria 4030
513 Ga0373958_0000211 3300034819 Bacteria 6869
514 Ga0373959_0000971 3300034820 Bacteria 4763
515 Ga0373928_0001962 3300035084 Bacteria 4011
516 Ga0373940_0007105 3300035088 Bacteria 2513
517 Ga0373949_0001627 3300035090 Bacteria 6273
518 Ga0373952_0000129 3300035092 Bacteria 10744
519 Ga0373923_0004899 3300035111 Bacteria 4494
520 Ga0373923_0039006 3300035111 Bacteria 1949
521 Ga0373932_0001094 3300035112 Bacteria 7817
522 Ga0373941_0000358 3300035115 Bacteria 9039
523 Ga0373954_0001846 3300035118 Bacteria 8744
524 Ga0373960_0000142 3300035121 Bacteria 11918
525 Ga0373943_0003022 3300035170 Bacteria 7639
526 Ga0373955_0092425 3300035172 Bacteria 1726
527 Ga0373962_0002718 3300035242 Bacteria 4210
528 Ga0373924_0001146 3300035410 Bacteria 8527
529 Ga0373931_0003011 3300035691 Bacteria 7520
530 Ga0373935_0065676 3300035692 Bacteria 2329
531 Ga0373935_0228239 3300035692 Bacteria 1296
532 Ga0373927_0139428 3300035695 Bacteria 1586
533 Ga0373933_0004638 3300035724 Bacteria 7527
534 Ga0373947_0065816 3300035725 Unclassified 2211
535 Ga0373937_0002466 3300036401 Bacteria 15384
536 Ga0373937_0012985 3300036401 Bacteria 7336
537 Ga0373937_0028197 3300036401 Bacteria 5080
538 Ga0373937_0094407 3300036401 Bacteria 2774
539 Ga0373937_0103536 3300036401 Unclassified 2644
540 Ga0373937_0113376 3300036401 Bacteria 2523
541 Ga0373937_0157699 3300036401 Bacteria 2128
542 Ga0373925_0006824 3300037068 Bacteria 8362
543 Ga0373925_0155763 3300037068 Bacteria 1797
544 Ga0436364_0781776 3300037853 Bacteria 13335
545 Ga0436364_1276028 3300037853 Bacteria 29443
546 Ga0436365_0846807 3300039437 Unclassified 3091
547 Ga0439453_0000938 3300041408 Bacteria 3516
548 Ga0451853_0617865 3300041512 Bacteria 1722
549 Ga0439464_0051469 3300042439 Unclassified 1192
550 Ga0439460_0019822 3300042461 Unclassified 1825
551 Ga0451576_0093715 3300045051 Bacteria 3122
552 Ga0495592_0090605 3300046454 Bacteria 2194
553 Ga0495592_0098176 3300046454 Bacteria 2091
554 Ga0495592_0104945 3300046454 Bacteria 2008
555 Ga0495629_0100748 3300046459 Bacteria 2016
556 Ga0495580_0144043 3300046472 Unclassified 1651
557 Ga0495582_0049184 3300046473 Bacteria 2322
558 Ga0495582_0070689 3300046473 Unclassified 1931
559 Ga0495582_0106065 3300046473 Bacteria 1576
560 Ga0495639_0041331 3300046475 Bacteria 2077
561 Ga0495662_0029213 3300046476 Bacteria 2662
562 Ga0495594_0044180 3300046499 Unclassified 2444
563 Ga0495608_0028795 3300046511 Bacteria 3775
564 Ga0495630_0013227 3300046517 Bacteria 6001
565 Ga0495666_0035920 3300046526 Bacteria 2414
566 Ga0495652_0050010 3300046529 Unclassified 3576
567 Ga0495652_0147027 3300046529 Bacteria 1846
568 Ga0495640_0210940 3300046533 Unclassified 1228
569 Ga0495586_0043814 3300046535 Bacteria 2410
570 Ga0495587_0030924 3300046536 Bacteria 3245
571 Ga0495587_0152114 3300046536 Unclassified 1319
572 Ga0495667_0002106 3300046559 Bacteria 13225
573 Ga0495667_0080086 3300046559 Bacteria 2123
574 Ga0495634_0016032 3300046642 Bacteria 5366
575 Ga0495634_0031014 3300046642 Bacteria 3685
576 Ga0495657_0010424 3300046675 Bacteria 6994
577 Ga0495599_0009436 3300046678 Bacteria 5966
578 Ga0495599_0028359 3300046678 Bacteria 3509
579 Ga0495623_0071715 3300046679 Bacteria 2155
580 Ga0495647_0030246 3300046681 Bacteria 2008
581 Ga0495669_0000392 3300046684 Bacteria 21792
582 Ga0495613_0006057 3300046689 Bacteria 9050
583 Ga0495613_0049668 3300046689 Unclassified 3095
584 Ga0495674_0041863 3300047319 Bacteria 4089
585 Ga0495680_0100923 3300047322 Bacteria 2150
586 Ga0495684_0002939 3300047471 Bacteria 13421
587 Ga0495684_0043513 3300047471 Bacteria 3438
588 Ga0495684_0047796 3300047471 Bacteria 3272
589 Ga0495684_0083001 3300047471 Unclassified 2431
590 Ga0495684_0195265 3300047471 Bacteria 1494
591 Ga0495602_0035526 3300048088 Bacteria 4648
592 Ga0495602_0075497 3300048088 Bacteria 2861
593 Ga0495602_0137262 3300048088 Bacteria 1941
594 Ga0496100_0002579 3300048903 Bacteria 9235
595 Ga0496101_0028507 3300048904 Bacteria 3898
596 Ga0496104_0106511 3300048907 Bacteria 2687
597 Ga0496104_0119974 3300048907 Bacteria 2525
598 Ga0496107_0053341 3300048910 Bacteria 2917
599 Ga0496110_0264714 3300048913 Bacteria 1565
600 Ga0496114_0063428 3300048917 Bacteria 3094
601 Ga0496114_0209132 3300048917 Bacteria 1711
602 Ga0496115_0093567 3300048918 Bacteria 2458
603 Ga0501036_0127652 3300049572 Bacteria 2147
604 Ga0501039_0007520 3300049575 Bacteria 8323
605 Ga0501039_0141747 3300049575 Bacteria 1888
606 Ga0501040_0001339 3300049576 Bacteria 15578
607 Ga0501041_0001470 3300049577 Bacteria 13024
608 Ga0501042_0004097 3300049578 Bacteria 9257
609 Ga0501043_0218250 3300049579 Bacteria 1476
610 Ga0501046_0008625 3300049580 Bacteria 8866
611 Ga0501046_0101843 3300049580 Bacteria 2202
612 Ga0501048_0013347 3300049582 Bacteria 6097
613 Ga0501071_0011358 3300049587 Bacteria 5999
614 Ga0501072_0002972 3300049588 Bacteria 12773
615 Ga0501075_0002653 3300049591 Bacteria 11955
616 Ga0501076_0004478 3300049592 Bacteria 9948
617 Ga0501076_0287232 3300049592 Bacteria 1348
618 Ga0501079_0000842 3300049741 Bacteria 20901
619 Ga0501079_0018760 3300049741 Bacteria 5285
620 Ga0501081_0135040 3300049743 Bacteria 1765
621 Ga0501045_0031394 3300049824 Bacteria 3847
622 nmdc:mga05p37_16609_c1 3300050507 Bacteria 8867
623 nmdc:mga05p37_201106_c1 3300050507 Bacteria 2413
624 nmdc:mga05p37_22668_c1 3300050507 Bacteria 7616
625 nmdc:mga05p37_484994_c1 3300050507 Bacteria 1423
626 nmdc:mga05p37_54477_c1 3300050507 Bacteria 4921
627 nmdc:mga05p37_66133_c1 3300050507 Bacteria 4447
628 nmdc:mga05p37_81809_c1 3300050507 Bacteria 3978
629 nmdc:mga05p37_8811_c1 3300050507 Bacteria 11922
630 nmdc:mga09592_168859_c1 3300050508 Bacteria 1891
631 nmdc:mga09592_177563_c1 3300050508 Bacteria 1842
632 nmdc:mga09592_231883_c1 3300050508 Bacteria 1600
633 nmdc:mga09592_50293_c1 3300050508 Bacteria 3515
634 nmdc:mga09592_80292_c1 3300050508 Bacteria 2778
635 nmdc:mga09592_9665_c1 3300050508 Bacteria 7837
636 nmdc:mga0qj67_31610_c1 3300050509 Bacteria 4125
637 nmdc:mga0qj67_3558_c1 3300050509 Bacteria 11250
638 nmdc:mga0qj67_6843_c1 3300050509 Bacteria 8381
639 nmdc:mga06r32_10003_c1 3300050510 Bacteria 8557
640 nmdc:mga06r32_126861_c1 3300050510 Bacteria 2521
641 nmdc:mga06r32_990_c1 3300050510 Bacteria 25473
642 nmdc:mga08y16_101655_c1 3300050511 Unclassified 2993
643 nmdc:mga08y16_143682_c1 3300050511 Bacteria 2480
644 nmdc:mga08y16_16208_c1 3300050511 Bacteria 7835
645 nmdc:mga08y16_16627_c1 3300050511 Bacteria 7737
646 nmdc:mga08y16_261767_c1 3300050511 Bacteria 1786
647 nmdc:mga08y16_34956_c1 3300050511 Bacteria 5280
648 nmdc:mga08y16_423284_c1 3300050511 Bacteria 1361
649 nmdc:mga08y16_6428_c1 3300050511 Bacteria 12319
650 nmdc:mga08y16_9712_c1 3300050511 Bacteria 10102
651 nmdc:mga0n895_111681_c1 3300050512 Bacteria 2750
652 nmdc:mga0n895_11196_c1 3300050512 Bacteria 7988
653 nmdc:mga0n895_139021_c1 3300050512 Bacteria 2456
654 nmdc:mga0n895_17_c1 3300050512 Bacteria 97721
655 nmdc:mga0n895_22282_c1 3300050512 Bacteria 5939
656 nmdc:mga0n895_302689_c1 3300050512 Bacteria 1621
657 nmdc:mga0n895_4443_c1 3300050512 Bacteria 11521
658 nmdc:mga0n895_6923_c1 3300050512 Bacteria 9686
659 nmdc:mga0rr50_24_c1 3300050513 Bacteria 115213
660 nmdc:mga0rr50_6167_c1 3300050513 Bacteria 7260
661 nmdc:mga0rr50_8222_c1 3300050513 Bacteria 6482
662 nmdc:mga0rr50_8279_c1 3300050513 Bacteria 6466
663 nmdc:mga0rr50_85858_c1 3300050513 Bacteria 2440
664 nmdc:mga08x19_14709_c1 3300050514 Bacteria 4752
665 nmdc:mga08x19_164_c1 3300050514 Bacteria 48608
666 nmdc:mga08x19_21194_c1 3300050514 Bacteria 4008
667 nmdc:mga08x19_33515_c1 3300050514 Bacteria 3242
668 nmdc:mga08x19_35864_c1 3300050514 Bacteria 3139
669 nmdc:mga0a205_124466_c1 3300050515 Bacteria 2478
670 nmdc:mga0a205_1369_c1 3300050515 Bacteria 20578
671 nmdc:mga0a205_145327_c1 3300050515 Bacteria 2271
672 nmdc:mga0a205_30264_c1 3300050515 Bacteria 5182
673 nmdc:mga0a205_4214_c1 3300050515 Bacteria 12897
674 nmdc:mga0a205_53149_c1 3300050515 Bacteria 3909
675 nmdc:mga0a205_67705_c1 3300050515 Bacteria 3449
676 Ga0495601_0027892 3300053077 Bacteria 3494
677 Ga0495619_0016657 3300053085 Bacteria 4651
678 Ga0500568_0006475 3300053139 Bacteria 5871
679 Ga0501084_0007729 3300054114 Bacteria 8854
680 Ga0587066_001754 3300059490 Bacteria 2255
681 Ga0587085_002625 3300059506 Unclassified 1853
682 Ga0501082_0000598 3300060353 Bacteria 31815
683 Ga0530510_0002490 3300061734 Bacteria 12643
684 Ga0075434_100014359
685 JGI24746J21847_1001922
686 JGI25406J46586_10004947
687 JGI25406J46586_10007213
688 Ga0058863_10005104
689 Ga0058863_11659439
690 Ga0058863_11963286
691 Ga0058861_10008326
692 Ga0058861_11859261
693 Ga0058861_12043805
694 Ga0058860_10028757
695 Ga0058862_10144628
696 Ga0058862_10162591
697 Ga0058862_12772827
698 Ga0058862_12819301
699 Ga0065712_10073962
700 Ga0065712_10074085
701 Ga0065707_10107490
702 Ga0070676_10002464
703 Ga0070676_10100680
704 Ga0070683_100003267
705 Ga0070683_100081639
706 Ga0070690_100009087
707 Ga0070690_100027560
708 Ga0070670_100001248
709 Ga0070670_100004490
710 Ga0070670_100004593
711 Ga0070670_100056297
712 Ga0068869_100013828
713 Ga0068869_100025087
714 Ga0070666_10000509
715 Ga0070666_10004052
716 Ga0070666_10050666
717 Ga0070680_100025858
718 Ga0068868_100004131
719 Ga0068868_100018183
720 Ga0068868_100026985
721 Ga0070689_100012196
722 Ga0070689_100014543
723 Ga0070689_100022276
724 Ga0070689_100054270
725 Ga0070689_100118247
726 Ga0070691_10000499
727 Ga0070661_100080391
728 Ga0070661_100124759
729 Ga0070669_100003267
730 Ga0070669_100036321
731 Ga0070675_100000668
732 Ga0070675_100001599
733 Ga0070675_100004298
734 Ga0070675_100005310
735 Ga0070675_100013818
736 Ga0070675_100019490
737 Ga0070675_100031716
738 Ga0070675_100138949
739 Ga0070675_100175089
740 Ga0070671_100012402
741 Ga0070671_100023055
742 Ga0070671_100111319
743 Ga0070674_100004642
744 Ga0070674_100029698
745 Ga0070673_100003584
746 Ga0070673_100006750
747 Ga0070673_100009678
748 Ga0070673_100017294
749 Ga0070673_100028903
750 Ga0070673_100067675
751 Ga0070673_100102156
752 Ga0070688_100025393
753 Ga0070688_100029591
754 Ga0070659_100117145
755 Ga0070667_100001600
756 Ga0070667_100006223
757 Ga0070667_100030462
758 Ga0070667_100057952
759 Ga0070667_100127475
760 Ga0070714_100001826
761 Ga0070713_100000935
762 Ga0070713_100003116
763 Ga0070713_100012227
764 Ga0070713_100085404
765 Ga0070713_100087411
766 Ga0070711_100030775
767 Ga0070705_100028991
768 Ga0070678_100093319
769 Ga0070678_100142200
770 Ga0070678_100177965
771 Ga0070678_100230493
772 Ga0070662_100051173
773 Ga0070662_100056908
774 Ga0068867_100076809
775 Ga0070685_10054992
776 Ga0070707_100002149
777 Ga0070707_100121718
778 Ga0070698_100100333
779 Ga0070699_100014478
780 Ga0070699_100017195
781 Ga0070699_100174841
782 Ga0070699_100290615
783 Ga0070679_100001946
784 Ga0068853_100012196
785 Ga0068853_100036192
786 Ga0070672_100006720
787 Ga0070672_100007393
788 Ga0070672_100031848
789 Ga0070686_100002791
790 Ga0070695_100012160
791 Ga0070696_100184443
792 Ga0070665_100036905
793 Ga0070665_100204382
794 Ga0070704_100270136
795 Ga0068855_100014204
796 Ga0068855_100039227
797 Ga0068855_100060600
798 Ga0070664_100000258
799 Ga0070664_100002614
800 Ga0070664_100004462
801 Ga0070664_100007111
802 Ga0068857_100122823
803 Ga0068857_100151104
804 Ga0068856_100004659
805 Ga0068856_100023682
806 Ga0068856_100031403
807 Ga0068852_100090071
808 Ga0068859_100006552
809 Ga0068859_100034415
810 Ga0068859_100042936
811 Ga0068859_100045829
812 Ga0068859_100074448
813 Ga0068859_100086829
814 Ga0068859_100184036
815 Ga0068864_100004037
816 Ga0068864_100089256
817 Ga0068864_100109351
818 Ga0068861_100016297
819 Ga0068861_100075940
820 Ga0068851_10064920
821 Ga0068870_10010370
822 Ga0068863_100001234
823 Ga0068863_100002880
824 Ga0068863_100030948
825 Ga0068863_100055857
826 Ga0068863_100106155
827 Ga0068858_100010457
828 Ga0068858_100021936
829 Ga0068858_100066574
830 Ga0068858_100069595
831 Ga0068858_100108592
832 Ga0068858_100172690
833 Ga0068858_100175715
834 Ga0068860_100029897
835 Ga0068860_100237700
836 Ga0068862_100097442
837 Ga0081455_10041399
838 Ga0081539_10000013
839 Ga0081539_10000106
840 Ga0081539_10002718
841 Ga0070717_10073756
842 Ga0070717_10160680
843 Ga0097621_100007138
844 Ga0097621_100019275
845 Ga0097621_100019311
846 Ga0097621_100023906
847 Ga0097621_100033469
848 Ga0068871_100001072
849 Ga0068871_100001819
850 Ga0068871_100003612
851 Ga0068871_100015622
852 Ga0068871_100027301
853 Ga0068871_100051179
854 Ga0068871_100088707
855 Ga0068871_100110323
856 Ga0068871_100249366
857 Ga0075428_100012448
858 Ga0075428_100012530
859 Ga0075428_100017579
860 Ga0075428_100042750
861 Ga0075428_100164093
862 Ga0075428_100165530
863 Ga0075430_100000233
864 Ga0075430_100012210
865 Ga0075430_100028830
866 Ga0075431_100000207
867 Ga0075431_100004033
868 Ga0075431_100098401
869 Ga0075431_100123541
870 Ga0075433_10000518
871 Ga0075433_10003508
872 Ga0075433_10020698
873 Ga0075433_10084652
874 Ga0075433_10118629
875 Ga0075433_10185570
876 Ga0075434_100000050
877 Ga0075434_100001931
878 Ga0075434_100010445
879 Ga0075434_100025735
880 Ga0075434_100032027
881 Ga0075434_100042785
882 Ga0075434_100091972
883 Ga0075434_100107835
884 Ga0075434_100273216
885 Ga0075429_100020228
886 Ga0075429_100038142
887 Ga0075429_100046986
888 Ga0075429_100062606
889 Ga0075429_100116991
890 Ga0068865_100045805
891 Ga0068865_100053696
892 Ga0068865_100055792
893 Ga0068865_100079769
894 Ga0075436_100000097
895 Ga0075436_100010524
896 Ga0075436_100101352
897 Ga0097620_100006552
898 Ga0097620_100034414
899 Ga0097620_100042937
900 Ga0097620_100045830
901 Ga0097620_100074446
902 Ga0097620_100086826
903 Ga0097620_100184043
904 Ga0075435_100000005
905 Ga0075435_100003353
906 Ga0075435_100005133
907 Ga0075435_100007324
908 Ga0075435_100017712
909 Ga0105240_10007198
910 Ga0105240_10015331
911 Ga0105240_10020851
912 Ga0105240_10040521
913 Ga0111539_10001202
914 Ga0111539_10001398
915 Ga0111539_10004695
916 Ga0111539_10006472
917 Ga0111539_10013878
918 Ga0111539_10020559
919 Ga0111539_10021927
920 Ga0111539_10064511
921 Ga0111539_10180793
922 Ga0111539_10298527
923 Ga0105245_10000192
924 Ga0105247_10018000
925 Ga0105247_10029785
926 Ga0114129_10000202
927 Ga0114129_10001832
928 Ga0114129_10007610
929 Ga0114129_10007946
930 Ga0114129_10011000
931 Ga0114129_10011415
932 Ga0114129_10035470
933 Ga0114129_10189421
934 Ga0114129_10258160
935 Ga0114129_10373647
936 Ga0114129_10566737
937 Ga0105243_10034059
938 Ga0105243_10322512
939 Ga0105241_10002747
940 Ga0105241_10025511
941 Ga0105241_10057383
942 Ga0105242_10007762
943 Ga0105242_10033202
944 Ga0105242_10209810
945 Ga0105248_10001514
946 Ga0105248_10001742
947 Ga0105248_10002253
948 Ga0105248_10003628
949 Ga0105248_10020644
950 Ga0105248_10022386
951 Ga0105248_10107935
952 Ga0105248_10116113
953 Ga0105237_10001090
954 Ga0105237_10002070
955 Ga0105237_10199315
956 Ga0105238_10009391
957 Ga0105238_10046444
958 Ga0105249_10000661
959 Ga0105239_10002379
960 Ga0105239_10073405
961 Ga0105239_10101833
962 Ga0105239_10155113
963 Ga0105239_10360867
964 Ga0105246_10098795
965 Ga0105246_10191811
966 Ga0157370_10008316
967 Ga0157370_10011635
968 Ga0157369_10018158
969 Ga0157369_10021399
970 Ga0157369_10030421
971 Ga0157374_10051471
972 Ga0157374_10086754
973 Ga0157374_10108905
974 Ga0157374_10226333
975 Ga0157378_10230123
976 Ga0163162_10002970
977 Ga0163162_10020723
978 Ga0163162_10029470
979 Ga0163162_10039877
980 Ga0163162_10154237
981 Ga0157372_10008945
982 Ga0157372_10016119
983 Ga0157375_10001431
984 Ga0157375_10004194
985 Ga0157375_10009979
986 Ga0157375_10073006
987 Ga0157375_10365285
988 Ga0163163_10002197
989 Ga0163163_10005398
990 Ga0163163_10011171
991 Ga0163163_10014941
992 Ga0163163_10123118
993 Ga0157380_10024681
994 Ga0157380_10028491
995 Ga0157380_10044619
996 Ga0157377_10014885
997 Ga0157379_10004571
998 Ga0157379_10047285
999 Ga0157379_10050726
1000 Ga0157376_10001229
1001 Ga0157376_10091505
1002 Ga0157376_10094014
1003 Ga0157376_10124574
1004 Ga0157376_10125259
1005 Ga0157376_10146335
1006 Ga0157376_10147268
1007 Ga0163161_10031268
1008 Ga0184599_153230
1009 Ga0197907_10812394
1010 Ga0206356_11025438
1011 Ga0206356_11150613
1012 Ga0206356_11532100
1013 Ga0206352_11225336
1014 Ga0213875_10003762
1015 Ga0224712_10023088
1016 Ga0224712_10033054
1017 Ga0207697_10002795
1018 Ga0207682_10002390
1019 Ga0207682_10021981
1020 Ga0207642_10039720
1021 Ga0207710_10041488
1022 Ga0207688_10002056
1023 Ga0207680_10005731
1024 Ga0207680_10006964
1025 Ga0207680_10009288
1026 Ga0207680_10014187
1027 Ga0207680_10067164
1028 Ga0207699_10032189
1029 Ga0207699_10066263
1030 Ga0207645_10006522
1031 Ga0207643_10000200
1032 Ga0207643_10005620
1033 Ga0207654_10007257
1034 Ga0207654_10029300
1035 Ga0207707_10003218
1036 Ga0207707_10045370
1037 Ga0207695_10000470
1038 Ga0207695_10013492
1039 Ga0207695_10032018
1040 Ga0207695_10056583
1041 Ga0207671_10012216
1042 Ga0207671_10034343
1043 Ga0207671_10081571
1044 Ga0207663_10102760
1045 Ga0207663_10171477
1046 Ga0207662_10044111
1047 Ga0207657_10025700
1048 Ga0207649_10001490
1049 Ga0207649_10016492
1050 Ga0207652_10007454
1051 Ga0207646_10029051
1052 Ga0207681_10019669
1053 Ga0207681_10021078
1054 Ga0207681_10157464
1055 Ga0207694_10027524
1056 Ga0207650_10001019
1057 Ga0207650_10004733
1058 Ga0207650_10006251
1059 Ga0207650_10058341
1060 Ga0207659_10004644
1061 Ga0207659_10010837
1062 Ga0207659_10028473
1063 Ga0207659_10030179
1064 Ga0207659_10051731
1065 Ga0207659_10091177
1066 Ga0207659_10128903
1067 Ga0207687_10002264
1068 Ga0207687_10109323
1069 Ga0207700_10001152
1070 Ga0207700_10023155
1071 Ga0207700_10049642
1072 Ga0207664_10002665
1073 Ga0207644_10004202
1074 Ga0207644_10021478
1075 Ga0207644_10034176
1076 Ga0207690_10085108
1077 Ga0207706_10027308
1078 Ga0207706_10122638
1079 Ga0207706_10219569
1080 Ga0207686_10063439
1081 Ga0207686_10088086
1082 Ga0207686_10089079
1083 Ga0207686_10127217
1084 Ga0207670_10007981
1085 Ga0207669_10011083
1086 Ga0207704_10002081
1087 Ga0207704_10040543
1088 Ga0207691_10004572
1089 Ga0207691_10005131
1090 Ga0207691_10013717
1091 Ga0207691_10016325
1092 Ga0207691_10017117
1093 Ga0207691_10192390
1094 Ga0207711_10001094
1095 Ga0207711_10005825
1096 Ga0207711_10015927
1097 Ga0207711_10041366
1098 Ga0207711_10050409
1099 Ga0207711_10060847
1100 Ga0207711_10066730
1101 Ga0207689_10003931
1102 Ga0207689_10004899
1103 Ga0207689_10124012
1104 Ga0207689_10154392
1105 Ga0207661_10037911
1106 Ga0207661_10151713
1107 Ga0207679_10004003
1108 Ga0207679_10014144
1109 Ga0207679_10014649
1110 Ga0207679_10036164
1111 Ga0207679_10043704
1112 Ga0207679_10068237
1113 Ga0207667_10000145
1114 Ga0207667_10007064
1115 Ga0207667_10013508
1116 Ga0207667_10033467
1117 Ga0207651_10011200
1118 Ga0207651_10015966
1119 Ga0207651_10018516
1120 Ga0207651_10043156
1121 Ga0207651_10060580
1122 Ga0207712_10010900
1123 Ga0207640_10012685
1124 Ga0207640_10118548
1125 Ga0207658_10005857
1126 Ga0207658_10008910
1127 Ga0207658_10049837
1128 Ga0207658_10077570
1129 Ga0207658_10079997
1130 Ga0207677_10003190
1131 Ga0207703_10015647
1132 Ga0207703_10081156
1133 Ga0207703_10138770
1134 Ga0207639_10006620
1135 Ga0207639_10028840
1136 Ga0207678_10013425
1137 Ga0207708_10044876
1138 Ga0207708_10057331
1139 Ga0207702_10002090
1140 Ga0207702_10016397
1141 Ga0207702_10017628
1142 Ga0207641_10006903
1143 Ga0207641_10015626
1144 Ga0207641_10054382
1145 Ga0207648_10022934
1146 Ga0207648_10116927
1147 Ga0207676_10006861
1148 Ga0207676_10014676
1149 Ga0207676_10102381
1150 Ga0207676_10134806
1151 Ga0207676_10147599
1152 Ga0207674_10005855
1153 Ga0207674_10016274
1154 Ga0207674_10092689
1155 Ga0207675_100005851
1156 Ga0207675_100073199
1157 Ga0207675_100099654
1158 Ga0207675_100115098
1159 Ga0207683_10024597
1160 Ga0207683_10039664
1161 Ga0207683_10117301
1162 Ga0207683_10154505
1163 Ga0207683_10241642
1164 Ga0207698_10009500
1165 Ga0207698_10171562
1166 Ga0207428_10000329
1167 Ga0207428_10003194
1168 Ga0207428_10009006
1169 Ga0207428_10037800
1170 Ga0207428_10130648
1171 Ga0207428_10202472
1172 Ga0268266_10031305
1173 Ga0268266_10036889
1174 Ga0268266_10051713
1175 Ga0268266_10206712
1176 Ga0268265_10283453
1177 Ga0268264_10001798
1178 Ga0268264_10092646
1179 Ga0268264_10148614
1180 Ga0265767_100741
1181 Ga0265777_100657
1182 Ga0307408_100212698
1183 Ga0265313_10002536
1184 Ga0265314_10018408
1185 Ga0307405_10050880
1186 Ga0307413_10091684
1187 Ga0307410_10084682
1188 Ga0307406_10050271
1189 Ga0307409_100001236
1190 Ga0307411_10009542
1191 Ga0307411_10080297
1192 Ga0307411_10178281
1193 Ga0307415_100027887
1194 Ga0373948_0003700
1195 Ga0373950_0000756
1196 Ga0373958_0000211
1197 Ga0373959_0000971
1198 Ga0373928_0001962
1199 Ga0373940_0007105
1200 Ga0373949_0001627
1201 Ga0373952_0000129
1202 Ga0373923_0004899
1203 Ga0373923_0039006
1204 Ga0373932_0001094
1205 Ga0373941_0000358
1206 Ga0373954_0001846
1207 Ga0373960_0000142
1208 Ga0373943_0003022
1209 Ga0373955_0092425
1210 Ga0373962_0002718
1211 Ga0373924_0001146
1212 Ga0373931_0003011
1213 Ga0373935_0065676
1214 Ga0373935_0228239
1215 Ga0373927_0139428
1216 Ga0373933_0004638
1217 Ga0373947_0065816
1218 Ga0373937_0002466
1219 Ga0373937_0012985
1220 Ga0373937_0028197
1221 Ga0373937_0094407
1222 Ga0373937_0103536
1223 Ga0373937_0113376
1224 Ga0373937_0157699
1225 Ga0373925_0006824
1226 Ga0373925_0155763
1227 Ga0436364_0781776
1228 Ga0436364_1276028
1229 Ga0436365_0846807
1230 Ga0439453_0000938
1231 Ga0451853_0617865
1232 Ga0439464_0051469
1233 Ga0439460_0019822
1234 Ga0451576_0093715
1235 Ga0495592_0090605
1236 Ga0495592_0098176
1237 Ga0495592_0104945
1238 Ga0495629_0100748
1239 Ga0495580_0144043
1240 Ga0495582_0049184
1241 Ga0495582_0070689
1242 Ga0495582_0106065
1243 Ga0495639_0041331
1244 Ga0495662_0029213
1245 Ga0495594_0044180
1246 Ga0495608_0028795
1247 Ga0495630_0013227
1248 Ga0495666_0035920
1249 Ga0495652_0050010
1250 Ga0495652_0147027
1251 Ga0495640_0210940
1252 Ga0495586_0043814
1253 Ga0495587_0030924
1254 Ga0495587_0152114
1255 Ga0495667_0002106
1256 Ga0495667_0080086
1257 Ga0495634_0016032
1258 Ga0495634_0031014
1259 Ga0495657_0010424
1260 Ga0495599_0009436
1261 Ga0495599_0028359
1262 Ga0495623_0071715
1263 Ga0495647_0030246
1264 Ga0495669_0000392
1265 Ga0495613_0006057
1266 Ga0495613_0049668
1267 Ga0495674_0041863
1268 Ga0495680_0100923
1269 Ga0495684_0002939
1270 Ga0495684_0043513
1271 Ga0495684_0047796
1272 Ga0495684_0083001
1273 Ga0495684_0195265
1274 Ga0495602_0035526
1275 Ga0495602_0075497
1276 Ga0495602_0137262
1277 Ga0496100_0002579
1278 Ga0496101_0028507
1279 Ga0496104_0106511
1280 Ga0496104_0119974
1281 Ga0496107_0053341
1282 Ga0496110_0264714
1283 Ga0496114_0063428
1284 Ga0496114_0209132
1285 Ga0496115_0093567
1286 Ga0501036_0127652
1287 Ga0501039_0007520
1288 Ga0501039_0141747
1289 Ga0501040_0001339
1290 Ga0501041_0001470
1291 Ga0501042_0004097
1292 Ga0501043_0218250
1293 Ga0501046_0008625
1294 Ga0501046_0101843
1295 Ga0501048_0013347
1296 Ga0501071_0011358
1297 Ga0501072_0002972
1298 Ga0501075_0002653
1299 Ga0501076_0004478
1300 Ga0501076_0287232
1301 Ga0501079_0000842
1302 Ga0501079_0018760
1303 Ga0501081_0135040
1304 Ga0501045_0031394
1305 nmdc:mga05p37_16609_c1
1306 nmdc:mga05p37_201106_c1
1307 nmdc:mga05p37_22668_c1
1308 nmdc:mga05p37_484994_c1
1309 nmdc:mga05p37_54477_c1
1310 nmdc:mga05p37_66133_c1
1311 nmdc:mga05p37_81809_c1
1312 nmdc:mga05p37_8811_c1
1313 nmdc:mga09592_168859_c1
1314 nmdc:mga09592_177563_c1
1315 nmdc:mga09592_231883_c1
1316 nmdc:mga09592_50293_c1
1317 nmdc:mga09592_80292_c1
1318 nmdc:mga09592_9665_c1
1319 nmdc:mga0qj67_31610_c1
1320 nmdc:mga0qj67_3558_c1
1321 nmdc:mga0qj67_6843_c1
1322 nmdc:mga06r32_10003_c1
1323 nmdc:mga06r32_126861_c1
1324 nmdc:mga06r32_990_c1
1325 nmdc:mga08y16_101655_c1
1326 nmdc:mga08y16_143682_c1
1327 nmdc:mga08y16_16208_c1
1328 nmdc:mga08y16_16627_c1
1329 nmdc:mga08y16_261767_c1
1330 nmdc:mga08y16_34956_c1
1331 nmdc:mga08y16_423284_c1
1332 nmdc:mga08y16_6428_c1
1333 nmdc:mga08y16_9712_c1
1334 nmdc:mga0n895_111681_c1
1335 nmdc:mga0n895_11196_c1
1336 nmdc:mga0n895_139021_c1
1337 nmdc:mga0n895_17_c1
1338 nmdc:mga0n895_22282_c1
1339 nmdc:mga0n895_302689_c1
1340 nmdc:mga0n895_4443_c1
1341 nmdc:mga0n895_6923_c1
1342 nmdc:mga0rr50_24_c1
1343 nmdc:mga0rr50_6167_c1
1344 nmdc:mga0rr50_8222_c1
1345 nmdc:mga0rr50_8279_c1
1346 nmdc:mga0rr50_85858_c1
1347 nmdc:mga08x19_14709_c1
1348 nmdc:mga08x19_164_c1
1349 nmdc:mga08x19_21194_c1
1350 nmdc:mga08x19_33515_c1
1351 nmdc:mga08x19_35864_c1
1352 nmdc:mga0a205_124466_c1
1353 nmdc:mga0a205_1369_c1
1354 nmdc:mga0a205_145327_c1
1355 nmdc:mga0a205_30264_c1
1356 nmdc:mga0a205_4214_c1
1357 nmdc:mga0a205_53149_c1
1358 nmdc:mga0a205_67705_c1
1359 Ga0495601_0027892
1360 Ga0495619_0016657
1361 Ga0500568_0006475
1362 Ga0501084_0007729
1363 Ga0587066_001754
1364 Ga0587085_002625
1365 Ga0501082_0000598
1366 Ga0530510_0002490

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07586

HXXSHH

Protein of unknown function (DUF1552)

50

355

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2w8d-assembly1.cif.gz_A distinct and essential morphogenic functions for wall- and lipo- teichoic acids in bacillus subtilis 0.5516 44 430
5zzu-assembly2.cif.gz_B crystal structure of the c-terminal periplasmic domain of eceptc from escherichia coli- complex with zn 0.5403 44 400
2w5t-assembly1.cif.gz_A structure-based mechanism of lipoteichoic acid synthesis by staphylococcus aureus ltas. 0.528 45 430
5lrm-assembly1.cif.gz_A structure of di-zinc mcr-1 in p41212 space group 0.5202 44 427
2zkt-assembly1.cif.gz_A structure of ph0037 protein from pyrococcus horikoshii 0.5191 298 436
ID Description Score Start End Superfamily
af_Q9SEL6_1_98_1.20.58.400 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins 0.7445 194 260 1.20.58.400
af_A0A1D8PJW1_4_96_1.20.58.400 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins 0.7011 191 260 1.20.58.400
af_Q8S0N4_1_99_1.20.58.400 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins 0.695 191 267 1.20.58.400
af_A0A1D6NEE8_1_99_1.20.58.400 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins 0.665 190 267 1.20.58.400
af_I1JE83_1_99_1.20.58.400 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins 0.6493 190 268 1.20.58.400
ID Description Score Start End GO Terms
AF-A0A2V8M716-F1-model_v4 DUF1552 domain-containing protein 0.8644 280 442
AF-A0A3N5GB64-F1-model_v4 DUF1552 domain-containing protein 0.8506 281 442
AF-A0A2V8P970-F1-model_v4 DUF1552 domain-containing protein 0.8445 306 443
AF-A0A4Q3VQ31-F1-model_v4 DUF1552 domain-containing protein 0.8427 272 443
AF-A0A2V8M716-F1-model_v4 DUF1552 domain-containing protein 0.8407 280 442

Map