F474687

General Info

Members Datasets Scaffolds Average Seq Length
678 298 678 131

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_39818_c1|nmdc:mga0n895_39818_c1_2663_3103
Length 146
Sequence VHRRRRSDRNGCRINLKTQLQELLDRARFLRPWGFRVVAADKRKCTLELPHKPALERPGGIINGPALMAAADCAMWLAIKARIGVEGDALTSELNTAFLAPARGEHVYCTARILKMGRRRIYGTAECHGRKGNLFSHHTLTYVRTG

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
155 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
156 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
157 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
158 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
159 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
160 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
161 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
162 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
163 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
164 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
165 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
167 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
169 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
170 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
171 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
172 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
173 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
174 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
175 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
176 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
177 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
178 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
179 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
180 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
181 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
183 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
190 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
191 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
192 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
193 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
194 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
195 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
196 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
197 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
198 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
199 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
200 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
201 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
202 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
203 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
204 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
205 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
206 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
211 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
212 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
213 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
214 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
215 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
216 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
217 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
218 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
219 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
220 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
221 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
222 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
223 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
224 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
225 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
226 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
227 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
228 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
229 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
230 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
231 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
234 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
235 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
236 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
237 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
238 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
239 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
240 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
241 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
242 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
243 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
244 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
245 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
246 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
247 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
248 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
249 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
265 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
266 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
267 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
268 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
269 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
270 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
271 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
272 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
273 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
274 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
275 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
276 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
277 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
278 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
279 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
280 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
283 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
284 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
285 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
286 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
287 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
288 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
289 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
290 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
291 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
292 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
293 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
294 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
295 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
296 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
297 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
298 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.15
Rhizosphere 99.85
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100392717 3300005330 Bacteria 1017
2 Ga0070690_100450105 3300005330 Bacteria 955
3 Ga0068869_100043804 3300005334 Bacteria 3216
4 Ga0068869_100162448 3300005334 Bacteria 1739
5 Ga0070680_100023291 3300005336 Bacteria 4938
6 Ga0070680_100053775 3300005336 Bacteria 3286
7 Ga0070680_100085806 3300005336 Bacteria 2601
8 Ga0068868_100003297 3300005338 Bacteria 11228
9 Ga0068868_100278957 3300005338 Bacteria 1414
10 Ga0068868_100655748 3300005338 Bacteria 935
11 Ga0070689_100070658 3300005340 Bacteria 2726
12 Ga0070689_100297526 3300005340 Bacteria 1343
13 Ga0070689_100334371 3300005340 Bacteria 1268
14 Ga0070689_100647650 3300005340 Bacteria 919
15 Ga0070689_100769563 3300005340 Bacteria 845
16 Ga0070691_10016874 3300005341 Bacteria 3358
17 Ga0070691_10670221 3300005341 Bacteria 620
18 Ga0070687_100001183 3300005343 Bacteria 9042
19 Ga0070687_100481459 3300005343 Bacteria 832
20 Ga0070692_10005023 3300005345 Bacteria 5592
21 Ga0070692_10042596 3300005345 Bacteria 2332
22 Ga0070692_10072867 3300005345 Bacteria 1833
23 Ga0070668_100083706 3300005347 Bacteria 2504
24 Ga0070669_100014286 3300005353 Bacteria 5650
25 Ga0070669_100293037 3300005353 Bacteria 1307
26 Ga0070669_100988672 3300005353 Bacteria 721
27 Ga0070675_100064647 3300005354 Bacteria 3025
28 Ga0070675_100669291 3300005354 Bacteria 944
29 Ga0070675_100672136 3300005354 Bacteria 942
30 Ga0070671_100225462 3300005355 Bacteria 1590
31 Ga0070671_100414599 3300005355 Bacteria 1153
32 Ga0070671_100608297 3300005355 Bacteria 945
33 Ga0070674_101575343 3300005356 Bacteria 592
34 Ga0070673_100267659 3300005364 Bacteria 1495
35 Ga0070673_100331255 3300005364 Bacteria 1347
36 Ga0070673_100758394 3300005364 Bacteria 894
37 Ga0070688_100039334 3300005365 Bacteria 2893
38 Ga0070688_100743372 3300005365 Bacteria 763
39 Ga0070688_101607078 3300005365 Bacteria 531
40 Ga0070703_10160872 3300005406 Bacteria 852
41 Ga0070710_10183223 3300005437 Bacteria 1312
42 Ga0070701_10013032 3300005438 Bacteria 3772
43 Ga0070711_100410830 3300005439 Bacteria 1101
44 Ga0070711_100930807 3300005439 Bacteria 743
45 Ga0070705_100002410 3300005440 Bacteria 9407
46 Ga0070705_100219092 3300005440 Bacteria 1317
47 Ga0070705_100436759 3300005440 Bacteria 979
48 Ga0070705_100730374 3300005440 Bacteria 781
49 Ga0070700_100003267 3300005441 Bacteria 8351
50 Ga0070700_100004291 3300005441 Bacteria 7445
51 Ga0070700_100126370 3300005441 Bacteria 1720
52 Ga0070700_100415063 3300005441 Bacteria 1016
53 Ga0070700_101126533 3300005441 Unclassified 652
54 Ga0070694_100015084 3300005444 Bacteria 4844
55 Ga0070694_100030631 3300005444 Bacteria 3521
56 Ga0070694_100093878 3300005444 Bacteria 2110
57 Ga0070694_100313374 3300005444 Bacteria 1205
58 Ga0070694_100339024 3300005444 Bacteria 1162
59 Ga0070694_100496089 3300005444 Bacteria 971
60 Ga0070694_100881369 3300005444 Bacteria 738
61 Ga0070694_100982963 3300005444 Bacteria 700
62 Ga0070708_100738210 3300005445 Bacteria 926
63 Ga0070662_100501968 3300005457 Bacteria 1012
64 Ga0070662_100962020 3300005457 Bacteria 730
65 Ga0070681_10069603 3300005458 Bacteria 3485
66 Ga0070681_10130057 3300005458 Bacteria 2450
67 Ga0068867_100003301 3300005459 Bacteria 11361
68 Ga0068867_100005090 3300005459 Bacteria 9290
69 Ga0070685_10317553 3300005466 Bacteria 1055
70 Ga0070706_100182610 3300005467 Bacteria 1959
71 Ga0070707_100251262 3300005468 Bacteria 1721
72 Ga0070707_101370211 3300005468 Bacteria 674
73 Ga0070707_102083162 3300005468 Bacteria 535
74 Ga0070698_100084915 3300005471 Bacteria 3153
75 Ga0070698_100620727 3300005471 Bacteria 1022
76 Ga0070698_100817637 3300005471 Bacteria 876
77 Ga0070699_100105120 3300005518 Bacteria 2476
78 Ga0070699_100286144 3300005518 Bacteria 1477
79 Ga0070699_101477986 3300005518 Bacteria 623
80 Ga0070679_100058786 3300005530 Bacteria 3831
81 Ga0070684_100197257 3300005535 Bacteria 1833
82 Ga0070684_100335744 3300005535 Bacteria 1389
83 Ga0070697_100006226 3300005536 Bacteria 9240
84 Ga0070697_100100419 3300005536 Bacteria 2403
85 Ga0070686_100017279 3300005544 Bacteria 4212
86 Ga0070686_100059064 3300005544 Bacteria 2470
87 Ga0070686_100765078 3300005544 Bacteria 776
88 Ga0070695_100015945 3300005545 Bacteria 4542
89 Ga0070695_100033902 3300005545 Bacteria 3196
90 Ga0070695_100080342 3300005545 Bacteria 2155
91 Ga0070695_100140987 3300005545 Bacteria 1671
92 Ga0070695_100165845 3300005545 Bacteria 1555
93 Ga0070696_100012095 3300005546 Bacteria 5783
94 Ga0070696_100151796 3300005546 Bacteria 1701
95 Ga0070696_100158442 3300005546 Bacteria 1666
96 Ga0070696_100255795 3300005546 Bacteria 1326
97 Ga0070696_100554158 3300005546 Bacteria 921
98 Ga0070696_101718916 3300005546 Bacteria 541
99 Ga0070693_100001350 3300005547 Bacteria 11040
100 Ga0070693_100062656 3300005547 Bacteria 2165
101 Ga0070693_100273427 3300005547 Bacteria 1129
102 Ga0070693_100646542 3300005547 Bacteria 769
103 Ga0070704_100038400 3300005549 Bacteria 3280
104 Ga0070704_100231403 3300005549 Bacteria 1508
105 Ga0070704_100416412 3300005549 Bacteria 1150
106 Ga0070704_100861017 3300005549 Bacteria 813
107 Ga0070704_101007498 3300005549 Bacteria 754
108 Ga0068855_100022771 3300005563 Bacteria 7508
109 Ga0070664_101232598 3300005564 Bacteria 706
110 Ga0068854_100056717 3300005578 Bacteria 2824
111 Ga0068856_100101355 3300005614 Bacteria 2872
112 Ga0068856_100315526 3300005614 Bacteria 1581
113 Ga0070702_100000150 3300005615 Bacteria 21785
114 Ga0070702_100100344 3300005615 Bacteria 1774
115 Ga0068852_101697873 3300005616 Bacteria 654
116 Ga0068859_100141587 3300005617 Bacteria 2479
117 Ga0068859_101203378 3300005617 Bacteria 834
118 Ga0068859_101759604 3300005617 Bacteria 684
119 Ga0068864_100026496 3300005618 Bacteria 4889
120 Ga0068866_10006202 3300005718 Bacteria 4976
121 Ga0068861_100031913 3300005719 Bacteria 3874
122 Ga0068861_100056123 3300005719 Bacteria 3005
123 Ga0068861_100388655 3300005719 Bacteria 1235
124 Ga0068870_10074806 3300005840 Bacteria 1857
125 Ga0068863_100474479 3300005841 Bacteria 1229
126 Ga0068863_100572790 3300005841 Bacteria 1116
127 Ga0068858_100050263 3300005842 Bacteria 3858
128 Ga0068858_100375570 3300005842 Bacteria 1364
129 Ga0068860_100031234 3300005843 Bacteria 5121
130 Ga0068862_100051652 3300005844 Bacteria 3516
131 Ga0068862_100349869 3300005844 Bacteria 1371
132 Ga0068862_102332943 3300005844 Unclassified 547
133 Ga0081539_10000917 3300005985 Bacteria 55614
134 Ga0070716_100505875 3300006173 Bacteria 892
135 Ga0070716_101160223 3300006173 Bacteria 619
136 Ga0097621_100013058 3300006237 Bacteria 6176
137 Ga0097621_100015779 3300006237 Bacteria 5694
138 Ga0068871_100007963 3300006358 Bacteria 7601
139 Ga0068871_100448131 3300006358 Bacteria 1156
140 Ga0075428_100002475 3300006844 Bacteria 20049
141 Ga0075428_100029340 3300006844 Bacteria 6086
142 Ga0075428_100052500 3300006844 Bacteria 4468
143 Ga0075428_100068580 3300006844 Bacteria 3879
144 Ga0075430_100009696 3300006846 Bacteria 8135
145 Ga0075430_100270145 3300006846 Bacteria 1407
146 Ga0075430_100286514 3300006846 Bacteria 1363
147 Ga0075430_100410019 3300006846 Bacteria 1118
148 Ga0075430_100647409 3300006846 Bacteria 871
149 Ga0075430_101460236 3300006846 Bacteria 562
150 Ga0075431_100003827 3300006847 Bacteria 14629
151 Ga0075431_100063456 3300006847 Bacteria 3813
152 Ga0075431_100113019 3300006847 Bacteria 2803
153 Ga0075431_100115567 3300006847 Bacteria 2770
154 Ga0075431_100195190 3300006847 Bacteria 2073
155 Ga0075431_100224493 3300006847 Bacteria 1915
156 Ga0075433_10003619 3300006852 Bacteria 11940
157 Ga0075433_10058017 3300006852 Bacteria 3385
158 Ga0075433_10088354 3300006852 Bacteria 2739
159 Ga0075433_10530753 3300006852 Bacteria 1035
160 Ga0075433_11507414 3300006852 Bacteria 581
161 Ga0075434_100000003 3300006871 Bacteria 134839
162 Ga0075434_100002400 3300006871 Bacteria 16442
163 Ga0075434_100967170 3300006871 Bacteria 866
164 Ga0075434_102227579 3300006871 Bacteria 551
165 Ga0075429_100000113 3300006880 Bacteria 46474
166 Ga0075429_100004277 3300006880 Bacteria 12251
167 Ga0075429_100171323 3300006880 Bacteria 1901
168 Ga0075429_100339175 3300006880 Bacteria 1316
169 Ga0075429_100464842 3300006880 Bacteria 1108
170 Ga0068865_100027903 3300006881 Bacteria 3734
171 Ga0068865_100251799 3300006881 Bacteria 1394
172 Ga0075436_100002673 3300006914 Bacteria 12256
173 Ga0075436_100004352 3300006914 Bacteria 9719
174 Ga0075436_100012300 3300006914 Bacteria 5863
175 Ga0075436_100215520 3300006914 Bacteria 1362
176 Ga0097620_100090854 3300006931 Bacteria 3104
177 Ga0097620_100141582 3300006931 Bacteria 2479
178 Ga0097620_101203323 3300006931 Bacteria 834
179 Ga0097620_101759687 3300006931 Bacteria 684
180 Ga0075435_100000265 3300007076 Bacteria 32624
181 Ga0075435_100006583 3300007076 Bacteria 8222
182 Ga0075435_100012648 3300007076 Bacteria 6253
183 Ga0075435_100349880 3300007076 Bacteria 1267
184 Ga0075435_100444030 3300007076 Bacteria 1118
185 Ga0075435_101502036 3300007076 Bacteria 591
186 Ga0099794_10042962 3300007265 Bacteria 2157
187 Ga0099794_10221259 3300007265 Bacteria 972
188 Ga0099794_10675562 3300007265 Bacteria 549
189 Ga0111539_10040746 3300009094 Bacteria 5589
190 Ga0111539_10043099 3300009094 Bacteria 5412
191 Ga0111539_10053145 3300009094 Bacteria 4822
192 Ga0111539_11524036 3300009094 Bacteria 775
193 Ga0111539_13320185 3300009094 Bacteria 518
194 Ga0105245_10007925 3300009098 Bacteria 9289
195 Ga0105245_10474760 3300009098 Bacteria 1263
196 Ga0105245_11792352 3300009098 Bacteria 667
197 Ga0114129_10002343 3300009147 Bacteria 26291
198 Ga0114129_10005124 3300009147 Bacteria 18449
199 Ga0114129_10591361 3300009147 Bacteria 1439
200 Ga0114129_10750029 3300009147 Bacteria 1250
201 Ga0114129_11563404 3300009147 Bacteria 809
202 Ga0105243_10002517 3300009148 Bacteria 15300
203 Ga0105243_10011311 3300009148 Bacteria 6751
204 Ga0105241_10018460 3300009174 Bacteria 5130
205 Ga0105242_10045232 3300009176 Bacteria 3567
206 Ga0105242_11052479 3300009176 Bacteria 825
207 Ga0105242_11344288 3300009176 Bacteria 740
208 Ga0105248_10681871 3300009177 Bacteria 1159
209 Ga0105249_10599057 3300009553 Bacteria 1156
210 Ga0105249_11723223 3300009553 Bacteria 699
211 Ga0099796_10297668 3300010159 Bacteria 683
212 Ga0105239_10054903 3300010375 Bacteria 4370
213 Ga0105239_12368365 3300010375 Bacteria 618
214 Ga0105246_10215792 3300011119 Bacteria 1501
215 Ga0157323_1022974 3300012495 Bacteria 609
216 Ga0157371_10547663 3300013102 Bacteria 857
217 Ga0157369_11014634 3300013105 Bacteria 849
218 Ga0157378_10044867 3300013297 Bacteria 3926
219 Ga0157378_12000728 3300013297 Bacteria 629
220 Ga0163162_10147320 3300013306 Bacteria 2471
221 Ga0163162_11766392 3300013306 Bacteria 707
222 Ga0157372_11512596 3300013307 Bacteria 773
223 Ga0157375_11041413 3300013308 Bacteria 956
224 Ga0157380_10011055 3300014326 Bacteria 6512
225 Ga0157380_10038302 3300014326 Bacteria 3722
226 Ga0157380_10051886 3300014326 Bacteria 3246
227 Ga0157377_10246557 3300014745 Bacteria 1156
228 Ga0157376_10105119 3300014969 Bacteria 2475
229 Ga0157376_10133587 3300014969 Bacteria 2217
230 Ga0157376_10814479 3300014969 Bacteria 947
231 Ga0207653_10012100 3300025885 Bacteria 2692
232 Ga0207653_10116829 3300025885 Bacteria 957
233 Ga0207692_10462171 3300025898 Bacteria 800
234 Ga0207642_10028143 3300025899 Bacteria 2310
235 Ga0207688_10793980 3300025901 Bacteria 600
236 Ga0207685_10186108 3300025905 Bacteria 966
237 Ga0207645_10058527 3300025907 Bacteria 2460
238 Ga0207643_10055492 3300025908 Bacteria 2253
239 Ga0207643_10073660 3300025908 Bacteria 1969
240 Ga0207643_10129279 3300025908 Bacteria 1501
241 Ga0207654_10323293 3300025911 Bacteria 1055
242 Ga0207707_10100720 3300025912 Bacteria 2525
243 Ga0207707_10110698 3300025912 Bacteria 2400
244 Ga0207707_10580787 3300025912 Bacteria 950
245 Ga0207663_11270701 3300025916 Bacteria 593
246 Ga0207660_10061693 3300025917 Bacteria 2699
247 Ga0207660_10201382 3300025917 Bacteria 1555
248 Ga0207660_10234177 3300025917 Bacteria 1445
249 Ga0207660_11418754 3300025917 Bacteria 562
250 Ga0207662_10000110 3300025918 Bacteria 39525
251 Ga0207662_10210781 3300025918 Bacteria 1261
252 Ga0207652_10105016 3300025921 Bacteria 2499
253 Ga0207652_10360226 3300025921 Bacteria 1313
254 Ga0207646_10352686 3300025922 Bacteria 1330
255 Ga0207646_10651153 3300025922 Bacteria 944
256 Ga0207681_10004479 3300025923 Bacteria 8599
257 Ga0207659_10024907 3300025926 Bacteria 4016
258 Ga0207659_10533073 3300025926 Bacteria 997
259 Ga0207687_10027468 3300025927 Bacteria 3819
260 Ga0207664_10210879 3300025929 Bacteria 1680
261 Ga0207644_10485751 3300025931 Bacteria 1018
262 Ga0207706_10519113 3300025933 Bacteria 1027
263 Ga0207706_10915187 3300025933 Bacteria 740
264 Ga0207709_10003963 3300025935 Bacteria 8638
265 Ga0207670_10001969 3300025936 Bacteria 10773
266 Ga0207670_10081697 3300025936 Bacteria 2263
267 Ga0207670_10102930 3300025936 Bacteria 2042
268 Ga0207670_10278294 3300025936 Bacteria 1303
269 Ga0207670_10915875 3300025936 Bacteria 735
270 Ga0207704_10002884 3300025938 Bacteria 7774
271 Ga0207704_10305933 3300025938 Bacteria 1220
272 Ga0207665_10655714 3300025939 Bacteria 823
273 Ga0207665_10897017 3300025939 Bacteria 703
274 Ga0207691_10234423 3300025940 Bacteria 1588
275 Ga0207689_10006996 3300025942 Bacteria 9917
276 Ga0207689_10056573 3300025942 Bacteria 3228
277 Ga0207661_10207622 3300025944 Bacteria 1725
278 Ga0207667_10044504 3300025949 Bacteria 4703
279 Ga0207667_10488260 3300025949 Bacteria 1250
280 Ga0207651_10165724 3300025960 Bacteria 1737
281 Ga0207651_10355994 3300025960 Bacteria 1234
282 Ga0207651_10659630 3300025960 Bacteria 919
283 Ga0207668_10362506 3300025972 Bacteria 1215
284 Ga0207640_10124454 3300025981 Bacteria 1854
285 Ga0207640_11934422 3300025981 Bacteria 534
286 Ga0207677_10047524 3300026023 Bacteria 2882
287 Ga0207677_10659034 3300026023 Bacteria 925
288 Ga0207703_10045480 3300026035 Bacteria 3531
289 Ga0207708_10006584 3300026075 Bacteria 8598
290 Ga0207708_10187933 3300026075 Bacteria 1643
291 Ga0207702_10059836 3300026078 Bacteria 3246
292 Ga0207702_10388489 3300026078 Bacteria 1343
293 Ga0207641_10467913 3300026088 Bacteria 1220
294 Ga0207641_10659087 3300026088 Bacteria 1028
295 Ga0207648_10001025 3300026089 Bacteria 31445
296 Ga0207648_10029600 3300026089 Bacteria 4856
297 Ga0207648_11309733 3300026089 Bacteria 681
298 Ga0207676_10027624 3300026095 Bacteria 4229
299 Ga0207674_10287035 3300026116 Bacteria 1594
300 Ga0207675_100005378 3300026118 Bacteria 12285
301 Ga0207675_100005981 3300026118 Bacteria 11584
302 Ga0207675_100134757 3300026118 Bacteria 2343
303 Ga0207675_100296453 3300026118 Bacteria 1574
304 Ga0207683_10567092 3300026121 Bacteria 1050
305 Ga0207698_11423686 3300026142 Bacteria 708
306 Ga0209969_1029605 3300027360 Bacteria 835
307 Ga0209967_1000306 3300027364 Bacteria 6638
308 Ga0209981_1005511 3300027378 Bacteria 1680
309 Ga0210000_1005821 3300027462 Bacteria 1793
310 Ga0210000_1008946 3300027462 Bacteria 1470
311 Ga0209995_1016044 3300027471 Bacteria 1229
312 Ga0209995_1061830 3300027471 Bacteria 638
313 Ga0209999_1009943 3300027543 Bacteria 1718
314 Ga0209999_1019295 3300027543 Bacteria 1250
315 Ga0209588_1015516 3300027671 Bacteria 2343
316 Ga0209588_1193996 3300027671 Bacteria 634
317 Ga0209971_1020839 3300027682 Bacteria 1559
318 Ga0209966_1006695 3300027695 Bacteria 2005
319 Ga0207428_10155375 3300027907 Bacteria 1740
320 Ga0207428_10232569 3300027907 Bacteria 1379
321 Ga0268265_10041489 3300028380 Bacteria 3406
322 Ga0268265_10483989 3300028380 Bacteria 1163
323 Ga0268265_10763644 3300028380 Bacteria 939
324 Ga0268265_10998336 3300028380 Bacteria 827
325 Ga0268264_10059685 3300028381 Bacteria 3196
326 Ga0268264_11426392 3300028381 Bacteria 703
327 Ga0307408_100323497 3300031548 Bacteria 1300
328 Ga0307408_101388735 3300031548 Bacteria 661
329 Ga0316579_10005614 3300031691 Bacteria 5076
330 Ga0307405_10313158 3300031731 Bacteria 1196
331 Ga0307405_11355342 3300031731 Bacteria 621
332 Ga0307413_10419453 3300031824 Bacteria 1054
333 Ga0307410_10972283 3300031852 Bacteria 731
334 Ga0307412_10082296 3300031911 Bacteria 2229
335 Ga0307412_10624557 3300031911 Bacteria 916
336 Ga0307409_100120641 3300031995 Bacteria 2220
337 Ga0307409_101974181 3300031995 Bacteria 613
338 Ga0307416_100150202 3300032002 Bacteria 2135
339 Ga0307416_100259564 3300032002 Bacteria 1697
340 Ga0307416_100338885 3300032002 Bacteria 1515
341 Ga0307416_100540611 3300032002 Bacteria 1237
342 Ga0307416_100683485 3300032002 Bacteria 1114
343 Ga0307416_101687942 3300032002 Bacteria 738
344 Ga0307416_102390712 3300032002 Bacteria 628
345 Ga0307411_10513741 3300032005 Bacteria 1015
346 Ga0316583_10017222 3300032133 Bacteria 2598
347 Ga0316583_10088371 3300032133 Bacteria 1081
348 Ga0373950_0081715 3300034818 Bacteria 676
349 Ga0373938_0083255 3300034957 Bacteria 782
350 Ga0373938_0101291 3300034957 Bacteria 724
351 Ga0373926_0001668 3300035083 Bacteria 6863
352 Ga0373928_0114796 3300035084 Bacteria 716
353 Ga0373929_0241720 3300035085 Unclassified 520
354 Ga0373940_0003072 3300035088 Bacteria 3351
355 Ga0373944_0010854 3300035089 Bacteria 2489
356 Ga0373949_0020008 3300035090 Bacteria 1529
357 Ga0373949_0086592 3300035090 Bacteria 842
358 Ga0373951_0012149 3300035091 Bacteria 1937
359 Ga0373952_0002445 3300035092 Bacteria 3349
360 Ga0373952_0129361 3300035092 Bacteria 692
361 Ga0373923_0054740 3300035111 Bacteria 1680
362 Ga0373923_0163207 3300035111 Bacteria 1017
363 Ga0373932_0006117 3300035112 Bacteria 2840
364 Ga0373932_0114064 3300035112 Bacteria 894
365 Ga0373932_0196321 3300035112 Bacteria 715
366 Ga0373936_0086985 3300035113 Bacteria 1306
367 Ga0373936_0370277 3300035113 Bacteria 654
368 Ga0373939_0002793 3300035114 Bacteria 4094
369 Ga0373939_0075738 3300035114 Bacteria 1107
370 Ga0373941_0009434 3300035115 Bacteria 2458
371 Ga0373941_0141188 3300035115 Bacteria 876
372 Ga0373941_0267043 3300035115 Bacteria 673
373 Ga0373945_0003844 3300035116 Bacteria 4744
374 Ga0373953_0053659 3300035117 Bacteria 1634
375 Ga0373954_0000028 3300035118 Bacteria 56501
376 Ga0373956_0068551 3300035119 Bacteria 1616
377 Ga0373960_0004703 3300035121 Bacteria 3141
378 Ga0373960_0014621 3300035121 Bacteria 1992
379 Ga0373960_0047523 3300035121 Bacteria 1263
380 Ga0373960_0353600 3300035121 Unclassified 558
381 Ga0373943_0056794 3300035170 Bacteria 1943
382 Ga0373943_0069707 3300035170 Bacteria 1777
383 Ga0373946_0008098 3300035171 Bacteria 3859
384 Ga0373946_0035782 3300035171 Bacteria 2010
385 Ga0373955_0009467 3300035172 Bacteria 4563
386 Ga0373955_0040471 3300035172 Bacteria 2493
387 Ga0373955_0149578 3300035172 Bacteria 1374
388 Ga0373955_0426735 3300035172 Bacteria 807
389 Ga0373942_0089602 3300035207 Bacteria 925
390 Ga0373942_0097501 3300035207 Bacteria 894
391 Ga0373961_0009409 3300035241 Bacteria 2391
392 Ga0373961_0058152 3300035241 Bacteria 1165
393 Ga0373961_0415760 3300035241 Bacteria 519
394 Ga0373962_0087225 3300035242 Bacteria 956
395 Ga0373924_0117818 3300035410 Bacteria 1151
396 Ga0373924_0192973 3300035410 Bacteria 897
397 Ga0373924_0259368 3300035410 Bacteria 770
398 Ga0373924_0381895 3300035410 Bacteria 629
399 Ga0373931_0001811 3300035691 Bacteria 9299
400 Ga0373931_0062651 3300035691 Bacteria 2008
401 Ga0373931_0103402 3300035691 Bacteria 1605
402 Ga0373931_0257773 3300035691 Bacteria 1063
403 Ga0373931_0271663 3300035691 Bacteria 1038
404 Ga0373931_1194730 3300035691 Unclassified 520
405 Ga0373935_0016908 3300035692 Bacteria 4417
406 Ga0373927_0010069 3300035695 Bacteria 6330
407 Ga0373933_0023783 3300035724 Bacteria 3503
408 Ga0373933_0024952 3300035724 Bacteria 3425
409 Ga0373933_0281731 3300035724 Bacteria 1074
410 Ga0373947_0031901 3300035725 Bacteria 3103
411 Ga0373947_0102081 3300035725 Bacteria 1803
412 Ga0373947_0918492 3300035725 Bacteria 597
413 Ga0373947_1062996 3300035725 Bacteria 552
414 Ga0373937_0001199 3300036401 Bacteria 21771
415 Ga0373937_0043315 3300036401 Bacteria 4107
416 Ga0373925_0021316 3300037068 Bacteria 4721
417 Ga0373925_1012308 3300037068 Bacteria 684
418 Ga0316581_0075503 3300037588 Bacteria 1035
419 Ga0439439_0148895 3300041406 Bacteria 664
420 Ga0439453_0001076 3300041408 Bacteria 3379
421 Ga0451807_0627795 3300041486 Bacteria 2095
422 Ga0439431_0093512 3300041997 Bacteria 821
423 Ga0439433_0126486 3300041999 Unclassified 647
424 Ga0439456_048392 3300042013 Bacteria 928
425 Ga0439458_0095305 3300042157 Bacteria 769
426 Ga0439434_0005692 3300042435 Bacteria 3638
427 Ga0439435_0001116 3300042436 Bacteria 4784
428 Ga0439435_0063885 3300042436 Bacteria 1078
429 Ga0439435_0101712 3300042436 Bacteria 884
430 Ga0439444_0003523 3300042437 Bacteria 2215
431 Ga0439444_0057543 3300042437 Bacteria 804
432 Ga0439460_0000526 3300042461 Bacteria 8328
433 Ga0450918_037022 3300042531 Bacteria 870
434 Ga0450893_0044890 3300042532 Bacteria 817
435 Ga0451577_0193255 3300042876 Bacteria 1836
436 Ga0451577_1765589 3300042876 Bacteria 543
437 Ga0453683_0481556 3300044673 Bacteria 804
438 Ga0453683_1152746 3300044673 Bacteria 518
439 Ga0466964_0916964 3300044706 Bacteria 502
440 Ga0466960_0374563 3300044901 Bacteria 816
441 Ga0451576_0009574 3300045051 Bacteria 11217
442 Ga0451576_0026461 3300045051 Bacteria 6240
443 Ga0451576_0050035 3300045051 Bacteria 4385
444 Ga0451576_0111234 3300045051 Bacteria 2850
445 Ga0451576_0130916 3300045051 Bacteria 2615
446 Ga0451576_0132216 3300045051 Bacteria 2601
447 Ga0451576_0468176 3300045051 Bacteria 1323
448 Ga0451576_1125936 3300045051 Bacteria 821
449 Ga0451576_1306375 3300045051 Unclassified 756
450 Ga0451576_1739017 3300045051 Bacteria 645
451 Ga0466958_0184619 3300045836 Bacteria 1324
452 Ga0466967_0001877 3300045976 Bacteria 12676
453 Ga0495592_0158265 3300046454 Bacteria 1561
454 Ga0495592_0583919 3300046454 Bacteria 683
455 Ga0495603_0075190 3300046455 Bacteria 1983
456 Ga0495651_0260646 3300046462 Bacteria 1180
457 Ga0495580_0022250 3300046472 Bacteria 4667
458 Ga0495639_0032900 3300046475 Bacteria 2314
459 Ga0495662_0100001 3300046476 Bacteria 1418
460 Ga0495664_0137853 3300046477 Bacteria 1479
461 Ga0495594_0061586 3300046499 Bacteria 2077
462 Ga0495608_0203145 3300046511 Bacteria 1248
463 Ga0495608_0570658 3300046511 Bacteria 681
464 Ga0495628_1214818 3300046516 Bacteria 511
465 Ga0495630_0468563 3300046517 Bacteria 965
466 Ga0495666_0022861 3300046526 Bacteria 3094
467 Ga0495652_0900204 3300046529 Bacteria 584
468 Ga0495665_0176962 3300046531 Bacteria 1109
469 Ga0495640_0038602 3300046533 Bacteria 3358
470 Ga0495586_0009470 3300046535 Bacteria 5186
471 Ga0495598_0254348 3300046537 Bacteria 652
472 Ga0495609_0444313 3300046538 Bacteria 516
473 Ga0495621_0186669 3300046539 Bacteria 830
474 Ga0495621_0236985 3300046539 Bacteria 742
475 Ga0495667_0186941 3300046559 Bacteria 1328
476 Ga0495656_0152189 3300046615 Bacteria 1118
477 Ga0495634_0619985 3300046642 Bacteria 627
478 Ga0495635_0432834 3300046663 Bacteria 871
479 Ga0495659_0023464 3300046664 Bacteria 2097
480 Ga0495659_0423511 3300046664 Bacteria 577
481 Ga0495588_0050293 3300046674 Bacteria 2144
482 Ga0495657_0084499 3300046675 Bacteria 2047
483 Ga0495657_0768543 3300046675 Bacteria 552
484 Ga0495623_0531752 3300046679 Bacteria 618
485 Ga0495647_0000776 3300046681 Bacteria 9490
486 Ga0495658_0103694 3300046683 Bacteria 1701
487 Ga0495669_0122826 3300046684 Bacteria 1218
488 Ga0495624_0205310 3300046690 Bacteria 1196
489 Ga0495604_0441724 3300047317 Bacteria 851
490 Ga0495604_0723344 3300047317 Bacteria 631
491 Ga0495636_0542830 3300047318 Unclassified 565
492 Ga0495674_0162082 3300047319 Bacteria 1870
493 Ga0495674_0353399 3300047319 Bacteria 1193
494 Ga0495676_0516363 3300047321 Bacteria 783
495 Ga0495680_0101441 3300047322 Bacteria 2144
496 Ga0495675_0262560 3300047444 Bacteria 1034
497 Ga0501298_108933 3300049521 Bacteria 640
498 Ga0501299_028701 3300049522 Bacteria 1062
499 Ga0501299_209041 3300049522 Bacteria 522
500 Ga0501031_0068233 3300049568 Bacteria 2316
501 Ga0501031_0100824 3300049568 Bacteria 1884
502 Ga0501031_0497834 3300049568 Bacteria 786
503 Ga0501031_0547852 3300049568 Bacteria 745
504 Ga0501032_0012925 3300049569 Bacteria 5950
505 Ga0501033_0007637 3300049570 Bacteria 8405
506 Ga0501033_0659134 3300049570 Bacteria 714
507 Ga0501033_0777852 3300049570 Bacteria 648
508 Ga0501034_0138074 3300049571 Bacteria 2418
509 Ga0501036_0005367 3300049572 Bacteria 10378
510 Ga0501036_0097488 3300049572 Bacteria 2485
511 Ga0501036_0248344 3300049572 Bacteria 1491
512 Ga0501036_0480845 3300049572 Bacteria 1034
513 Ga0501036_1113491 3300049572 Bacteria 645
514 Ga0501036_1698377 3300049572 Bacteria 509
515 Ga0501037_0554453 3300049573 Bacteria 775
516 Ga0501038_0005959 3300049574 Bacteria 11273
517 Ga0501038_0023410 3300049574 Bacteria 5522
518 Ga0501038_0648140 3300049574 Bacteria 795
519 Ga0501038_1138075 3300049574 Bacteria 569
520 Ga0501039_0000350 3300049575 Bacteria 33064
521 Ga0501039_0041323 3300049575 Bacteria 3561
522 Ga0501039_0075897 3300049575 Bacteria 2613
523 Ga0501039_0082947 3300049575 Bacteria 2496
524 Ga0501039_0169004 3300049575 Bacteria 1719
525 Ga0501040_0000076 3300049576 Bacteria 47632
526 Ga0501040_0030565 3300049576 Bacteria 3639
527 Ga0501040_0057572 3300049576 Bacteria 2669
528 Ga0501040_0094250 3300049576 Bacteria 2083
529 Ga0501040_0136343 3300049576 Bacteria 1728
530 Ga0501040_0203466 3300049576 Bacteria 1406
531 Ga0501041_0002310 3300049577 Bacteria 10783
532 Ga0501041_0018963 3300049577 Bacteria 4099
533 Ga0501041_0125174 3300049577 Bacteria 1599
534 Ga0501041_0476101 3300049577 Bacteria 793
535 Ga0501042_0001348 3300049578 Bacteria 14367
536 Ga0501042_0032166 3300049578 Bacteria 3714
537 Ga0501042_0120236 3300049578 Bacteria 1891
538 Ga0501042_0358663 3300049578 Bacteria 1055
539 Ga0501042_0418088 3300049578 Bacteria 971
540 Ga0501043_0038121 3300049579 Bacteria 3780
541 Ga0501043_0066693 3300049579 Bacteria 2826
542 Ga0501043_0338490 3300049579 Bacteria 1145
543 Ga0501046_0004903 3300049580 Bacteria 12044
544 Ga0501046_0083740 3300049580 Bacteria 2461
545 Ga0501046_0207868 3300049580 Bacteria 1454
546 Ga0501046_0789840 3300049580 Bacteria 666
547 Ga0501047_0039745 3300049581 Bacteria 4550
548 Ga0501048_0002981 3300049582 Bacteria 12922
549 Ga0501048_0046947 3300049582 Bacteria 3083
550 Ga0501048_0064376 3300049582 Bacteria 2593
551 Ga0501048_0124176 3300049582 Bacteria 1825
552 Ga0501048_0208786 3300049582 Bacteria 1385
553 Ga0501048_0596671 3300049582 Bacteria 793
554 Ga0501068_0096208 3300049584 Bacteria 1831
555 Ga0501068_0690709 3300049584 Bacteria 667
556 Ga0501069_0631699 3300049585 Bacteria 644
557 Ga0501070_0026559 3300049586 Bacteria 4858
558 Ga0501070_1059041 3300049586 Bacteria 627
559 Ga0501071_0012748 3300049587 Bacteria 5715
560 Ga0501071_0013763 3300049587 Bacteria 5519
561 Ga0501071_0162282 3300049587 Bacteria 1671
562 Ga0501071_0322060 3300049587 Bacteria 1174
563 Ga0501071_0408595 3300049587 Bacteria 1037
564 Ga0501071_1537671 3300049587 Bacteria 514
565 Ga0501072_0004702 3300049588 Bacteria 10402
566 Ga0501072_0008686 3300049588 Bacteria 7713
567 Ga0501072_0136067 3300049588 Bacteria 1959
568 Ga0501072_0296834 3300049588 Bacteria 1284
569 Ga0501072_0409190 3300049588 Bacteria 1076
570 Ga0501072_0452321 3300049588 Bacteria 1017
571 Ga0501072_0589166 3300049588 Bacteria 877
572 Ga0501072_0928142 3300049588 Bacteria 680
573 Ga0501074_0024704 3300049590 Bacteria 4366
574 Ga0501074_0069474 3300049590 Bacteria 2533
575 Ga0501074_0171059 3300049590 Bacteria 1551
576 Ga0501074_0651862 3300049590 Bacteria 744
577 Ga0501075_0002705 3300049591 Bacteria 11863
578 Ga0501075_0023756 3300049591 Bacteria 4490
579 Ga0501075_0068593 3300049591 Bacteria 2679
580 Ga0501075_0155564 3300049591 Bacteria 1743
581 Ga0501075_0990944 3300049591 Bacteria 639
582 Ga0501076_0000478 3300049592 Bacteria 25212
583 Ga0501076_0002331 3300049592 Bacteria 13011
584 Ga0501076_0131949 3300049592 Bacteria 2026
585 Ga0501076_0485268 3300049592 Bacteria 1018
586 Ga0501076_0597789 3300049592 Bacteria 910
587 Ga0501077_0002380 3300049593 Bacteria 11285
588 Ga0501077_0286710 3300049593 Bacteria 1048
589 Ga0501209_149947 3300049656 Bacteria 702
590 Ga0501233_025851 3300049668 Bacteria 1293
591 Ga0501225_0064879 3300049705 Bacteria 1031
592 Ga0501079_0002229 3300049741 Bacteria 13978
593 Ga0501079_0032959 3300049741 Bacteria 3984
594 Ga0501079_0139368 3300049741 Bacteria 1889
595 Ga0501079_0424736 3300049741 Bacteria 1043
596 Ga0501079_1047708 3300049741 Bacteria 643
597 Ga0501080_0042211 3300049742 Bacteria 4248
598 Ga0501080_0118705 3300049742 Bacteria 2452
599 Ga0501081_0000032 3300049743 Bacteria 52062
600 Ga0501081_0001984 3300049743 Bacteria 12761
601 Ga0501081_0067853 3300049743 Bacteria 2482
602 Ga0501081_0388225 3300049743 Bacteria 1032
603 Ga0501083_0041619 3300049744 Bacteria 3116
604 Ga0501083_0065708 3300049744 Bacteria 2416
605 Ga0501083_0806542 3300049744 Bacteria 611
606 Ga0501035_0013954 3300049822 Bacteria 7412
607 Ga0501035_0969101 3300049822 Bacteria 670
608 Ga0501035_1464312 3300049822 Bacteria 522
609 Ga0501045_0000662 3300049824 Bacteria 21887
610 Ga0501045_0012663 3300049824 Bacteria 5938
611 Ga0501045_0157129 3300049824 Bacteria 1692
612 Ga0501045_0211106 3300049824 Bacteria 1446
613 Ga0501045_0589161 3300049824 Bacteria 824
614 Ga0501204_051297 3300049850 Bacteria 633
615 nmdc:mga05p37_1414500_c1 3300050507 Bacteria 699
616 nmdc:mga05p37_28485_c1 3300050507 Bacteria 6810
617 nmdc:mga05p37_445_c1 3300050507 Bacteria 45012
618 nmdc:mga05p37_479260_c1 3300050507 Bacteria 1433
619 nmdc:mga05p37_515766_c1 3300050507 Bacteria 1368
620 nmdc:mga05p37_712_c1 3300050507 Bacteria 36873
621 nmdc:mga05p37_971965_c1 3300050507 Bacteria 906
622 nmdc:mga09592_102197_c1 3300050508 Bacteria 2456
623 nmdc:mga09592_116376_c1 3300050508 Bacteria 2294
624 nmdc:mga09592_118_c1 3300050508 Bacteria 50210
625 nmdc:mga09592_134796_c1 3300050508 Bacteria 2127
626 nmdc:mga09592_172410_c1 3300050508 Bacteria 1871
627 nmdc:mga09592_1745376_c1 3300050508 Bacteria 501
628 nmdc:mga09592_496_c1 3300050508 Bacteria 29603
629 nmdc:mga0qj67_201907_c1 3300050509 Bacteria 1615
630 nmdc:mga0qj67_329005_c1 3300050509 Bacteria 1237
631 nmdc:mga0qj67_654625_c1 3300050509 Bacteria 838
632 nmdc:mga0qj67_779477_c1 3300050509 Bacteria 758
633 nmdc:mga06r32_1480520_c1 3300050510 Bacteria 619
634 nmdc:mga06r32_17949_c1 3300050510 Bacteria 6469
635 nmdc:mga06r32_18701_c1 3300050510 Bacteria 6348
636 nmdc:mga06r32_209471_c1 3300050510 Bacteria 1937
637 nmdc:mga06r32_60743_c1 3300050510 Bacteria 3638
638 nmdc:mga06r32_835358_c1 3300050510 Bacteria 880
639 nmdc:mga08y16_162923_c1 3300050511 Bacteria 2317
640 nmdc:mga08y16_32621_c1 3300050511 Bacteria 5474
641 nmdc:mga08y16_34152_c1 3300050511 Bacteria 5343
642 nmdc:mga08y16_612669_c1 3300050511 Bacteria 1096
643 nmdc:mga0n895_1108_c1 3300050512 Bacteria 19675
644 nmdc:mga0n895_1527_c1 3300050512 Bacteria 17386
645 nmdc:mga0n895_39818_c1 3300050512 Bacteria 4564
646 nmdc:mga0rr50_2902_c1 3300050513 Bacteria 9778
647 nmdc:mga0rr50_37680_c1 3300050513 Bacteria 3493
648 nmdc:mga08x19_1007480_c1 3300050514 Bacteria 592
649 nmdc:mga08x19_106982_c1 3300050514 Bacteria 1861
650 nmdc:mga08x19_1218441_c1 3300050514 Bacteria 533
651 nmdc:mga08x19_16842_c1 3300050514 Bacteria 4464
652 nmdc:mga08x19_176432_c1 3300050514 Bacteria 1457
653 nmdc:mga08x19_264418_c1 3300050514 Bacteria 1190
654 nmdc:mga08x19_639_c2 3300050514 Bacteria 6743
655 nmdc:mga08x19_7012_c1 3300050514 Bacteria 6691
656 nmdc:mga0a205_165465_c1 3300050515 Bacteria 2107
657 nmdc:mga0a205_189685_c1 3300050515 Bacteria 1948
658 nmdc:mga0a205_2500_c1 3300050515 Bacteria 16211
659 nmdc:mga0a205_600391_c1 3300050515 Bacteria 954
660 nmdc:mga0a205_659087_c1 3300050515 Bacteria 898
661 nmdc:mga0a205_75085_c1 3300050515 Bacteria 3266
662 Ga0495601_0080581 3300053077 Bacteria 2089
663 Ga0495595_0641243 3300053084 Unclassified 544
664 Ga0501084_0004084 3300054114 Bacteria 11890
665 Ga0501084_0031894 3300054114 Bacteria 4407
666 Ga0501084_0042590 3300054114 Bacteria 3798
667 Ga0501084_0673225 3300054114 Bacteria 873
668 Ga0501084_0750330 3300054114 Bacteria 822
669 Ga0501084_1311624 3300054114 Bacteria 607
670 Ga0590071_065313 3300059421 Bacteria 893
671 Ga0590077_020785 3300059426 Bacteria 1395
672 Ga0501082_0028363 3300060353 Bacteria 4824
673 Ga0501082_0029850 3300060353 Bacteria 4697
674 Ga0501082_0332696 3300060353 Bacteria 1323
675 Ga0530510_0001597 3300061734 Bacteria 15298
676 Ga0530510_0005498 3300061734 Bacteria 8774
677 Ga0530510_0114121 3300061734 Bacteria 1980
678 Ga0530510_0251986 3300061734 Bacteria 1316

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046675 Ga0495657_0768543 Ga0495657_0768543_13_366 117
2 3300005356 Ga0070674_101575343 Ga0070674_1015753432 122
3 3300027671 Ga0209588_1193996 Ga0209588_11939961 123
4 3300005336 Ga0070680_100085806 Ga0070680_1000858063 124
5 3300005345 Ga0070692_10072867 Ga0070692_100728673 124
6 3300005347 Ga0070668_100083706 Ga0070668_1000837062 124
7 3300005353 Ga0070669_100014286 Ga0070669_1000142862 124
8 3300005355 Ga0070671_100414599 Ga0070671_1004145992 124
9 3300005364 Ga0070673_100758394 Ga0070673_1007583941 124
10 3300005441 Ga0070700_100004291 Ga0070700_1000042912 124
11 3300005441 Ga0070700_101126533 Ga0070700_1011265332 124
12 3300005457 Ga0070662_100501968 Ga0070662_1005019682 124
13 3300005459 Ga0068867_100003301 Ga0068867_1000033019 124
14 3300005545 Ga0070695_100080342 Ga0070695_1000803422 124
15 3300005549 Ga0070704_101007498 Ga0070704_1010074982 124
16 3300005719 Ga0068861_100031913 Ga0068861_1000319136 124
17 3300005844 Ga0068862_102332943 Ga0068862_1023329431 124
18 3300006846 Ga0075430_100270145 Ga0075430_1002701452 124
19 3300006846 Ga0075430_100647409 Ga0075430_1006474092 124
20 3300006880 Ga0075429_100464842 Ga0075429_1004648422 124
21 3300009553 Ga0105249_11723223 Ga0105249_117232232 124
22 3300013306 Ga0163162_11766392 Ga0163162_117663922 124
23 3300025923 Ga0207681_10004479 Ga0207681_100044799 124
24 3300025960 Ga0207651_10659630 Ga0207651_106596302 124
25 3300025972 Ga0207668_10362506 Ga0207668_103625062 124
26 3300028380 Ga0268265_10998336 Ga0268265_109983362 124
27 3300034818 Ga0373950_0081715 Ga0373950_0081715_257_631 124
28 3300035242 Ga0373962_0087225 Ga0373962_0087225_413_787 124
29 3300037068 Ga0373925_1012308 Ga0373925_1012308_111_485 124
30 3300046454 Ga0495592_0158265 Ga0495592_0158265_712_1086 124
31 3300046476 Ga0495662_0100001 Ga0495662_0100001_859_1233 124
32 3300046511 Ga0495608_0570658 Ga0495608_0570658_270_644 124
33 3300046517 Ga0495630_0468563 Ga0495630_0468563_57_431 124
34 3300046533 Ga0495640_0038602 Ga0495640_0038602_1424_1798 124
35 3300046642 Ga0495634_0619985 Ga0495634_0619985_46_420 124
36 3300046664 Ga0495659_0423511 Ga0495659_0423511_62_436 124
37 3300046690 Ga0495624_0205310 Ga0495624_0205310_284_658 124
38 3300047319 Ga0495674_0162082 Ga0495674_0162082_1312_1686 124
39 3300050508 nmdc:mga09592_172410_c1 nmdc:mga09592_172410_c1_727_1101 124
40 3300050509 nmdc:mga0qj67_329005_c1 nmdc:mga0qj67_329005_c1_57_431 124
41 3300050510 nmdc:mga06r32_1480520_c1 nmdc:mga06r32_1480520_c1_75_449 124
42 3300053077 Ga0495601_0080581 Ga0495601_0080581_472_846 124
43 3300005439 Ga0070711_100410830 Ga0070711_1004108302 127
44 3300035410 Ga0373924_0381895 Ga0373924_0381895_73_465 127
45 3300049568 Ga0501031_0068233 Ga0501031_0068233_1001_1384 127
46 3300049568 Ga0501031_0497834 Ga0501031_0497834_123_506 127
47 3300049569 Ga0501032_0012925 Ga0501032_0012925_4544_4927 127
48 3300049570 Ga0501033_0007637 Ga0501033_0007637_4825_5208 127
49 3300049570 Ga0501033_0659134 Ga0501033_0659134_131_514 127
50 3300049571 Ga0501034_0138074 Ga0501034_0138074_26_409 127
51 3300049572 Ga0501036_0005367 Ga0501036_0005367_3716_4099 127
52 3300049572 Ga0501036_0248344 Ga0501036_0248344_495_878 127
53 3300049574 Ga0501038_0005959 Ga0501038_0005959_5316_5699 127
54 3300049574 Ga0501038_0023410 Ga0501038_0023410_3378_3761 127
55 3300049575 Ga0501039_0000350 Ga0501039_0000350_27000_27383 127
56 3300049575 Ga0501039_0169004 Ga0501039_0169004_811_1194 127
57 3300049576 Ga0501040_0000076 Ga0501040_0000076_40934_41317 127
58 3300049576 Ga0501040_0057572 Ga0501040_0057572_1015_1398 127
59 3300049577 Ga0501041_0002310 Ga0501041_0002310_5058_5441 127
60 3300049577 Ga0501041_0018963 Ga0501041_0018963_1941_2324 127
61 3300049578 Ga0501042_0001348 Ga0501042_0001348_5407_5790 127
62 3300049578 Ga0501042_0032166 Ga0501042_0032166_3190_3573 127
63 3300049579 Ga0501043_0038121 Ga0501043_0038121_2050_2433 127
64 3300049579 Ga0501043_0066693 Ga0501043_0066693_478_861 127
65 3300049580 Ga0501046_0004903 Ga0501046_0004903_5594_5977 127
66 3300049580 Ga0501046_0083740 Ga0501046_0083740_108_491 127
67 3300049581 Ga0501047_0039745 Ga0501047_0039745_1932_2315 127
68 3300049582 Ga0501048_0002981 Ga0501048_0002981_7224_7607 127
69 3300049582 Ga0501048_0064376 Ga0501048_0064376_1465_1848 127
70 3300049584 Ga0501068_0096208 Ga0501068_0096208_620_1003 127
71 3300049586 Ga0501070_0026559 Ga0501070_0026559_4153_4536 127
72 3300049587 Ga0501071_0012748 Ga0501071_0012748_4535_4918 127
73 3300049587 Ga0501071_0013763 Ga0501071_0013763_2692_3075 127
74 3300049588 Ga0501072_0004702 Ga0501072_0004702_7734_8117 127
75 3300049588 Ga0501072_0008686 Ga0501072_0008686_5650_6033 127
76 3300049590 Ga0501074_0024704 Ga0501074_0024704_3050_3433 127
77 3300049590 Ga0501074_0069474 Ga0501074_0069474_527_910 127
78 3300049591 Ga0501075_0002705 Ga0501075_0002705_8283_8666 127
79 3300049591 Ga0501075_0068593 Ga0501075_0068593_977_1360 127
80 3300049592 Ga0501076_0000478 Ga0501076_0000478_6560_6943 127
81 3300049592 Ga0501076_0002331 Ga0501076_0002331_6956_7339 127
82 3300049593 Ga0501077_0002380 Ga0501077_0002380_5527_5910 127
83 3300049741 Ga0501079_0002229 Ga0501079_0002229_6677_7060 127
84 3300049741 Ga0501079_0032959 Ga0501079_0032959_1740_2123 127
85 3300049742 Ga0501080_0042211 Ga0501080_0042211_2019_2402 127
86 3300049742 Ga0501080_0118705 Ga0501080_0118705_836_1219 127
87 3300049743 Ga0501081_0000032 Ga0501081_0000032_5352_5735 127
88 3300049743 Ga0501081_0001984 Ga0501081_0001984_7762_8145 127
89 3300049744 Ga0501083_0041619 Ga0501083_0041619_1040_1423 127
90 3300049744 Ga0501083_0065708 Ga0501083_0065708_1719_2102 127
91 3300049822 Ga0501035_0013954 Ga0501035_0013954_2148_2531 127
92 3300049822 Ga0501035_0969101 Ga0501035_0969101_264_647 127
93 3300049824 Ga0501045_0000662 Ga0501045_0000662_16041_16424 127
94 3300050509 nmdc:mga0qj67_201907_c1 nmdc:mga0qj67_201907_c1_824_1207 127
95 3300054114 Ga0501084_0004084 Ga0501084_0004084_5496_5879 127
96 3300054114 Ga0501084_0031894 Ga0501084_0031894_1235_1618 127
97 3300060353 Ga0501082_0028363 Ga0501082_0028363_1808_2191 127
98 3300060353 Ga0501082_0029850 Ga0501082_0029850_2844_3227 127
99 3300061734 Ga0530510_0001597 Ga0530510_0001597_5171_5554 127
100 3300061734 Ga0530510_0005498 Ga0530510_0005498_2151_2534 127
101 3300005338 Ga0068868_100655748 Ga0068868_1006557482 129
102 3300005458 Ga0070681_10069603 Ga0070681_100696032 130
103 3300005458 Ga0070681_10130057 Ga0070681_101300573 130
104 3300005544 Ga0070686_100765078 Ga0070686_1007650782 130
105 3300005614 Ga0068856_100101355 Ga0068856_1001013553 130
106 3300010375 Ga0105239_12368365 Ga0105239_123683651 130
107 3300025905 Ga0207685_10186108 Ga0207685_101861082 130
108 3300025912 Ga0207707_10100720 Ga0207707_101007203 130
109 3300025912 Ga0207707_10110698 Ga0207707_101106983 130
110 3300025921 Ga0207652_10360226 Ga0207652_103602262 130
111 3300025944 Ga0207661_10207622 Ga0207661_102076222 130
112 3300026078 Ga0207702_10059836 Ga0207702_100598363 130
113 3300035092 Ga0373952_0129361 Ga0373952_0129361_141_533 130
114 3300035121 Ga0373960_0004703 Ga0373960_0004703_1285_1677 130
115 3300035172 Ga0373955_0149578 Ga0373955_0149578_109_510 130
116 3300035172 Ga0373955_0426735 Ga0373955_0426735_25_426 130
117 3300035724 Ga0373933_0281731 Ga0373933_0281731_520_921 130
118 3300046529 Ga0495652_0900204 Ga0495652_0900204_115_516 130
119 3300049576 Ga0501040_0094250 Ga0501040_0094250_1049_1444 130
120 3300049582 Ga0501048_0124176 Ga0501048_0124176_1194_1589 130
121 3300049587 Ga0501071_0162282 Ga0501071_0162282_373_768 130
122 3300049588 Ga0501072_0296834 Ga0501072_0296834_534_929 130
123 3300049591 Ga0501075_0155564 Ga0501075_0155564_1150_1545 130
124 3300049824 Ga0501045_0211106 Ga0501045_0211106_737_1132 130
125 3300053084 Ga0495595_0641243 Ga0495595_0641243_36_437 130
126 3300005330 Ga0070690_100392717 Ga0070690_1003927172 131
127 3300005330 Ga0070690_100450105 Ga0070690_1004501052 131
128 3300005334 Ga0068869_100043804 Ga0068869_1000438042 131
129 3300005334 Ga0068869_100162448 Ga0068869_1001624482 131
130 3300005336 Ga0070680_100023291 Ga0070680_1000232913 131
131 3300005336 Ga0070680_100053775 Ga0070680_1000537752 131
132 3300005338 Ga0068868_100003297 Ga0068868_10000329712 131
133 3300005338 Ga0068868_100278957 Ga0068868_1002789572 131
134 3300005340 Ga0070689_100070658 Ga0070689_1000706582 131
135 3300005340 Ga0070689_100297526 Ga0070689_1002975262 131
136 3300005340 Ga0070689_100334371 Ga0070689_1003343712 131
137 3300005340 Ga0070689_100647650 Ga0070689_1006476501 131
138 3300005340 Ga0070689_100769563 Ga0070689_1007695631 131
139 3300005341 Ga0070691_10016874 Ga0070691_100168742 131
140 3300005341 Ga0070691_10670221 Ga0070691_106702211 131
141 3300005343 Ga0070687_100001183 Ga0070687_1000011839 131
142 3300005343 Ga0070687_100481459 Ga0070687_1004814592 131
143 3300005345 Ga0070692_10005023 Ga0070692_100050236 131
144 3300005345 Ga0070692_10042596 Ga0070692_100425962 131
145 3300005353 Ga0070669_100293037 Ga0070669_1002930371 131
146 3300005353 Ga0070669_100988672 Ga0070669_1009886721 131
147 3300005354 Ga0070675_100064647 Ga0070675_1000646472 131
148 3300005354 Ga0070675_100669291 Ga0070675_1006692912 131
149 3300005354 Ga0070675_100672136 Ga0070675_1006721362 131
150 3300005355 Ga0070671_100225462 Ga0070671_1002254622 131
151 3300005355 Ga0070671_100608297 Ga0070671_1006082972 131
152 3300005364 Ga0070673_100267659 Ga0070673_1002676592 131
153 3300005364 Ga0070673_100331255 Ga0070673_1003312552 131
154 3300005365 Ga0070688_100039334 Ga0070688_1000393343 131
155 3300005365 Ga0070688_100743372 Ga0070688_1007433721 131
156 3300005365 Ga0070688_101607078 Ga0070688_1016070781 131
157 3300005406 Ga0070703_10160872 Ga0070703_101608722 131
158 3300005437 Ga0070710_10183223 Ga0070710_101832232 131
159 3300005438 Ga0070701_10013032 Ga0070701_100130322 131
160 3300005439 Ga0070711_100930807 Ga0070711_1009308072 131
161 3300005440 Ga0070705_100002410 Ga0070705_1000024103 131
162 3300005440 Ga0070705_100219092 Ga0070705_1002190922 131
163 3300005440 Ga0070705_100436759 Ga0070705_1004367592 131
164 3300005440 Ga0070705_100730374 Ga0070705_1007303742 131
165 3300005441 Ga0070700_100003267 Ga0070700_1000032673 131
166 3300005441 Ga0070700_100126370 Ga0070700_1001263703 131
167 3300005441 Ga0070700_100415063 Ga0070700_1004150632 131
168 3300005444 Ga0070694_100015084 Ga0070694_1000150845 131
169 3300005444 Ga0070694_100030631 Ga0070694_1000306313 131
170 3300005444 Ga0070694_100093878 Ga0070694_1000938782 131
171 3300005444 Ga0070694_100313374 Ga0070694_1003133742 131
172 3300005444 Ga0070694_100339024 Ga0070694_1003390242 131
173 3300005444 Ga0070694_100496089 Ga0070694_1004960892 131
174 3300005444 Ga0070694_100881369 Ga0070694_1008813692 131
175 3300005444 Ga0070694_100982963 Ga0070694_1009829632 131
176 3300005445 Ga0070708_100738210 Ga0070708_1007382102 131
177 3300005457 Ga0070662_100962020 Ga0070662_1009620201 131
178 3300005459 Ga0068867_100005090 Ga0068867_1000050909 131
179 3300005466 Ga0070685_10317553 Ga0070685_103175532 131
180 3300005467 Ga0070706_100182610 Ga0070706_1001826102 131
181 3300005468 Ga0070707_100251262 Ga0070707_1002512622 131
182 3300005468 Ga0070707_101370211 Ga0070707_1013702112 131
183 3300005468 Ga0070707_102083162 Ga0070707_1020831621 131
184 3300005471 Ga0070698_100084915 Ga0070698_1000849153 131
185 3300005471 Ga0070698_100620727 Ga0070698_1006207271 131
186 3300005471 Ga0070698_100817637 Ga0070698_1008176372 131
187 3300005518 Ga0070699_100105120 Ga0070699_1001051202 131
188 3300005518 Ga0070699_100286144 Ga0070699_1002861442 131
189 3300005518 Ga0070699_101477986 Ga0070699_1014779861 131
190 3300005530 Ga0070679_100058786 Ga0070679_1000587863 131
191 3300005535 Ga0070684_100197257 Ga0070684_1001972572 131
192 3300005535 Ga0070684_100335744 Ga0070684_1003357442 131
193 3300005536 Ga0070697_100006226 Ga0070697_1000062269 131
194 3300005536 Ga0070697_100100419 Ga0070697_1001004192 131
195 3300005544 Ga0070686_100017279 Ga0070686_1000172794 131
196 3300005544 Ga0070686_100059064 Ga0070686_1000590643 131
197 3300005545 Ga0070695_100015945 Ga0070695_1000159454 131
198 3300005545 Ga0070695_100033902 Ga0070695_1000339023 131
199 3300005545 Ga0070695_100140987 Ga0070695_1001409872 131
200 3300005545 Ga0070695_100165845 Ga0070695_1001658452 131
201 3300005546 Ga0070696_100012095 Ga0070696_1000120954 131
202 3300005546 Ga0070696_100151796 Ga0070696_1001517962 131
203 3300005546 Ga0070696_100158442 Ga0070696_1001584422 131
204 3300005546 Ga0070696_100255795 Ga0070696_1002557952 131
205 3300005546 Ga0070696_100554158 Ga0070696_1005541582 131
206 3300005546 Ga0070696_101718916 Ga0070696_1017189161 131
207 3300005547 Ga0070693_100001350 Ga0070693_10000135012 131
208 3300005547 Ga0070693_100062656 Ga0070693_1000626563 131
209 3300005547 Ga0070693_100273427 Ga0070693_1002734272 131
210 3300005547 Ga0070693_100646542 Ga0070693_1006465421 131
211 3300005549 Ga0070704_100038400 Ga0070704_1000384002 131
212 3300005549 Ga0070704_100231403 Ga0070704_1002314032 131
213 3300005549 Ga0070704_100416412 Ga0070704_1004164121 131
214 3300005549 Ga0070704_100861017 Ga0070704_1008610172 131
215 3300005563 Ga0068855_100022771 Ga0068855_1000227712 131
216 3300005564 Ga0070664_101232598 Ga0070664_1012325982 131
217 3300005578 Ga0068854_100056717 Ga0068854_1000567173 131
218 3300005614 Ga0068856_100315526 Ga0068856_1003155262 131
219 3300005615 Ga0070702_100000150 Ga0070702_10000015017 131
220 3300005615 Ga0070702_100100344 Ga0070702_1001003442 131
221 3300005616 Ga0068852_101697873 Ga0068852_1016978732 131
222 3300005617 Ga0068859_100141587 Ga0068859_1001415872 131
223 3300005617 Ga0068859_101203378 Ga0068859_1012033782 131
224 3300005617 Ga0068859_101759604 Ga0068859_1017596042 131
225 3300005618 Ga0068864_100026496 Ga0068864_1000264965 131
226 3300005718 Ga0068866_10006202 Ga0068866_100062023 131
227 3300005719 Ga0068861_100056123 Ga0068861_1000561233 131
228 3300005719 Ga0068861_100388655 Ga0068861_1003886552 131
229 3300005840 Ga0068870_10074806 Ga0068870_100748062 131
230 3300005841 Ga0068863_100474479 Ga0068863_1004744792 131
231 3300005841 Ga0068863_100572790 Ga0068863_1005727902 131
232 3300005842 Ga0068858_100050263 Ga0068858_1000502634 131
233 3300005842 Ga0068858_100375570 Ga0068858_1003755702 131
234 3300005843 Ga0068860_100031234 Ga0068860_1000312343 131
235 3300005844 Ga0068862_100051652 Ga0068862_1000516523 131
236 3300005844 Ga0068862_100349869 Ga0068862_1003498692 131
237 3300005985 Ga0081539_10000917 Ga0081539_1000091720 131
238 3300006173 Ga0070716_100505875 Ga0070716_1005058751 131
239 3300006173 Ga0070716_101160223 Ga0070716_1011602232 131
240 3300006237 Ga0097621_100013058 Ga0097621_1000130588 131
241 3300006237 Ga0097621_100015779 Ga0097621_1000157794 131
242 3300006358 Ga0068871_100007963 Ga0068871_1000079636 131
243 3300006358 Ga0068871_100448131 Ga0068871_1004481312 131
244 3300006844 Ga0075428_100002475 Ga0075428_10000247516 131
245 3300006844 Ga0075428_100029340 Ga0075428_1000293406 131
246 3300006844 Ga0075428_100052500 Ga0075428_1000525003 131
247 3300006844 Ga0075428_100068580 Ga0075428_1000685803 131
248 3300006846 Ga0075430_100009696 Ga0075430_1000096962 131
249 3300006846 Ga0075430_100286514 Ga0075430_1002865142 131
250 3300006846 Ga0075430_100410019 Ga0075430_1004100192 131
251 3300006846 Ga0075430_101460236 Ga0075430_1014602362 131
252 3300006847 Ga0075431_100003827 Ga0075431_1000038277 131
253 3300006847 Ga0075431_100063456 Ga0075431_1000634564 131
254 3300006847 Ga0075431_100113019 Ga0075431_1001130192 131
255 3300006847 Ga0075431_100115567 Ga0075431_1001155672 131
256 3300006847 Ga0075431_100195190 Ga0075431_1001951902 131
257 3300006847 Ga0075431_100224493 Ga0075431_1002244932 131
258 3300006852 Ga0075433_10003619 Ga0075433_100036194 131
259 3300006852 Ga0075433_10058017 Ga0075433_100580174 131
260 3300006852 Ga0075433_10088354 Ga0075433_100883542 131
261 3300006852 Ga0075433_10530753 Ga0075433_105307532 131
262 3300006852 Ga0075433_11507414 Ga0075433_115074142 131
263 3300006871 Ga0075434_100000003 Ga0075434_100000003126 131
264 3300006871 Ga0075434_100002400 Ga0075434_10000240013 131
265 3300006871 Ga0075434_100967170 Ga0075434_1009671702 131
266 3300006871 Ga0075434_102227579 Ga0075434_1022275792 131
267 3300006880 Ga0075429_100000113 Ga0075429_1000001138 131
268 3300006880 Ga0075429_100004277 Ga0075429_1000042773 131
269 3300006880 Ga0075429_100171323 Ga0075429_1001713232 131
270 3300006880 Ga0075429_100339175 Ga0075429_1003391752 131
271 3300006881 Ga0068865_100027903 Ga0068865_1000279033 131
272 3300006881 Ga0068865_100251799 Ga0068865_1002517991 131
273 3300006914 Ga0075436_100002673 Ga0075436_1000026733 131
274 3300006914 Ga0075436_100004352 Ga0075436_1000043528 131
275 3300006914 Ga0075436_100012300 Ga0075436_1000123006 131
276 3300006914 Ga0075436_100215520 Ga0075436_1002155202 131
277 3300006931 Ga0097620_100090854 Ga0097620_1000908543 131
278 3300006931 Ga0097620_100141582 Ga0097620_1001415823 131
279 3300006931 Ga0097620_101203323 Ga0097620_1012033232 131
280 3300006931 Ga0097620_101759687 Ga0097620_1017596872 131
281 3300007076 Ga0075435_100000265 Ga0075435_10000026512 131
282 3300007076 Ga0075435_100006583 Ga0075435_1000065832 131
283 3300007076 Ga0075435_100012648 Ga0075435_1000126485 131
284 3300007076 Ga0075435_100349880 Ga0075435_1003498802 131
285 3300007076 Ga0075435_100444030 Ga0075435_1004440302 131
286 3300007076 Ga0075435_101502036 Ga0075435_1015020361 131
287 3300007265 Ga0099794_10042962 Ga0099794_100429622 131
288 3300007265 Ga0099794_10221259 Ga0099794_102212592 131
289 3300007265 Ga0099794_10675562 Ga0099794_106755622 131
290 3300009094 Ga0111539_10040746 Ga0111539_100407465 131
291 3300009094 Ga0111539_10043099 Ga0111539_100430994 131
292 3300009094 Ga0111539_10053145 Ga0111539_100531456 131
293 3300009094 Ga0111539_11524036 Ga0111539_115240362 131
294 3300009094 Ga0111539_13320185 Ga0111539_133201851 131
295 3300009098 Ga0105245_10007925 Ga0105245_100079253 131
296 3300009098 Ga0105245_10474760 Ga0105245_104747603 131
297 3300009098 Ga0105245_11792352 Ga0105245_117923522 131
298 3300009147 Ga0114129_10002343 Ga0114129_100023437 131
299 3300009147 Ga0114129_10005124 Ga0114129_100051248 131
300 3300009147 Ga0114129_10591361 Ga0114129_105913612 131
301 3300009147 Ga0114129_10750029 Ga0114129_107500292 131
302 3300009147 Ga0114129_11563404 Ga0114129_115634042 131
303 3300009148 Ga0105243_10002517 Ga0105243_1000251715 131
304 3300009148 Ga0105243_10011311 Ga0105243_100113114 131
305 3300009174 Ga0105241_10018460 Ga0105241_100184602 131
306 3300009176 Ga0105242_10045232 Ga0105242_100452324 131
307 3300009176 Ga0105242_11052479 Ga0105242_110524792 131
308 3300009176 Ga0105242_11344288 Ga0105242_113442882 131
309 3300009177 Ga0105248_10681871 Ga0105248_106818712 131
310 3300009553 Ga0105249_10599057 Ga0105249_105990572 131
311 3300010159 Ga0099796_10297668 Ga0099796_102976682 131
312 3300010375 Ga0105239_10054903 Ga0105239_100549034 131
313 3300011119 Ga0105246_10215792 Ga0105246_102157923 131
314 3300012495 Ga0157323_1022974 Ga0157323_10229742 131
315 3300013102 Ga0157371_10547663 Ga0157371_105476632 131
316 3300013105 Ga0157369_11014634 Ga0157369_110146342 131
317 3300013297 Ga0157378_10044867 Ga0157378_100448674 131
318 3300013297 Ga0157378_12000728 Ga0157378_120007282 131
319 3300013306 Ga0163162_10147320 Ga0163162_101473203 131
320 3300013307 Ga0157372_11512596 Ga0157372_115125962 131
321 3300013308 Ga0157375_11041413 Ga0157375_110414132 131
322 3300014326 Ga0157380_10011055 Ga0157380_100110552 131
323 3300014326 Ga0157380_10038302 Ga0157380_100383024 131
324 3300014326 Ga0157380_10051886 Ga0157380_100518862 131
325 3300014745 Ga0157377_10246557 Ga0157377_102465572 131
326 3300014969 Ga0157376_10105119 Ga0157376_101051192 131
327 3300014969 Ga0157376_10133587 Ga0157376_101335872 131
328 3300014969 Ga0157376_10814479 Ga0157376_108144792 131
329 3300025885 Ga0207653_10012100 Ga0207653_100121004 131
330 3300025885 Ga0207653_10116829 Ga0207653_101168292 131
331 3300025898 Ga0207692_10462171 Ga0207692_104621712 131
332 3300025899 Ga0207642_10028143 Ga0207642_100281432 131
333 3300025901 Ga0207688_10793980 Ga0207688_107939801 131
334 3300025907 Ga0207645_10058527 Ga0207645_100585272 131
335 3300025908 Ga0207643_10055492 Ga0207643_100554922 131
336 3300025908 Ga0207643_10073660 Ga0207643_100736602 131
337 3300025908 Ga0207643_10129279 Ga0207643_101292792 131
338 3300025911 Ga0207654_10323293 Ga0207654_103232931 131
339 3300025912 Ga0207707_10580787 Ga0207707_105807872 131
340 3300025916 Ga0207663_11270701 Ga0207663_112707011 131
341 3300025917 Ga0207660_10061693 Ga0207660_100616933 131
342 3300025917 Ga0207660_10201382 Ga0207660_102013822 131
343 3300025917 Ga0207660_10234177 Ga0207660_102341772 131
344 3300025917 Ga0207660_11418754 Ga0207660_114187542 131
345 3300025918 Ga0207662_10000110 Ga0207662_1000011038 131
346 3300025918 Ga0207662_10210781 Ga0207662_102107812 131
347 3300025921 Ga0207652_10105016 Ga0207652_101050163 131
348 3300025922 Ga0207646_10352686 Ga0207646_103526862 131
349 3300025922 Ga0207646_10651153 Ga0207646_106511532 131
350 3300025926 Ga0207659_10024907 Ga0207659_100249073 131
351 3300025926 Ga0207659_10533073 Ga0207659_105330732 131
352 3300025927 Ga0207687_10027468 Ga0207687_100274682 131
353 3300025929 Ga0207664_10210879 Ga0207664_102108792 131
354 3300025931 Ga0207644_10485751 Ga0207644_104857512 131
355 3300025933 Ga0207706_10519113 Ga0207706_105191132 131
356 3300025933 Ga0207706_10915187 Ga0207706_109151871 131
357 3300025935 Ga0207709_10003963 Ga0207709_100039634 131
358 3300025936 Ga0207670_10001969 Ga0207670_100019693 131
359 3300025936 Ga0207670_10081697 Ga0207670_100816972 131
360 3300025936 Ga0207670_10102930 Ga0207670_101029303 131
361 3300025936 Ga0207670_10278294 Ga0207670_102782942 131
362 3300025936 Ga0207670_10915875 Ga0207670_109158752 131
363 3300025938 Ga0207704_10002884 Ga0207704_100028842 131
364 3300025938 Ga0207704_10305933 Ga0207704_103059333 131
365 3300025939 Ga0207665_10655714 Ga0207665_106557142 131
366 3300025939 Ga0207665_10897017 Ga0207665_108970172 131
367 3300025940 Ga0207691_10234423 Ga0207691_102344232 131
368 3300025942 Ga0207689_10006996 Ga0207689_100069963 131
369 3300025942 Ga0207689_10056573 Ga0207689_100565734 131
370 3300025949 Ga0207667_10044504 Ga0207667_100445043 131
371 3300025949 Ga0207667_10488260 Ga0207667_104882602 131
372 3300025960 Ga0207651_10165724 Ga0207651_101657242 131
373 3300025960 Ga0207651_10355994 Ga0207651_103559942 131
374 3300025981 Ga0207640_10124454 Ga0207640_101244543 131
375 3300025981 Ga0207640_11934422 Ga0207640_119344222 131
376 3300026023 Ga0207677_10047524 Ga0207677_100475242 131
377 3300026023 Ga0207677_10659034 Ga0207677_106590342 131
378 3300026035 Ga0207703_10045480 Ga0207703_100454803 131
379 3300026075 Ga0207708_10006584 Ga0207708_100065843 131
380 3300026075 Ga0207708_10187933 Ga0207708_101879332 131
381 3300026078 Ga0207702_10388489 Ga0207702_103884892 131
382 3300026088 Ga0207641_10467913 Ga0207641_104679132 131
383 3300026088 Ga0207641_10659087 Ga0207641_106590872 131
384 3300026089 Ga0207648_10001025 Ga0207648_100010256 131
385 3300026089 Ga0207648_10029600 Ga0207648_100296004 131
386 3300026089 Ga0207648_11309733 Ga0207648_113097332 131
387 3300026095 Ga0207676_10027624 Ga0207676_100276243 131
388 3300026116 Ga0207674_10287035 Ga0207674_102870352 131
389 3300026118 Ga0207675_100005378 Ga0207675_10000537812 131
390 3300026118 Ga0207675_100005981 Ga0207675_1000059816 131
391 3300026118 Ga0207675_100134757 Ga0207675_1001347572 131
392 3300026118 Ga0207675_100296453 Ga0207675_1002964532 131
393 3300026121 Ga0207683_10567092 Ga0207683_105670922 131
394 3300026142 Ga0207698_11423686 Ga0207698_114236862 131
395 3300027360 Ga0209969_1029605 Ga0209969_10296052 131
396 3300027364 Ga0209967_1000306 Ga0209967_10003061 131
397 3300027378 Ga0209981_1005511 Ga0209981_10055112 131
398 3300027462 Ga0210000_1005821 Ga0210000_10058212 131
399 3300027462 Ga0210000_1008946 Ga0210000_10089462 131
400 3300027471 Ga0209995_1016044 Ga0209995_10160442 131
401 3300027471 Ga0209995_1061830 Ga0209995_10618302 131
402 3300027543 Ga0209999_1009943 Ga0209999_10099432 131
403 3300027543 Ga0209999_1019295 Ga0209999_10192952 131
404 3300027671 Ga0209588_1015516 Ga0209588_10155163 131
405 3300027682 Ga0209971_1020839 Ga0209971_10208392 131
406 3300027695 Ga0209966_1006695 Ga0209966_10066952 131
407 3300027907 Ga0207428_10155375 Ga0207428_101553752 131
408 3300027907 Ga0207428_10232569 Ga0207428_102325692 131
409 3300028380 Ga0268265_10041489 Ga0268265_100414893 131
410 3300028380 Ga0268265_10483989 Ga0268265_104839892 131
411 3300028380 Ga0268265_10763644 Ga0268265_107636442 131
412 3300028381 Ga0268264_10059685 Ga0268264_100596852 131
413 3300028381 Ga0268264_11426392 Ga0268264_114263922 131
414 3300031548 Ga0307408_100323497 Ga0307408_1003234972 131
415 3300031548 Ga0307408_101388735 Ga0307408_1013887352 131
416 3300031691 Ga0316579_10005614 Ga0316579_100056145 131
417 3300031731 Ga0307405_10313158 Ga0307405_103131582 131
418 3300031731 Ga0307405_11355342 Ga0307405_113553422 131
419 3300031824 Ga0307413_10419453 Ga0307413_104194532 131
420 3300031852 Ga0307410_10972283 Ga0307410_109722832 131
421 3300031911 Ga0307412_10082296 Ga0307412_100822962 131
422 3300031911 Ga0307412_10624557 Ga0307412_106245572 131
423 3300031995 Ga0307409_100120641 Ga0307409_1001206414 131
424 3300031995 Ga0307409_101974181 Ga0307409_1019741812 131
425 3300032002 Ga0307416_100150202 Ga0307416_1001502022 131
426 3300032002 Ga0307416_100259564 Ga0307416_1002595642 131
427 3300032002 Ga0307416_100338885 Ga0307416_1003388852 131
428 3300032002 Ga0307416_100540611 Ga0307416_1005406112 131
429 3300032002 Ga0307416_100683485 Ga0307416_1006834852 131
430 3300032002 Ga0307416_101687942 Ga0307416_1016879422 131
431 3300032002 Ga0307416_102390712 Ga0307416_1023907122 131
432 3300032005 Ga0307411_10513741 Ga0307411_105137412 131
433 3300032133 Ga0316583_10017222 Ga0316583_100172224 131
434 3300032133 Ga0316583_10088371 Ga0316583_100883712 131
435 3300034957 Ga0373938_0083255 Ga0373938_0083255_348_743 131
436 3300034957 Ga0373938_0101291 Ga0373938_0101291_283_678 131
437 3300035083 Ga0373926_0001668 Ga0373926_0001668_6238_6633 131
438 3300035084 Ga0373928_0114796 Ga0373928_0114796_72_467 131
439 3300035085 Ga0373929_0241720 Ga0373929_0241720_103_507 131
440 3300035088 Ga0373940_0003072 Ga0373940_0003072_1254_1649 131
441 3300035089 Ga0373944_0010854 Ga0373944_0010854_662_1057 131
442 3300035090 Ga0373949_0020008 Ga0373949_0020008_553_948 131
443 3300035090 Ga0373949_0086592 Ga0373949_0086592_267_662 131
444 3300035091 Ga0373951_0012149 Ga0373951_0012149_980_1375 131
445 3300035092 Ga0373952_0002445 Ga0373952_0002445_1466_1861 131
446 3300035111 Ga0373923_0054740 Ga0373923_0054740_160_564 131
447 3300035111 Ga0373923_0163207 Ga0373923_0163207_509_904 131
448 3300035112 Ga0373932_0006117 Ga0373932_0006117_692_1087 131
449 3300035112 Ga0373932_0114064 Ga0373932_0114064_76_471 131
450 3300035112 Ga0373932_0196321 Ga0373932_0196321_182_577 131
451 3300035113 Ga0373936_0086985 Ga0373936_0086985_649_1044 131
452 3300035113 Ga0373936_0370277 Ga0373936_0370277_122_517 131
453 3300035114 Ga0373939_0002793 Ga0373939_0002793_246_641 131
454 3300035114 Ga0373939_0075738 Ga0373939_0075738_94_498 131
455 3300035115 Ga0373941_0009434 Ga0373941_0009434_478_873 131
456 3300035115 Ga0373941_0141188 Ga0373941_0141188_260_655 131
457 3300035115 Ga0373941_0267043 Ga0373941_0267043_228_623 131
458 3300035116 Ga0373945_0003844 Ga0373945_0003844_657_1052 131
459 3300035117 Ga0373953_0053659 Ga0373953_0053659_248_643 131
460 3300035118 Ga0373954_0000028 Ga0373954_0000028_41366_41761 131
461 3300035119 Ga0373956_0068551 Ga0373956_0068551_1192_1587 131
462 3300035121 Ga0373960_0014621 Ga0373960_0014621_622_1017 131
463 3300035121 Ga0373960_0047523 Ga0373960_0047523_62_457 131
464 3300035121 Ga0373960_0353600 Ga0373960_0353600_110_535 131
465 3300035170 Ga0373943_0056794 Ga0373943_0056794_294_689 131
466 3300035170 Ga0373943_0069707 Ga0373943_0069707_667_1062 131
467 3300035171 Ga0373946_0008098 Ga0373946_0008098_825_1220 131
468 3300035171 Ga0373946_0035782 Ga0373946_0035782_967_1362 131
469 3300035172 Ga0373955_0009467 Ga0373955_0009467_274_678 131
470 3300035172 Ga0373955_0040471 Ga0373955_0040471_1943_2338 131
471 3300035207 Ga0373942_0089602 Ga0373942_0089602_107_511 131
472 3300035207 Ga0373942_0097501 Ga0373942_0097501_58_453 131
473 3300035241 Ga0373961_0009409 Ga0373961_0009409_1148_1543 131
474 3300035241 Ga0373961_0058152 Ga0373961_0058152_298_702 131
475 3300035241 Ga0373961_0415760 Ga0373961_0415760_57_455 131
476 3300035410 Ga0373924_0117818 Ga0373924_0117818_312_716 131
477 3300035410 Ga0373924_0192973 Ga0373924_0192973_10_405 131
478 3300035410 Ga0373924_0259368 Ga0373924_0259368_160_555 131
479 3300035691 Ga0373931_0001811 Ga0373931_0001811_8842_9237 131
480 3300035691 Ga0373931_0062651 Ga0373931_0062651_1424_1828 131
481 3300035691 Ga0373931_0103402 Ga0373931_0103402_270_665 131
482 3300035691 Ga0373931_0257773 Ga0373931_0257773_79_477 131
483 3300035691 Ga0373931_0271663 Ga0373931_0271663_212_607 131
484 3300035691 Ga0373931_1194730 Ga0373931_1194730_22_447 131
485 3300035692 Ga0373935_0016908 Ga0373935_0016908_2305_2700 131
486 3300035695 Ga0373927_0010069 Ga0373927_0010069_1816_2211 131
487 3300035724 Ga0373933_0023783 Ga0373933_0023783_634_1038 131
488 3300035724 Ga0373933_0024952 Ga0373933_0024952_2461_2856 131
489 3300035725 Ga0373947_0031901 Ga0373947_0031901_345_740 131
490 3300035725 Ga0373947_0102081 Ga0373947_0102081_677_1072 131
491 3300035725 Ga0373947_0918492 Ga0373947_0918492_28_423 131
492 3300035725 Ga0373947_1062996 Ga0373947_1062996_124_528 131
493 3300036401 Ga0373937_0001199 Ga0373937_0001199_4266_4661 131
494 3300036401 Ga0373937_0043315 Ga0373937_0043315_1192_1596 131
495 3300037068 Ga0373925_0021316 Ga0373925_0021316_661_1056 131
496 3300037588 Ga0316581_0075503 Ga0316581_0075503_102_527 131
497 3300041406 Ga0439439_0148895 Ga0439439_0148895_11_406 131
498 3300041408 Ga0439453_0001076 Ga0439453_0001076_764_1159 131
499 3300041486 Ga0451807_0627795 Ga0451807_0627795_1503_1907 131
500 3300041997 Ga0439431_0093512 Ga0439431_0093512_89_484 131
501 3300041999 Ga0439433_0126486 Ga0439433_0126486_229_624 131
502 3300042013 Ga0439456_048392 Ga0439456_048392_244_639 131
503 3300042157 Ga0439458_0095305 Ga0439458_0095305_319_714 131
504 3300042435 Ga0439434_0005692 Ga0439434_0005692_259_654 131
505 3300042436 Ga0439435_0001116 Ga0439435_0001116_3994_4389 131
506 3300042436 Ga0439435_0063885 Ga0439435_0063885_561_956 131
507 3300042436 Ga0439435_0101712 Ga0439435_0101712_101_514 131
508 3300042437 Ga0439444_0003523 Ga0439444_0003523_1468_1863 131
509 3300042437 Ga0439444_0057543 Ga0439444_0057543_153_548 131
510 3300042461 Ga0439460_0000526 Ga0439460_0000526_7459_7854 131
511 3300042531 Ga0450918_037022 Ga0450918_037022_340_735 131
512 3300042532 Ga0450893_0044890 Ga0450893_0044890_204_605 131
513 3300042876 Ga0451577_0193255 Ga0451577_0193255_92_487 131
514 3300042876 Ga0451577_1765589 Ga0451577_1765589_105_500 131
515 3300044673 Ga0453683_0481556 Ga0453683_0481556_291_698 131
516 3300044673 Ga0453683_1152746 Ga0453683_1152746_80_493 131
517 3300044706 Ga0466964_0916964 Ga0466964_0916964_46_447 131
518 3300044901 Ga0466960_0374563 Ga0466960_0374563_289_684 131
519 3300045051 Ga0451576_0009574 Ga0451576_0009574_105_500 131
520 3300045051 Ga0451576_0026461 Ga0451576_0026461_522_917 131
521 3300045051 Ga0451576_0050035 Ga0451576_0050035_713_1108 131
522 3300045051 Ga0451576_0111234 Ga0451576_0111234_198_611 131
523 3300045051 Ga0451576_0130916 Ga0451576_0130916_1697_2092 131
524 3300045051 Ga0451576_0132216 Ga0451576_0132216_1373_1768 131
525 3300045051 Ga0451576_0468176 Ga0451576_0468176_680_1087 131
526 3300045051 Ga0451576_1125936 Ga0451576_1125936_193_591 131
527 3300045051 Ga0451576_1306375 Ga0451576_1306375_320_715 131
528 3300045051 Ga0451576_1739017 Ga0451576_1739017_96_491 131
529 3300045836 Ga0466958_0184619 Ga0466958_0184619_351_746 131
530 3300045976 Ga0466967_0001877 Ga0466967_0001877_2470_2865 131
531 3300046454 Ga0495592_0583919 Ga0495592_0583919_50_454 131
532 3300046455 Ga0495603_0075190 Ga0495603_0075190_494_889 131
533 3300046462 Ga0495651_0260646 Ga0495651_0260646_531_926 131
534 3300046472 Ga0495580_0022250 Ga0495580_0022250_4035_4430 131
535 3300046475 Ga0495639_0032900 Ga0495639_0032900_1153_1548 131
536 3300046477 Ga0495664_0137853 Ga0495664_0137853_934_1338 131
537 3300046499 Ga0495594_0061586 Ga0495594_0061586_1496_1891 131
538 3300046511 Ga0495608_0203145 Ga0495608_0203145_668_1063 131
539 3300046516 Ga0495628_1214818 Ga0495628_1214818_12_416 131
540 3300046526 Ga0495666_0022861 Ga0495666_0022861_521_916 131
541 3300046531 Ga0495665_0176962 Ga0495665_0176962_71_466 131
542 3300046535 Ga0495586_0009470 Ga0495586_0009470_2468_2863 131
543 3300046537 Ga0495598_0254348 Ga0495598_0254348_130_525 131
544 3300046538 Ga0495609_0444313 Ga0495609_0444313_61_456 131
545 3300046539 Ga0495621_0186669 Ga0495621_0186669_192_590 131
546 3300046539 Ga0495621_0236985 Ga0495621_0236985_169_564 131
547 3300046559 Ga0495667_0186941 Ga0495667_0186941_590_994 131
548 3300046615 Ga0495656_0152189 Ga0495656_0152189_709_1104 131
549 3300046663 Ga0495635_0432834 Ga0495635_0432834_226_630 131
550 3300046664 Ga0495659_0023464 Ga0495659_0023464_203_598 131
551 3300046674 Ga0495588_0050293 Ga0495588_0050293_618_1013 131
552 3300046675 Ga0495657_0084499 Ga0495657_0084499_808_1203 131
553 3300046679 Ga0495623_0531752 Ga0495623_0531752_84_479 131
554 3300046681 Ga0495647_0000776 Ga0495647_0000776_8077_8472 131
555 3300046683 Ga0495658_0103694 Ga0495658_0103694_853_1248 131
556 3300046684 Ga0495669_0122826 Ga0495669_0122826_681_1076 131
557 3300047317 Ga0495604_0441724 Ga0495604_0441724_68_463 131
558 3300047317 Ga0495604_0723344 Ga0495604_0723344_160_564 131
559 3300047318 Ga0495636_0542830 Ga0495636_0542830_123_536 131
560 3300047319 Ga0495674_0353399 Ga0495674_0353399_115_519 131
561 3300047321 Ga0495676_0516363 Ga0495676_0516363_225_620 131
562 3300047322 Ga0495680_0101441 Ga0495680_0101441_770_1174 131
563 3300047444 Ga0495675_0262560 Ga0495675_0262560_523_918 131
564 3300049521 Ga0501298_108933 Ga0501298_108933_119_514 131
565 3300049522 Ga0501299_028701 Ga0501299_028701_636_1031 131
566 3300049522 Ga0501299_209041 Ga0501299_209041_101_496 131
567 3300049568 Ga0501031_0100824 Ga0501031_0100824_900_1295 131
568 3300049568 Ga0501031_0547852 Ga0501031_0547852_194_589 131
569 3300049570 Ga0501033_0777852 Ga0501033_0777852_161_556 131
570 3300049572 Ga0501036_0097488 Ga0501036_0097488_143_538 131
571 3300049572 Ga0501036_0480845 Ga0501036_0480845_26_421 131
572 3300049572 Ga0501036_1113491 Ga0501036_1113491_119_514 131
573 3300049572 Ga0501036_1698377 Ga0501036_1698377_20_415 131
574 3300049573 Ga0501037_0554453 Ga0501037_0554453_14_409 131
575 3300049574 Ga0501038_0648140 Ga0501038_0648140_269_664 131
576 3300049574 Ga0501038_1138075 Ga0501038_1138075_87_482 131
577 3300049575 Ga0501039_0041323 Ga0501039_0041323_698_1093 131
578 3300049575 Ga0501039_0075897 Ga0501039_0075897_1581_1976 131
579 3300049575 Ga0501039_0082947 Ga0501039_0082947_1041_1436 131
580 3300049576 Ga0501040_0030565 Ga0501040_0030565_2335_2730 131
581 3300049576 Ga0501040_0136343 Ga0501040_0136343_484_879 131
582 3300049576 Ga0501040_0203466 Ga0501040_0203466_223_618 131
583 3300049577 Ga0501041_0125174 Ga0501041_0125174_620_1015 131
584 3300049577 Ga0501041_0476101 Ga0501041_0476101_215_610 131
585 3300049578 Ga0501042_0120236 Ga0501042_0120236_893_1288 131
586 3300049578 Ga0501042_0358663 Ga0501042_0358663_268_663 131
587 3300049578 Ga0501042_0418088 Ga0501042_0418088_320_715 131
588 3300049579 Ga0501043_0338490 Ga0501043_0338490_637_1032 131
589 3300049580 Ga0501046_0207868 Ga0501046_0207868_738_1133 131
590 3300049580 Ga0501046_0789840 Ga0501046_0789840_189_596 131
591 3300049582 Ga0501048_0046947 Ga0501048_0046947_2143_2538 131
592 3300049582 Ga0501048_0208786 Ga0501048_0208786_628_1023 131
593 3300049582 Ga0501048_0596671 Ga0501048_0596671_199_594 131
594 3300049584 Ga0501068_0690709 Ga0501068_0690709_52_447 131
595 3300049585 Ga0501069_0631699 Ga0501069_0631699_78_473 131
596 3300049586 Ga0501070_1059041 Ga0501070_1059041_168_563 131
597 3300049587 Ga0501071_0322060 Ga0501071_0322060_477_872 131
598 3300049587 Ga0501071_0408595 Ga0501071_0408595_99_494 131
599 3300049587 Ga0501071_1537671 Ga0501071_1537671_40_435 131
600 3300049588 Ga0501072_0136067 Ga0501072_0136067_1191_1586 131
601 3300049588 Ga0501072_0409190 Ga0501072_0409190_56_451 131
602 3300049588 Ga0501072_0452321 Ga0501072_0452321_519_914 131
603 3300049588 Ga0501072_0589166 Ga0501072_0589166_350_745 131
604 3300049588 Ga0501072_0928142 Ga0501072_0928142_154_549 131
605 3300049590 Ga0501074_0171059 Ga0501074_0171059_217_612 131
606 3300049590 Ga0501074_0651862 Ga0501074_0651862_277_672 131
607 3300049591 Ga0501075_0023756 Ga0501075_0023756_2636_3031 131
608 3300049591 Ga0501075_0990944 Ga0501075_0990944_163_558 131
609 3300049592 Ga0501076_0131949 Ga0501076_0131949_938_1333 131
610 3300049592 Ga0501076_0485268 Ga0501076_0485268_324_719 131
611 3300049592 Ga0501076_0597789 Ga0501076_0597789_340_735 131
612 3300049593 Ga0501077_0286710 Ga0501077_0286710_553_948 131
613 3300049656 Ga0501209_149947 Ga0501209_149947_241_636 131
614 3300049668 Ga0501233_025851 Ga0501233_025851_638_1033 131
615 3300049705 Ga0501225_0064879 Ga0501225_0064879_442_837 131
616 3300049741 Ga0501079_0139368 Ga0501079_0139368_211_606 131
617 3300049741 Ga0501079_0424736 Ga0501079_0424736_377_772 131
618 3300049741 Ga0501079_1047708 Ga0501079_1047708_92_487 131
619 3300049743 Ga0501081_0067853 Ga0501081_0067853_2000_2395 131
620 3300049743 Ga0501081_0388225 Ga0501081_0388225_440_835 131
621 3300049744 Ga0501083_0806542 Ga0501083_0806542_146_541 131
622 3300049822 Ga0501035_1464312 Ga0501035_1464312_46_441 131
623 3300049824 Ga0501045_0012663 Ga0501045_0012663_2192_2587 131
624 3300049824 Ga0501045_0157129 Ga0501045_0157129_788_1183 131
625 3300049824 Ga0501045_0589161 Ga0501045_0589161_227_622 131
626 3300049850 Ga0501204_051297 Ga0501204_051297_114_509 131
627 3300050507 nmdc:mga05p37_1414500_c1 nmdc:mga05p37_1414500_c1_13_408 131
628 3300050507 nmdc:mga05p37_28485_c1 nmdc:mga05p37_28485_c1_1249_1644 131
629 3300050507 nmdc:mga05p37_445_c1 nmdc:mga05p37_445_c1_6253_6666 131
630 3300050507 nmdc:mga05p37_479260_c1 nmdc:mga05p37_479260_c1_217_612 131
631 3300050507 nmdc:mga05p37_515766_c1 nmdc:mga05p37_515766_c1_311_706 131
632 3300050507 nmdc:mga05p37_712_c1 nmdc:mga05p37_712_c1_10675_11070 131
633 3300050507 nmdc:mga05p37_971965_c1 nmdc:mga05p37_971965_c1_143_538 131
634 3300050508 nmdc:mga09592_102197_c1 nmdc:mga09592_102197_c1_633_1028 131
635 3300050508 nmdc:mga09592_116376_c1 nmdc:mga09592_116376_c1_1304_1699 131
636 3300050508 nmdc:mga09592_118_c1 nmdc:mga09592_118_c1_38740_39153 131
637 3300050508 nmdc:mga09592_134796_c1 nmdc:mga09592_134796_c1_1282_1677 131
638 3300050508 nmdc:mga09592_1745376_c1 nmdc:mga09592_1745376_c1_95_490 131
639 3300050508 nmdc:mga09592_496_c1 nmdc:mga09592_496_c1_9853_10248 131
640 3300050509 nmdc:mga0qj67_654625_c1 nmdc:mga0qj67_654625_c1_228_623 131
641 3300050509 nmdc:mga0qj67_779477_c1 nmdc:mga0qj67_779477_c1_284_679 131
642 3300050510 nmdc:mga06r32_17949_c1 nmdc:mga06r32_17949_c1_1472_1885 131
643 3300050510 nmdc:mga06r32_18701_c1 nmdc:mga06r32_18701_c1_2961_3374 131
644 3300050510 nmdc:mga06r32_209471_c1 nmdc:mga06r32_209471_c1_535_930 131
645 3300050510 nmdc:mga06r32_60743_c1 nmdc:mga06r32_60743_c1_1491_1886 131
646 3300050510 nmdc:mga06r32_835358_c1 nmdc:mga06r32_835358_c1_322_717 131
647 3300050511 nmdc:mga08y16_162923_c1 nmdc:mga08y16_162923_c1_1531_1926 131
648 3300050511 nmdc:mga08y16_32621_c1 nmdc:mga08y16_32621_c1_1398_1793 131
649 3300050511 nmdc:mga08y16_34152_c1 nmdc:mga08y16_34152_c1_609_1004 131
650 3300050511 nmdc:mga08y16_612669_c1 nmdc:mga08y16_612669_c1_175_570 131
651 3300050512 nmdc:mga0n895_1108_c1 nmdc:mga0n895_1108_c1_8365_8760 131
652 3300050512 nmdc:mga0n895_1527_c1 nmdc:mga0n895_1527_c1_13564_13959 131
653 3300050512 nmdc:mga0n895_39818_c1 nmdc:mga0n895_39818_c1_2663_3103 131
654 3300050513 nmdc:mga0rr50_2902_c1 nmdc:mga0rr50_2902_c1_5359_5754 131
655 3300050513 nmdc:mga0rr50_37680_c1 nmdc:mga0rr50_37680_c1_1623_2018 131
656 3300050514 nmdc:mga08x19_1007480_c1 nmdc:mga08x19_1007480_c1_80_475 131
657 3300050514 nmdc:mga08x19_106982_c1 nmdc:mga08x19_106982_c1_471_866 131
658 3300050514 nmdc:mga08x19_1218441_c1 nmdc:mga08x19_1218441_c1_65_490 131
659 3300050514 nmdc:mga08x19_16842_c1 nmdc:mga08x19_16842_c1_2799_3197 131
660 3300050514 nmdc:mga08x19_176432_c1 nmdc:mga08x19_176432_c1_408_803 131
661 3300050514 nmdc:mga08x19_264418_c1 nmdc:mga08x19_264418_c1_401_796 131
662 3300050514 nmdc:mga08x19_639_c2 nmdc:mga08x19_639_c2_4617_5012 131
663 3300050514 nmdc:mga08x19_7012_c1 nmdc:mga08x19_7012_c1_865_1260 131
664 3300050515 nmdc:mga0a205_165465_c1 nmdc:mga0a205_165465_c1_1089_1484 131
665 3300050515 nmdc:mga0a205_189685_c1 nmdc:mga0a205_189685_c1_1498_1893 131
666 3300050515 nmdc:mga0a205_2500_c1 nmdc:mga0a205_2500_c1_8349_8744 131
667 3300050515 nmdc:mga0a205_600391_c1 nmdc:mga0a205_600391_c1_471_866 131
668 3300050515 nmdc:mga0a205_659087_c1 nmdc:mga0a205_659087_c1_293_688 131
669 3300050515 nmdc:mga0a205_75085_c1 nmdc:mga0a205_75085_c1_1988_2383 131
670 3300054114 Ga0501084_0042590 Ga0501084_0042590_3247_3642 131
671 3300054114 Ga0501084_0673225 Ga0501084_0673225_451_846 131
672 3300054114 Ga0501084_0750330 Ga0501084_0750330_412_807 131
673 3300054114 Ga0501084_1311624 Ga0501084_1311624_196_591 131
674 3300059421 Ga0590071_065313 Ga0590071_065313_388_783 131
675 3300059426 Ga0590077_020785 Ga0590077_020785_896_1291 131
676 3300060353 Ga0501082_0332696 Ga0501082_0332696_625_1020 131
677 3300061734 Ga0530510_0114121 Ga0530510_0114121_165_560 131
678 3300061734 Ga0530510_0251986 Ga0530510_0251986_862_1257 131

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

59

136

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zki-assembly1.cif.gz_B structure of conserved protein pa5202 from pseudomonas aeruginosa 0.9508 12 129
3dkz-assembly1.cif.gz_A crystal structure of the q7w9w5_borpa protein from bordetella parapertussis. northeast structural genomics consortium target bpr208c. 0.9454 12 128
3nwz-assembly2.cif.gz_C crystal structure of bh2602 protein from bacillus halodurans with coa, northeast structural genomics consortium target bhr199 0.9417 31 128
3nwz-assembly3.cif.gz_D crystal structure of bh2602 protein from bacillus halodurans with coa, northeast structural genomics consortium target bhr199 0.9381 32 128
3gek-assembly2.cif.gz_A crystal structure of putative thioesterase yhda from lactococcus lactis. northeast structural genomics consortium target kr113 0.9282 29 129
ID Description Score Start End Superfamily
1zkiB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9483 12 129 3.10.129.10
3dkzB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9431 12 128 3.10.129.10
3nwzD00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9216 32 128 3.10.129.10
af_Q9M2E4_49_183_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9175 20 128 3.10.129.10
af_A0A1D6F200_19_155_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9156 19 131 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A522VK87-F1-model_v4 PaaI family thioesterase 0.9891 1 131 GO:0016790
AF-A0A522VK87-F1-model_v4 PaaI family thioesterase 0.9816 1 131 GO:0016790
AF-A0A3B8X8Z3-F1-model_v4 PaaI family thioesterase 0.9768 1 130 GO:0016289
AF-A0A2V7CWB0-F1-model_v4 Phenylacetic acid degradation protein 0.9752 1 131
AF-A0A843SGM2-F1-model_v4 PaaI family thioesterase 0.9752 2 131 GO:0016790

Feature Viewer

pLDDT pTM Quality
95.78 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map