F474687
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 678 | 298 | 678 | 131 |
Family's Representative Sequence
| Representative Sequence | 3300050512|nmdc:mga0n895_39818_c1|nmdc:mga0n895_39818_c1_2663_3103 |
| Length | 146 |
| Sequence | VHRRRRSDRNGCRINLKTQLQELLDRARFLRPWGFRVVAADKRKCTLELPHKPALERPGGIINGPALMAAADCAMWLAIKARIGVEGDALTSELNTAFLAPARGEHVYCTARILKMGRRRIYGTAECHGRKGNLFSHHTLTYVRTG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 2 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 3 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 4 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 5 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 56 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 60 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 61 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 62 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 63 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 64 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 65 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 66 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 69 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 82 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 143 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 146 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 147 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 148 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 149 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 150 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 151 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 152 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 153 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 154 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 155 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 156 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 157 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 158 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 159 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 160 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 161 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 162 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 163 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 164 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 165 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 166 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 168 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 169 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 170 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 171 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 172 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 173 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 174 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 176 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 177 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 178 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 180 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 181 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 182 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 183 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 184 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 185 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 186 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 187 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 190 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 191 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 192 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 193 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 194 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 195 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 196 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 197 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 198 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 199 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 200 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 201 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 202 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 203 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 204 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 205 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 206 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 207 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 208 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 209 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 210 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 248 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 249 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 274 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 275 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 276 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 283 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 296 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 297 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.15 |
| Rhizosphere | 99.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070690_100392717 | 3300005330 | Bacteria | 1017 |
| 2 | Ga0070690_100450105 | 3300005330 | Bacteria | 955 |
| 3 | Ga0068869_100043804 | 3300005334 | Bacteria | 3216 |
| 4 | Ga0068869_100162448 | 3300005334 | Bacteria | 1739 |
| 5 | Ga0070680_100023291 | 3300005336 | Bacteria | 4938 |
| 6 | Ga0070680_100053775 | 3300005336 | Bacteria | 3286 |
| 7 | Ga0070680_100085806 | 3300005336 | Bacteria | 2601 |
| 8 | Ga0068868_100003297 | 3300005338 | Bacteria | 11228 |
| 9 | Ga0068868_100278957 | 3300005338 | Bacteria | 1414 |
| 10 | Ga0068868_100655748 | 3300005338 | Bacteria | 935 |
| 11 | Ga0070689_100070658 | 3300005340 | Bacteria | 2726 |
| 12 | Ga0070689_100297526 | 3300005340 | Bacteria | 1343 |
| 13 | Ga0070689_100334371 | 3300005340 | Bacteria | 1268 |
| 14 | Ga0070689_100647650 | 3300005340 | Bacteria | 919 |
| 15 | Ga0070689_100769563 | 3300005340 | Bacteria | 845 |
| 16 | Ga0070691_10016874 | 3300005341 | Bacteria | 3358 |
| 17 | Ga0070691_10670221 | 3300005341 | Bacteria | 620 |
| 18 | Ga0070687_100001183 | 3300005343 | Bacteria | 9042 |
| 19 | Ga0070687_100481459 | 3300005343 | Bacteria | 832 |
| 20 | Ga0070692_10005023 | 3300005345 | Bacteria | 5592 |
| 21 | Ga0070692_10042596 | 3300005345 | Bacteria | 2332 |
| 22 | Ga0070692_10072867 | 3300005345 | Bacteria | 1833 |
| 23 | Ga0070668_100083706 | 3300005347 | Bacteria | 2504 |
| 24 | Ga0070669_100014286 | 3300005353 | Bacteria | 5650 |
| 25 | Ga0070669_100293037 | 3300005353 | Bacteria | 1307 |
| 26 | Ga0070669_100988672 | 3300005353 | Bacteria | 721 |
| 27 | Ga0070675_100064647 | 3300005354 | Bacteria | 3025 |
| 28 | Ga0070675_100669291 | 3300005354 | Bacteria | 944 |
| 29 | Ga0070675_100672136 | 3300005354 | Bacteria | 942 |
| 30 | Ga0070671_100225462 | 3300005355 | Bacteria | 1590 |
| 31 | Ga0070671_100414599 | 3300005355 | Bacteria | 1153 |
| 32 | Ga0070671_100608297 | 3300005355 | Bacteria | 945 |
| 33 | Ga0070674_101575343 | 3300005356 | Bacteria | 592 |
| 34 | Ga0070673_100267659 | 3300005364 | Bacteria | 1495 |
| 35 | Ga0070673_100331255 | 3300005364 | Bacteria | 1347 |
| 36 | Ga0070673_100758394 | 3300005364 | Bacteria | 894 |
| 37 | Ga0070688_100039334 | 3300005365 | Bacteria | 2893 |
| 38 | Ga0070688_100743372 | 3300005365 | Bacteria | 763 |
| 39 | Ga0070688_101607078 | 3300005365 | Bacteria | 531 |
| 40 | Ga0070703_10160872 | 3300005406 | Bacteria | 852 |
| 41 | Ga0070710_10183223 | 3300005437 | Bacteria | 1312 |
| 42 | Ga0070701_10013032 | 3300005438 | Bacteria | 3772 |
| 43 | Ga0070711_100410830 | 3300005439 | Bacteria | 1101 |
| 44 | Ga0070711_100930807 | 3300005439 | Bacteria | 743 |
| 45 | Ga0070705_100002410 | 3300005440 | Bacteria | 9407 |
| 46 | Ga0070705_100219092 | 3300005440 | Bacteria | 1317 |
| 47 | Ga0070705_100436759 | 3300005440 | Bacteria | 979 |
| 48 | Ga0070705_100730374 | 3300005440 | Bacteria | 781 |
| 49 | Ga0070700_100003267 | 3300005441 | Bacteria | 8351 |
| 50 | Ga0070700_100004291 | 3300005441 | Bacteria | 7445 |
| 51 | Ga0070700_100126370 | 3300005441 | Bacteria | 1720 |
| 52 | Ga0070700_100415063 | 3300005441 | Bacteria | 1016 |
| 53 | Ga0070700_101126533 | 3300005441 | Unclassified | 652 |
| 54 | Ga0070694_100015084 | 3300005444 | Bacteria | 4844 |
| 55 | Ga0070694_100030631 | 3300005444 | Bacteria | 3521 |
| 56 | Ga0070694_100093878 | 3300005444 | Bacteria | 2110 |
| 57 | Ga0070694_100313374 | 3300005444 | Bacteria | 1205 |
| 58 | Ga0070694_100339024 | 3300005444 | Bacteria | 1162 |
| 59 | Ga0070694_100496089 | 3300005444 | Bacteria | 971 |
| 60 | Ga0070694_100881369 | 3300005444 | Bacteria | 738 |
| 61 | Ga0070694_100982963 | 3300005444 | Bacteria | 700 |
| 62 | Ga0070708_100738210 | 3300005445 | Bacteria | 926 |
| 63 | Ga0070662_100501968 | 3300005457 | Bacteria | 1012 |
| 64 | Ga0070662_100962020 | 3300005457 | Bacteria | 730 |
| 65 | Ga0070681_10069603 | 3300005458 | Bacteria | 3485 |
| 66 | Ga0070681_10130057 | 3300005458 | Bacteria | 2450 |
| 67 | Ga0068867_100003301 | 3300005459 | Bacteria | 11361 |
| 68 | Ga0068867_100005090 | 3300005459 | Bacteria | 9290 |
| 69 | Ga0070685_10317553 | 3300005466 | Bacteria | 1055 |
| 70 | Ga0070706_100182610 | 3300005467 | Bacteria | 1959 |
| 71 | Ga0070707_100251262 | 3300005468 | Bacteria | 1721 |
| 72 | Ga0070707_101370211 | 3300005468 | Bacteria | 674 |
| 73 | Ga0070707_102083162 | 3300005468 | Bacteria | 535 |
| 74 | Ga0070698_100084915 | 3300005471 | Bacteria | 3153 |
| 75 | Ga0070698_100620727 | 3300005471 | Bacteria | 1022 |
| 76 | Ga0070698_100817637 | 3300005471 | Bacteria | 876 |
| 77 | Ga0070699_100105120 | 3300005518 | Bacteria | 2476 |
| 78 | Ga0070699_100286144 | 3300005518 | Bacteria | 1477 |
| 79 | Ga0070699_101477986 | 3300005518 | Bacteria | 623 |
| 80 | Ga0070679_100058786 | 3300005530 | Bacteria | 3831 |
| 81 | Ga0070684_100197257 | 3300005535 | Bacteria | 1833 |
| 82 | Ga0070684_100335744 | 3300005535 | Bacteria | 1389 |
| 83 | Ga0070697_100006226 | 3300005536 | Bacteria | 9240 |
| 84 | Ga0070697_100100419 | 3300005536 | Bacteria | 2403 |
| 85 | Ga0070686_100017279 | 3300005544 | Bacteria | 4212 |
| 86 | Ga0070686_100059064 | 3300005544 | Bacteria | 2470 |
| 87 | Ga0070686_100765078 | 3300005544 | Bacteria | 776 |
| 88 | Ga0070695_100015945 | 3300005545 | Bacteria | 4542 |
| 89 | Ga0070695_100033902 | 3300005545 | Bacteria | 3196 |
| 90 | Ga0070695_100080342 | 3300005545 | Bacteria | 2155 |
| 91 | Ga0070695_100140987 | 3300005545 | Bacteria | 1671 |
| 92 | Ga0070695_100165845 | 3300005545 | Bacteria | 1555 |
| 93 | Ga0070696_100012095 | 3300005546 | Bacteria | 5783 |
| 94 | Ga0070696_100151796 | 3300005546 | Bacteria | 1701 |
| 95 | Ga0070696_100158442 | 3300005546 | Bacteria | 1666 |
| 96 | Ga0070696_100255795 | 3300005546 | Bacteria | 1326 |
| 97 | Ga0070696_100554158 | 3300005546 | Bacteria | 921 |
| 98 | Ga0070696_101718916 | 3300005546 | Bacteria | 541 |
| 99 | Ga0070693_100001350 | 3300005547 | Bacteria | 11040 |
| 100 | Ga0070693_100062656 | 3300005547 | Bacteria | 2165 |
| 101 | Ga0070693_100273427 | 3300005547 | Bacteria | 1129 |
| 102 | Ga0070693_100646542 | 3300005547 | Bacteria | 769 |
| 103 | Ga0070704_100038400 | 3300005549 | Bacteria | 3280 |
| 104 | Ga0070704_100231403 | 3300005549 | Bacteria | 1508 |
| 105 | Ga0070704_100416412 | 3300005549 | Bacteria | 1150 |
| 106 | Ga0070704_100861017 | 3300005549 | Bacteria | 813 |
| 107 | Ga0070704_101007498 | 3300005549 | Bacteria | 754 |
| 108 | Ga0068855_100022771 | 3300005563 | Bacteria | 7508 |
| 109 | Ga0070664_101232598 | 3300005564 | Bacteria | 706 |
| 110 | Ga0068854_100056717 | 3300005578 | Bacteria | 2824 |
| 111 | Ga0068856_100101355 | 3300005614 | Bacteria | 2872 |
| 112 | Ga0068856_100315526 | 3300005614 | Bacteria | 1581 |
| 113 | Ga0070702_100000150 | 3300005615 | Bacteria | 21785 |
| 114 | Ga0070702_100100344 | 3300005615 | Bacteria | 1774 |
| 115 | Ga0068852_101697873 | 3300005616 | Bacteria | 654 |
| 116 | Ga0068859_100141587 | 3300005617 | Bacteria | 2479 |
| 117 | Ga0068859_101203378 | 3300005617 | Bacteria | 834 |
| 118 | Ga0068859_101759604 | 3300005617 | Bacteria | 684 |
| 119 | Ga0068864_100026496 | 3300005618 | Bacteria | 4889 |
| 120 | Ga0068866_10006202 | 3300005718 | Bacteria | 4976 |
| 121 | Ga0068861_100031913 | 3300005719 | Bacteria | 3874 |
| 122 | Ga0068861_100056123 | 3300005719 | Bacteria | 3005 |
| 123 | Ga0068861_100388655 | 3300005719 | Bacteria | 1235 |
| 124 | Ga0068870_10074806 | 3300005840 | Bacteria | 1857 |
| 125 | Ga0068863_100474479 | 3300005841 | Bacteria | 1229 |
| 126 | Ga0068863_100572790 | 3300005841 | Bacteria | 1116 |
| 127 | Ga0068858_100050263 | 3300005842 | Bacteria | 3858 |
| 128 | Ga0068858_100375570 | 3300005842 | Bacteria | 1364 |
| 129 | Ga0068860_100031234 | 3300005843 | Bacteria | 5121 |
| 130 | Ga0068862_100051652 | 3300005844 | Bacteria | 3516 |
| 131 | Ga0068862_100349869 | 3300005844 | Bacteria | 1371 |
| 132 | Ga0068862_102332943 | 3300005844 | Unclassified | 547 |
| 133 | Ga0081539_10000917 | 3300005985 | Bacteria | 55614 |
| 134 | Ga0070716_100505875 | 3300006173 | Bacteria | 892 |
| 135 | Ga0070716_101160223 | 3300006173 | Bacteria | 619 |
| 136 | Ga0097621_100013058 | 3300006237 | Bacteria | 6176 |
| 137 | Ga0097621_100015779 | 3300006237 | Bacteria | 5694 |
| 138 | Ga0068871_100007963 | 3300006358 | Bacteria | 7601 |
| 139 | Ga0068871_100448131 | 3300006358 | Bacteria | 1156 |
| 140 | Ga0075428_100002475 | 3300006844 | Bacteria | 20049 |
| 141 | Ga0075428_100029340 | 3300006844 | Bacteria | 6086 |
| 142 | Ga0075428_100052500 | 3300006844 | Bacteria | 4468 |
| 143 | Ga0075428_100068580 | 3300006844 | Bacteria | 3879 |
| 144 | Ga0075430_100009696 | 3300006846 | Bacteria | 8135 |
| 145 | Ga0075430_100270145 | 3300006846 | Bacteria | 1407 |
| 146 | Ga0075430_100286514 | 3300006846 | Bacteria | 1363 |
| 147 | Ga0075430_100410019 | 3300006846 | Bacteria | 1118 |
| 148 | Ga0075430_100647409 | 3300006846 | Bacteria | 871 |
| 149 | Ga0075430_101460236 | 3300006846 | Bacteria | 562 |
| 150 | Ga0075431_100003827 | 3300006847 | Bacteria | 14629 |
| 151 | Ga0075431_100063456 | 3300006847 | Bacteria | 3813 |
| 152 | Ga0075431_100113019 | 3300006847 | Bacteria | 2803 |
| 153 | Ga0075431_100115567 | 3300006847 | Bacteria | 2770 |
| 154 | Ga0075431_100195190 | 3300006847 | Bacteria | 2073 |
| 155 | Ga0075431_100224493 | 3300006847 | Bacteria | 1915 |
| 156 | Ga0075433_10003619 | 3300006852 | Bacteria | 11940 |
| 157 | Ga0075433_10058017 | 3300006852 | Bacteria | 3385 |
| 158 | Ga0075433_10088354 | 3300006852 | Bacteria | 2739 |
| 159 | Ga0075433_10530753 | 3300006852 | Bacteria | 1035 |
| 160 | Ga0075433_11507414 | 3300006852 | Bacteria | 581 |
| 161 | Ga0075434_100000003 | 3300006871 | Bacteria | 134839 |
| 162 | Ga0075434_100002400 | 3300006871 | Bacteria | 16442 |
| 163 | Ga0075434_100967170 | 3300006871 | Bacteria | 866 |
| 164 | Ga0075434_102227579 | 3300006871 | Bacteria | 551 |
| 165 | Ga0075429_100000113 | 3300006880 | Bacteria | 46474 |
| 166 | Ga0075429_100004277 | 3300006880 | Bacteria | 12251 |
| 167 | Ga0075429_100171323 | 3300006880 | Bacteria | 1901 |
| 168 | Ga0075429_100339175 | 3300006880 | Bacteria | 1316 |
| 169 | Ga0075429_100464842 | 3300006880 | Bacteria | 1108 |
| 170 | Ga0068865_100027903 | 3300006881 | Bacteria | 3734 |
| 171 | Ga0068865_100251799 | 3300006881 | Bacteria | 1394 |
| 172 | Ga0075436_100002673 | 3300006914 | Bacteria | 12256 |
| 173 | Ga0075436_100004352 | 3300006914 | Bacteria | 9719 |
| 174 | Ga0075436_100012300 | 3300006914 | Bacteria | 5863 |
| 175 | Ga0075436_100215520 | 3300006914 | Bacteria | 1362 |
| 176 | Ga0097620_100090854 | 3300006931 | Bacteria | 3104 |
| 177 | Ga0097620_100141582 | 3300006931 | Bacteria | 2479 |
| 178 | Ga0097620_101203323 | 3300006931 | Bacteria | 834 |
| 179 | Ga0097620_101759687 | 3300006931 | Bacteria | 684 |
| 180 | Ga0075435_100000265 | 3300007076 | Bacteria | 32624 |
| 181 | Ga0075435_100006583 | 3300007076 | Bacteria | 8222 |
| 182 | Ga0075435_100012648 | 3300007076 | Bacteria | 6253 |
| 183 | Ga0075435_100349880 | 3300007076 | Bacteria | 1267 |
| 184 | Ga0075435_100444030 | 3300007076 | Bacteria | 1118 |
| 185 | Ga0075435_101502036 | 3300007076 | Bacteria | 591 |
| 186 | Ga0099794_10042962 | 3300007265 | Bacteria | 2157 |
| 187 | Ga0099794_10221259 | 3300007265 | Bacteria | 972 |
| 188 | Ga0099794_10675562 | 3300007265 | Bacteria | 549 |
| 189 | Ga0111539_10040746 | 3300009094 | Bacteria | 5589 |
| 190 | Ga0111539_10043099 | 3300009094 | Bacteria | 5412 |
| 191 | Ga0111539_10053145 | 3300009094 | Bacteria | 4822 |
| 192 | Ga0111539_11524036 | 3300009094 | Bacteria | 775 |
| 193 | Ga0111539_13320185 | 3300009094 | Bacteria | 518 |
| 194 | Ga0105245_10007925 | 3300009098 | Bacteria | 9289 |
| 195 | Ga0105245_10474760 | 3300009098 | Bacteria | 1263 |
| 196 | Ga0105245_11792352 | 3300009098 | Bacteria | 667 |
| 197 | Ga0114129_10002343 | 3300009147 | Bacteria | 26291 |
| 198 | Ga0114129_10005124 | 3300009147 | Bacteria | 18449 |
| 199 | Ga0114129_10591361 | 3300009147 | Bacteria | 1439 |
| 200 | Ga0114129_10750029 | 3300009147 | Bacteria | 1250 |
| 201 | Ga0114129_11563404 | 3300009147 | Bacteria | 809 |
| 202 | Ga0105243_10002517 | 3300009148 | Bacteria | 15300 |
| 203 | Ga0105243_10011311 | 3300009148 | Bacteria | 6751 |
| 204 | Ga0105241_10018460 | 3300009174 | Bacteria | 5130 |
| 205 | Ga0105242_10045232 | 3300009176 | Bacteria | 3567 |
| 206 | Ga0105242_11052479 | 3300009176 | Bacteria | 825 |
| 207 | Ga0105242_11344288 | 3300009176 | Bacteria | 740 |
| 208 | Ga0105248_10681871 | 3300009177 | Bacteria | 1159 |
| 209 | Ga0105249_10599057 | 3300009553 | Bacteria | 1156 |
| 210 | Ga0105249_11723223 | 3300009553 | Bacteria | 699 |
| 211 | Ga0099796_10297668 | 3300010159 | Bacteria | 683 |
| 212 | Ga0105239_10054903 | 3300010375 | Bacteria | 4370 |
| 213 | Ga0105239_12368365 | 3300010375 | Bacteria | 618 |
| 214 | Ga0105246_10215792 | 3300011119 | Bacteria | 1501 |
| 215 | Ga0157323_1022974 | 3300012495 | Bacteria | 609 |
| 216 | Ga0157371_10547663 | 3300013102 | Bacteria | 857 |
| 217 | Ga0157369_11014634 | 3300013105 | Bacteria | 849 |
| 218 | Ga0157378_10044867 | 3300013297 | Bacteria | 3926 |
| 219 | Ga0157378_12000728 | 3300013297 | Bacteria | 629 |
| 220 | Ga0163162_10147320 | 3300013306 | Bacteria | 2471 |
| 221 | Ga0163162_11766392 | 3300013306 | Bacteria | 707 |
| 222 | Ga0157372_11512596 | 3300013307 | Bacteria | 773 |
| 223 | Ga0157375_11041413 | 3300013308 | Bacteria | 956 |
| 224 | Ga0157380_10011055 | 3300014326 | Bacteria | 6512 |
| 225 | Ga0157380_10038302 | 3300014326 | Bacteria | 3722 |
| 226 | Ga0157380_10051886 | 3300014326 | Bacteria | 3246 |
| 227 | Ga0157377_10246557 | 3300014745 | Bacteria | 1156 |
| 228 | Ga0157376_10105119 | 3300014969 | Bacteria | 2475 |
| 229 | Ga0157376_10133587 | 3300014969 | Bacteria | 2217 |
| 230 | Ga0157376_10814479 | 3300014969 | Bacteria | 947 |
| 231 | Ga0207653_10012100 | 3300025885 | Bacteria | 2692 |
| 232 | Ga0207653_10116829 | 3300025885 | Bacteria | 957 |
| 233 | Ga0207692_10462171 | 3300025898 | Bacteria | 800 |
| 234 | Ga0207642_10028143 | 3300025899 | Bacteria | 2310 |
| 235 | Ga0207688_10793980 | 3300025901 | Bacteria | 600 |
| 236 | Ga0207685_10186108 | 3300025905 | Bacteria | 966 |
| 237 | Ga0207645_10058527 | 3300025907 | Bacteria | 2460 |
| 238 | Ga0207643_10055492 | 3300025908 | Bacteria | 2253 |
| 239 | Ga0207643_10073660 | 3300025908 | Bacteria | 1969 |
| 240 | Ga0207643_10129279 | 3300025908 | Bacteria | 1501 |
| 241 | Ga0207654_10323293 | 3300025911 | Bacteria | 1055 |
| 242 | Ga0207707_10100720 | 3300025912 | Bacteria | 2525 |
| 243 | Ga0207707_10110698 | 3300025912 | Bacteria | 2400 |
| 244 | Ga0207707_10580787 | 3300025912 | Bacteria | 950 |
| 245 | Ga0207663_11270701 | 3300025916 | Bacteria | 593 |
| 246 | Ga0207660_10061693 | 3300025917 | Bacteria | 2699 |
| 247 | Ga0207660_10201382 | 3300025917 | Bacteria | 1555 |
| 248 | Ga0207660_10234177 | 3300025917 | Bacteria | 1445 |
| 249 | Ga0207660_11418754 | 3300025917 | Bacteria | 562 |
| 250 | Ga0207662_10000110 | 3300025918 | Bacteria | 39525 |
| 251 | Ga0207662_10210781 | 3300025918 | Bacteria | 1261 |
| 252 | Ga0207652_10105016 | 3300025921 | Bacteria | 2499 |
| 253 | Ga0207652_10360226 | 3300025921 | Bacteria | 1313 |
| 254 | Ga0207646_10352686 | 3300025922 | Bacteria | 1330 |
| 255 | Ga0207646_10651153 | 3300025922 | Bacteria | 944 |
| 256 | Ga0207681_10004479 | 3300025923 | Bacteria | 8599 |
| 257 | Ga0207659_10024907 | 3300025926 | Bacteria | 4016 |
| 258 | Ga0207659_10533073 | 3300025926 | Bacteria | 997 |
| 259 | Ga0207687_10027468 | 3300025927 | Bacteria | 3819 |
| 260 | Ga0207664_10210879 | 3300025929 | Bacteria | 1680 |
| 261 | Ga0207644_10485751 | 3300025931 | Bacteria | 1018 |
| 262 | Ga0207706_10519113 | 3300025933 | Bacteria | 1027 |
| 263 | Ga0207706_10915187 | 3300025933 | Bacteria | 740 |
| 264 | Ga0207709_10003963 | 3300025935 | Bacteria | 8638 |
| 265 | Ga0207670_10001969 | 3300025936 | Bacteria | 10773 |
| 266 | Ga0207670_10081697 | 3300025936 | Bacteria | 2263 |
| 267 | Ga0207670_10102930 | 3300025936 | Bacteria | 2042 |
| 268 | Ga0207670_10278294 | 3300025936 | Bacteria | 1303 |
| 269 | Ga0207670_10915875 | 3300025936 | Bacteria | 735 |
| 270 | Ga0207704_10002884 | 3300025938 | Bacteria | 7774 |
| 271 | Ga0207704_10305933 | 3300025938 | Bacteria | 1220 |
| 272 | Ga0207665_10655714 | 3300025939 | Bacteria | 823 |
| 273 | Ga0207665_10897017 | 3300025939 | Bacteria | 703 |
| 274 | Ga0207691_10234423 | 3300025940 | Bacteria | 1588 |
| 275 | Ga0207689_10006996 | 3300025942 | Bacteria | 9917 |
| 276 | Ga0207689_10056573 | 3300025942 | Bacteria | 3228 |
| 277 | Ga0207661_10207622 | 3300025944 | Bacteria | 1725 |
| 278 | Ga0207667_10044504 | 3300025949 | Bacteria | 4703 |
| 279 | Ga0207667_10488260 | 3300025949 | Bacteria | 1250 |
| 280 | Ga0207651_10165724 | 3300025960 | Bacteria | 1737 |
| 281 | Ga0207651_10355994 | 3300025960 | Bacteria | 1234 |
| 282 | Ga0207651_10659630 | 3300025960 | Bacteria | 919 |
| 283 | Ga0207668_10362506 | 3300025972 | Bacteria | 1215 |
| 284 | Ga0207640_10124454 | 3300025981 | Bacteria | 1854 |
| 285 | Ga0207640_11934422 | 3300025981 | Bacteria | 534 |
| 286 | Ga0207677_10047524 | 3300026023 | Bacteria | 2882 |
| 287 | Ga0207677_10659034 | 3300026023 | Bacteria | 925 |
| 288 | Ga0207703_10045480 | 3300026035 | Bacteria | 3531 |
| 289 | Ga0207708_10006584 | 3300026075 | Bacteria | 8598 |
| 290 | Ga0207708_10187933 | 3300026075 | Bacteria | 1643 |
| 291 | Ga0207702_10059836 | 3300026078 | Bacteria | 3246 |
| 292 | Ga0207702_10388489 | 3300026078 | Bacteria | 1343 |
| 293 | Ga0207641_10467913 | 3300026088 | Bacteria | 1220 |
| 294 | Ga0207641_10659087 | 3300026088 | Bacteria | 1028 |
| 295 | Ga0207648_10001025 | 3300026089 | Bacteria | 31445 |
| 296 | Ga0207648_10029600 | 3300026089 | Bacteria | 4856 |
| 297 | Ga0207648_11309733 | 3300026089 | Bacteria | 681 |
| 298 | Ga0207676_10027624 | 3300026095 | Bacteria | 4229 |
| 299 | Ga0207674_10287035 | 3300026116 | Bacteria | 1594 |
| 300 | Ga0207675_100005378 | 3300026118 | Bacteria | 12285 |
| 301 | Ga0207675_100005981 | 3300026118 | Bacteria | 11584 |
| 302 | Ga0207675_100134757 | 3300026118 | Bacteria | 2343 |
| 303 | Ga0207675_100296453 | 3300026118 | Bacteria | 1574 |
| 304 | Ga0207683_10567092 | 3300026121 | Bacteria | 1050 |
| 305 | Ga0207698_11423686 | 3300026142 | Bacteria | 708 |
| 306 | Ga0209969_1029605 | 3300027360 | Bacteria | 835 |
| 307 | Ga0209967_1000306 | 3300027364 | Bacteria | 6638 |
| 308 | Ga0209981_1005511 | 3300027378 | Bacteria | 1680 |
| 309 | Ga0210000_1005821 | 3300027462 | Bacteria | 1793 |
| 310 | Ga0210000_1008946 | 3300027462 | Bacteria | 1470 |
| 311 | Ga0209995_1016044 | 3300027471 | Bacteria | 1229 |
| 312 | Ga0209995_1061830 | 3300027471 | Bacteria | 638 |
| 313 | Ga0209999_1009943 | 3300027543 | Bacteria | 1718 |
| 314 | Ga0209999_1019295 | 3300027543 | Bacteria | 1250 |
| 315 | Ga0209588_1015516 | 3300027671 | Bacteria | 2343 |
| 316 | Ga0209588_1193996 | 3300027671 | Bacteria | 634 |
| 317 | Ga0209971_1020839 | 3300027682 | Bacteria | 1559 |
| 318 | Ga0209966_1006695 | 3300027695 | Bacteria | 2005 |
| 319 | Ga0207428_10155375 | 3300027907 | Bacteria | 1740 |
| 320 | Ga0207428_10232569 | 3300027907 | Bacteria | 1379 |
| 321 | Ga0268265_10041489 | 3300028380 | Bacteria | 3406 |
| 322 | Ga0268265_10483989 | 3300028380 | Bacteria | 1163 |
| 323 | Ga0268265_10763644 | 3300028380 | Bacteria | 939 |
| 324 | Ga0268265_10998336 | 3300028380 | Bacteria | 827 |
| 325 | Ga0268264_10059685 | 3300028381 | Bacteria | 3196 |
| 326 | Ga0268264_11426392 | 3300028381 | Bacteria | 703 |
| 327 | Ga0307408_100323497 | 3300031548 | Bacteria | 1300 |
| 328 | Ga0307408_101388735 | 3300031548 | Bacteria | 661 |
| 329 | Ga0316579_10005614 | 3300031691 | Bacteria | 5076 |
| 330 | Ga0307405_10313158 | 3300031731 | Bacteria | 1196 |
| 331 | Ga0307405_11355342 | 3300031731 | Bacteria | 621 |
| 332 | Ga0307413_10419453 | 3300031824 | Bacteria | 1054 |
| 333 | Ga0307410_10972283 | 3300031852 | Bacteria | 731 |
| 334 | Ga0307412_10082296 | 3300031911 | Bacteria | 2229 |
| 335 | Ga0307412_10624557 | 3300031911 | Bacteria | 916 |
| 336 | Ga0307409_100120641 | 3300031995 | Bacteria | 2220 |
| 337 | Ga0307409_101974181 | 3300031995 | Bacteria | 613 |
| 338 | Ga0307416_100150202 | 3300032002 | Bacteria | 2135 |
| 339 | Ga0307416_100259564 | 3300032002 | Bacteria | 1697 |
| 340 | Ga0307416_100338885 | 3300032002 | Bacteria | 1515 |
| 341 | Ga0307416_100540611 | 3300032002 | Bacteria | 1237 |
| 342 | Ga0307416_100683485 | 3300032002 | Bacteria | 1114 |
| 343 | Ga0307416_101687942 | 3300032002 | Bacteria | 738 |
| 344 | Ga0307416_102390712 | 3300032002 | Bacteria | 628 |
| 345 | Ga0307411_10513741 | 3300032005 | Bacteria | 1015 |
| 346 | Ga0316583_10017222 | 3300032133 | Bacteria | 2598 |
| 347 | Ga0316583_10088371 | 3300032133 | Bacteria | 1081 |
| 348 | Ga0373950_0081715 | 3300034818 | Bacteria | 676 |
| 349 | Ga0373938_0083255 | 3300034957 | Bacteria | 782 |
| 350 | Ga0373938_0101291 | 3300034957 | Bacteria | 724 |
| 351 | Ga0373926_0001668 | 3300035083 | Bacteria | 6863 |
| 352 | Ga0373928_0114796 | 3300035084 | Bacteria | 716 |
| 353 | Ga0373929_0241720 | 3300035085 | Unclassified | 520 |
| 354 | Ga0373940_0003072 | 3300035088 | Bacteria | 3351 |
| 355 | Ga0373944_0010854 | 3300035089 | Bacteria | 2489 |
| 356 | Ga0373949_0020008 | 3300035090 | Bacteria | 1529 |
| 357 | Ga0373949_0086592 | 3300035090 | Bacteria | 842 |
| 358 | Ga0373951_0012149 | 3300035091 | Bacteria | 1937 |
| 359 | Ga0373952_0002445 | 3300035092 | Bacteria | 3349 |
| 360 | Ga0373952_0129361 | 3300035092 | Bacteria | 692 |
| 361 | Ga0373923_0054740 | 3300035111 | Bacteria | 1680 |
| 362 | Ga0373923_0163207 | 3300035111 | Bacteria | 1017 |
| 363 | Ga0373932_0006117 | 3300035112 | Bacteria | 2840 |
| 364 | Ga0373932_0114064 | 3300035112 | Bacteria | 894 |
| 365 | Ga0373932_0196321 | 3300035112 | Bacteria | 715 |
| 366 | Ga0373936_0086985 | 3300035113 | Bacteria | 1306 |
| 367 | Ga0373936_0370277 | 3300035113 | Bacteria | 654 |
| 368 | Ga0373939_0002793 | 3300035114 | Bacteria | 4094 |
| 369 | Ga0373939_0075738 | 3300035114 | Bacteria | 1107 |
| 370 | Ga0373941_0009434 | 3300035115 | Bacteria | 2458 |
| 371 | Ga0373941_0141188 | 3300035115 | Bacteria | 876 |
| 372 | Ga0373941_0267043 | 3300035115 | Bacteria | 673 |
| 373 | Ga0373945_0003844 | 3300035116 | Bacteria | 4744 |
| 374 | Ga0373953_0053659 | 3300035117 | Bacteria | 1634 |
| 375 | Ga0373954_0000028 | 3300035118 | Bacteria | 56501 |
| 376 | Ga0373956_0068551 | 3300035119 | Bacteria | 1616 |
| 377 | Ga0373960_0004703 | 3300035121 | Bacteria | 3141 |
| 378 | Ga0373960_0014621 | 3300035121 | Bacteria | 1992 |
| 379 | Ga0373960_0047523 | 3300035121 | Bacteria | 1263 |
| 380 | Ga0373960_0353600 | 3300035121 | Unclassified | 558 |
| 381 | Ga0373943_0056794 | 3300035170 | Bacteria | 1943 |
| 382 | Ga0373943_0069707 | 3300035170 | Bacteria | 1777 |
| 383 | Ga0373946_0008098 | 3300035171 | Bacteria | 3859 |
| 384 | Ga0373946_0035782 | 3300035171 | Bacteria | 2010 |
| 385 | Ga0373955_0009467 | 3300035172 | Bacteria | 4563 |
| 386 | Ga0373955_0040471 | 3300035172 | Bacteria | 2493 |
| 387 | Ga0373955_0149578 | 3300035172 | Bacteria | 1374 |
| 388 | Ga0373955_0426735 | 3300035172 | Bacteria | 807 |
| 389 | Ga0373942_0089602 | 3300035207 | Bacteria | 925 |
| 390 | Ga0373942_0097501 | 3300035207 | Bacteria | 894 |
| 391 | Ga0373961_0009409 | 3300035241 | Bacteria | 2391 |
| 392 | Ga0373961_0058152 | 3300035241 | Bacteria | 1165 |
| 393 | Ga0373961_0415760 | 3300035241 | Bacteria | 519 |
| 394 | Ga0373962_0087225 | 3300035242 | Bacteria | 956 |
| 395 | Ga0373924_0117818 | 3300035410 | Bacteria | 1151 |
| 396 | Ga0373924_0192973 | 3300035410 | Bacteria | 897 |
| 397 | Ga0373924_0259368 | 3300035410 | Bacteria | 770 |
| 398 | Ga0373924_0381895 | 3300035410 | Bacteria | 629 |
| 399 | Ga0373931_0001811 | 3300035691 | Bacteria | 9299 |
| 400 | Ga0373931_0062651 | 3300035691 | Bacteria | 2008 |
| 401 | Ga0373931_0103402 | 3300035691 | Bacteria | 1605 |
| 402 | Ga0373931_0257773 | 3300035691 | Bacteria | 1063 |
| 403 | Ga0373931_0271663 | 3300035691 | Bacteria | 1038 |
| 404 | Ga0373931_1194730 | 3300035691 | Unclassified | 520 |
| 405 | Ga0373935_0016908 | 3300035692 | Bacteria | 4417 |
| 406 | Ga0373927_0010069 | 3300035695 | Bacteria | 6330 |
| 407 | Ga0373933_0023783 | 3300035724 | Bacteria | 3503 |
| 408 | Ga0373933_0024952 | 3300035724 | Bacteria | 3425 |
| 409 | Ga0373933_0281731 | 3300035724 | Bacteria | 1074 |
| 410 | Ga0373947_0031901 | 3300035725 | Bacteria | 3103 |
| 411 | Ga0373947_0102081 | 3300035725 | Bacteria | 1803 |
| 412 | Ga0373947_0918492 | 3300035725 | Bacteria | 597 |
| 413 | Ga0373947_1062996 | 3300035725 | Bacteria | 552 |
| 414 | Ga0373937_0001199 | 3300036401 | Bacteria | 21771 |
| 415 | Ga0373937_0043315 | 3300036401 | Bacteria | 4107 |
| 416 | Ga0373925_0021316 | 3300037068 | Bacteria | 4721 |
| 417 | Ga0373925_1012308 | 3300037068 | Bacteria | 684 |
| 418 | Ga0316581_0075503 | 3300037588 | Bacteria | 1035 |
| 419 | Ga0439439_0148895 | 3300041406 | Bacteria | 664 |
| 420 | Ga0439453_0001076 | 3300041408 | Bacteria | 3379 |
| 421 | Ga0451807_0627795 | 3300041486 | Bacteria | 2095 |
| 422 | Ga0439431_0093512 | 3300041997 | Bacteria | 821 |
| 423 | Ga0439433_0126486 | 3300041999 | Unclassified | 647 |
| 424 | Ga0439456_048392 | 3300042013 | Bacteria | 928 |
| 425 | Ga0439458_0095305 | 3300042157 | Bacteria | 769 |
| 426 | Ga0439434_0005692 | 3300042435 | Bacteria | 3638 |
| 427 | Ga0439435_0001116 | 3300042436 | Bacteria | 4784 |
| 428 | Ga0439435_0063885 | 3300042436 | Bacteria | 1078 |
| 429 | Ga0439435_0101712 | 3300042436 | Bacteria | 884 |
| 430 | Ga0439444_0003523 | 3300042437 | Bacteria | 2215 |
| 431 | Ga0439444_0057543 | 3300042437 | Bacteria | 804 |
| 432 | Ga0439460_0000526 | 3300042461 | Bacteria | 8328 |
| 433 | Ga0450918_037022 | 3300042531 | Bacteria | 870 |
| 434 | Ga0450893_0044890 | 3300042532 | Bacteria | 817 |
| 435 | Ga0451577_0193255 | 3300042876 | Bacteria | 1836 |
| 436 | Ga0451577_1765589 | 3300042876 | Bacteria | 543 |
| 437 | Ga0453683_0481556 | 3300044673 | Bacteria | 804 |
| 438 | Ga0453683_1152746 | 3300044673 | Bacteria | 518 |
| 439 | Ga0466964_0916964 | 3300044706 | Bacteria | 502 |
| 440 | Ga0466960_0374563 | 3300044901 | Bacteria | 816 |
| 441 | Ga0451576_0009574 | 3300045051 | Bacteria | 11217 |
| 442 | Ga0451576_0026461 | 3300045051 | Bacteria | 6240 |
| 443 | Ga0451576_0050035 | 3300045051 | Bacteria | 4385 |
| 444 | Ga0451576_0111234 | 3300045051 | Bacteria | 2850 |
| 445 | Ga0451576_0130916 | 3300045051 | Bacteria | 2615 |
| 446 | Ga0451576_0132216 | 3300045051 | Bacteria | 2601 |
| 447 | Ga0451576_0468176 | 3300045051 | Bacteria | 1323 |
| 448 | Ga0451576_1125936 | 3300045051 | Bacteria | 821 |
| 449 | Ga0451576_1306375 | 3300045051 | Unclassified | 756 |
| 450 | Ga0451576_1739017 | 3300045051 | Bacteria | 645 |
| 451 | Ga0466958_0184619 | 3300045836 | Bacteria | 1324 |
| 452 | Ga0466967_0001877 | 3300045976 | Bacteria | 12676 |
| 453 | Ga0495592_0158265 | 3300046454 | Bacteria | 1561 |
| 454 | Ga0495592_0583919 | 3300046454 | Bacteria | 683 |
| 455 | Ga0495603_0075190 | 3300046455 | Bacteria | 1983 |
| 456 | Ga0495651_0260646 | 3300046462 | Bacteria | 1180 |
| 457 | Ga0495580_0022250 | 3300046472 | Bacteria | 4667 |
| 458 | Ga0495639_0032900 | 3300046475 | Bacteria | 2314 |
| 459 | Ga0495662_0100001 | 3300046476 | Bacteria | 1418 |
| 460 | Ga0495664_0137853 | 3300046477 | Bacteria | 1479 |
| 461 | Ga0495594_0061586 | 3300046499 | Bacteria | 2077 |
| 462 | Ga0495608_0203145 | 3300046511 | Bacteria | 1248 |
| 463 | Ga0495608_0570658 | 3300046511 | Bacteria | 681 |
| 464 | Ga0495628_1214818 | 3300046516 | Bacteria | 511 |
| 465 | Ga0495630_0468563 | 3300046517 | Bacteria | 965 |
| 466 | Ga0495666_0022861 | 3300046526 | Bacteria | 3094 |
| 467 | Ga0495652_0900204 | 3300046529 | Bacteria | 584 |
| 468 | Ga0495665_0176962 | 3300046531 | Bacteria | 1109 |
| 469 | Ga0495640_0038602 | 3300046533 | Bacteria | 3358 |
| 470 | Ga0495586_0009470 | 3300046535 | Bacteria | 5186 |
| 471 | Ga0495598_0254348 | 3300046537 | Bacteria | 652 |
| 472 | Ga0495609_0444313 | 3300046538 | Bacteria | 516 |
| 473 | Ga0495621_0186669 | 3300046539 | Bacteria | 830 |
| 474 | Ga0495621_0236985 | 3300046539 | Bacteria | 742 |
| 475 | Ga0495667_0186941 | 3300046559 | Bacteria | 1328 |
| 476 | Ga0495656_0152189 | 3300046615 | Bacteria | 1118 |
| 477 | Ga0495634_0619985 | 3300046642 | Bacteria | 627 |
| 478 | Ga0495635_0432834 | 3300046663 | Bacteria | 871 |
| 479 | Ga0495659_0023464 | 3300046664 | Bacteria | 2097 |
| 480 | Ga0495659_0423511 | 3300046664 | Bacteria | 577 |
| 481 | Ga0495588_0050293 | 3300046674 | Bacteria | 2144 |
| 482 | Ga0495657_0084499 | 3300046675 | Bacteria | 2047 |
| 483 | Ga0495657_0768543 | 3300046675 | Bacteria | 552 |
| 484 | Ga0495623_0531752 | 3300046679 | Bacteria | 618 |
| 485 | Ga0495647_0000776 | 3300046681 | Bacteria | 9490 |
| 486 | Ga0495658_0103694 | 3300046683 | Bacteria | 1701 |
| 487 | Ga0495669_0122826 | 3300046684 | Bacteria | 1218 |
| 488 | Ga0495624_0205310 | 3300046690 | Bacteria | 1196 |
| 489 | Ga0495604_0441724 | 3300047317 | Bacteria | 851 |
| 490 | Ga0495604_0723344 | 3300047317 | Bacteria | 631 |
| 491 | Ga0495636_0542830 | 3300047318 | Unclassified | 565 |
| 492 | Ga0495674_0162082 | 3300047319 | Bacteria | 1870 |
| 493 | Ga0495674_0353399 | 3300047319 | Bacteria | 1193 |
| 494 | Ga0495676_0516363 | 3300047321 | Bacteria | 783 |
| 495 | Ga0495680_0101441 | 3300047322 | Bacteria | 2144 |
| 496 | Ga0495675_0262560 | 3300047444 | Bacteria | 1034 |
| 497 | Ga0501298_108933 | 3300049521 | Bacteria | 640 |
| 498 | Ga0501299_028701 | 3300049522 | Bacteria | 1062 |
| 499 | Ga0501299_209041 | 3300049522 | Bacteria | 522 |
| 500 | Ga0501031_0068233 | 3300049568 | Bacteria | 2316 |
| 501 | Ga0501031_0100824 | 3300049568 | Bacteria | 1884 |
| 502 | Ga0501031_0497834 | 3300049568 | Bacteria | 786 |
| 503 | Ga0501031_0547852 | 3300049568 | Bacteria | 745 |
| 504 | Ga0501032_0012925 | 3300049569 | Bacteria | 5950 |
| 505 | Ga0501033_0007637 | 3300049570 | Bacteria | 8405 |
| 506 | Ga0501033_0659134 | 3300049570 | Bacteria | 714 |
| 507 | Ga0501033_0777852 | 3300049570 | Bacteria | 648 |
| 508 | Ga0501034_0138074 | 3300049571 | Bacteria | 2418 |
| 509 | Ga0501036_0005367 | 3300049572 | Bacteria | 10378 |
| 510 | Ga0501036_0097488 | 3300049572 | Bacteria | 2485 |
| 511 | Ga0501036_0248344 | 3300049572 | Bacteria | 1491 |
| 512 | Ga0501036_0480845 | 3300049572 | Bacteria | 1034 |
| 513 | Ga0501036_1113491 | 3300049572 | Bacteria | 645 |
| 514 | Ga0501036_1698377 | 3300049572 | Bacteria | 509 |
| 515 | Ga0501037_0554453 | 3300049573 | Bacteria | 775 |
| 516 | Ga0501038_0005959 | 3300049574 | Bacteria | 11273 |
| 517 | Ga0501038_0023410 | 3300049574 | Bacteria | 5522 |
| 518 | Ga0501038_0648140 | 3300049574 | Bacteria | 795 |
| 519 | Ga0501038_1138075 | 3300049574 | Bacteria | 569 |
| 520 | Ga0501039_0000350 | 3300049575 | Bacteria | 33064 |
| 521 | Ga0501039_0041323 | 3300049575 | Bacteria | 3561 |
| 522 | Ga0501039_0075897 | 3300049575 | Bacteria | 2613 |
| 523 | Ga0501039_0082947 | 3300049575 | Bacteria | 2496 |
| 524 | Ga0501039_0169004 | 3300049575 | Bacteria | 1719 |
| 525 | Ga0501040_0000076 | 3300049576 | Bacteria | 47632 |
| 526 | Ga0501040_0030565 | 3300049576 | Bacteria | 3639 |
| 527 | Ga0501040_0057572 | 3300049576 | Bacteria | 2669 |
| 528 | Ga0501040_0094250 | 3300049576 | Bacteria | 2083 |
| 529 | Ga0501040_0136343 | 3300049576 | Bacteria | 1728 |
| 530 | Ga0501040_0203466 | 3300049576 | Bacteria | 1406 |
| 531 | Ga0501041_0002310 | 3300049577 | Bacteria | 10783 |
| 532 | Ga0501041_0018963 | 3300049577 | Bacteria | 4099 |
| 533 | Ga0501041_0125174 | 3300049577 | Bacteria | 1599 |
| 534 | Ga0501041_0476101 | 3300049577 | Bacteria | 793 |
| 535 | Ga0501042_0001348 | 3300049578 | Bacteria | 14367 |
| 536 | Ga0501042_0032166 | 3300049578 | Bacteria | 3714 |
| 537 | Ga0501042_0120236 | 3300049578 | Bacteria | 1891 |
| 538 | Ga0501042_0358663 | 3300049578 | Bacteria | 1055 |
| 539 | Ga0501042_0418088 | 3300049578 | Bacteria | 971 |
| 540 | Ga0501043_0038121 | 3300049579 | Bacteria | 3780 |
| 541 | Ga0501043_0066693 | 3300049579 | Bacteria | 2826 |
| 542 | Ga0501043_0338490 | 3300049579 | Bacteria | 1145 |
| 543 | Ga0501046_0004903 | 3300049580 | Bacteria | 12044 |
| 544 | Ga0501046_0083740 | 3300049580 | Bacteria | 2461 |
| 545 | Ga0501046_0207868 | 3300049580 | Bacteria | 1454 |
| 546 | Ga0501046_0789840 | 3300049580 | Bacteria | 666 |
| 547 | Ga0501047_0039745 | 3300049581 | Bacteria | 4550 |
| 548 | Ga0501048_0002981 | 3300049582 | Bacteria | 12922 |
| 549 | Ga0501048_0046947 | 3300049582 | Bacteria | 3083 |
| 550 | Ga0501048_0064376 | 3300049582 | Bacteria | 2593 |
| 551 | Ga0501048_0124176 | 3300049582 | Bacteria | 1825 |
| 552 | Ga0501048_0208786 | 3300049582 | Bacteria | 1385 |
| 553 | Ga0501048_0596671 | 3300049582 | Bacteria | 793 |
| 554 | Ga0501068_0096208 | 3300049584 | Bacteria | 1831 |
| 555 | Ga0501068_0690709 | 3300049584 | Bacteria | 667 |
| 556 | Ga0501069_0631699 | 3300049585 | Bacteria | 644 |
| 557 | Ga0501070_0026559 | 3300049586 | Bacteria | 4858 |
| 558 | Ga0501070_1059041 | 3300049586 | Bacteria | 627 |
| 559 | Ga0501071_0012748 | 3300049587 | Bacteria | 5715 |
| 560 | Ga0501071_0013763 | 3300049587 | Bacteria | 5519 |
| 561 | Ga0501071_0162282 | 3300049587 | Bacteria | 1671 |
| 562 | Ga0501071_0322060 | 3300049587 | Bacteria | 1174 |
| 563 | Ga0501071_0408595 | 3300049587 | Bacteria | 1037 |
| 564 | Ga0501071_1537671 | 3300049587 | Bacteria | 514 |
| 565 | Ga0501072_0004702 | 3300049588 | Bacteria | 10402 |
| 566 | Ga0501072_0008686 | 3300049588 | Bacteria | 7713 |
| 567 | Ga0501072_0136067 | 3300049588 | Bacteria | 1959 |
| 568 | Ga0501072_0296834 | 3300049588 | Bacteria | 1284 |
| 569 | Ga0501072_0409190 | 3300049588 | Bacteria | 1076 |
| 570 | Ga0501072_0452321 | 3300049588 | Bacteria | 1017 |
| 571 | Ga0501072_0589166 | 3300049588 | Bacteria | 877 |
| 572 | Ga0501072_0928142 | 3300049588 | Bacteria | 680 |
| 573 | Ga0501074_0024704 | 3300049590 | Bacteria | 4366 |
| 574 | Ga0501074_0069474 | 3300049590 | Bacteria | 2533 |
| 575 | Ga0501074_0171059 | 3300049590 | Bacteria | 1551 |
| 576 | Ga0501074_0651862 | 3300049590 | Bacteria | 744 |
| 577 | Ga0501075_0002705 | 3300049591 | Bacteria | 11863 |
| 578 | Ga0501075_0023756 | 3300049591 | Bacteria | 4490 |
| 579 | Ga0501075_0068593 | 3300049591 | Bacteria | 2679 |
| 580 | Ga0501075_0155564 | 3300049591 | Bacteria | 1743 |
| 581 | Ga0501075_0990944 | 3300049591 | Bacteria | 639 |
| 582 | Ga0501076_0000478 | 3300049592 | Bacteria | 25212 |
| 583 | Ga0501076_0002331 | 3300049592 | Bacteria | 13011 |
| 584 | Ga0501076_0131949 | 3300049592 | Bacteria | 2026 |
| 585 | Ga0501076_0485268 | 3300049592 | Bacteria | 1018 |
| 586 | Ga0501076_0597789 | 3300049592 | Bacteria | 910 |
| 587 | Ga0501077_0002380 | 3300049593 | Bacteria | 11285 |
| 588 | Ga0501077_0286710 | 3300049593 | Bacteria | 1048 |
| 589 | Ga0501209_149947 | 3300049656 | Bacteria | 702 |
| 590 | Ga0501233_025851 | 3300049668 | Bacteria | 1293 |
| 591 | Ga0501225_0064879 | 3300049705 | Bacteria | 1031 |
| 592 | Ga0501079_0002229 | 3300049741 | Bacteria | 13978 |
| 593 | Ga0501079_0032959 | 3300049741 | Bacteria | 3984 |
| 594 | Ga0501079_0139368 | 3300049741 | Bacteria | 1889 |
| 595 | Ga0501079_0424736 | 3300049741 | Bacteria | 1043 |
| 596 | Ga0501079_1047708 | 3300049741 | Bacteria | 643 |
| 597 | Ga0501080_0042211 | 3300049742 | Bacteria | 4248 |
| 598 | Ga0501080_0118705 | 3300049742 | Bacteria | 2452 |
| 599 | Ga0501081_0000032 | 3300049743 | Bacteria | 52062 |
| 600 | Ga0501081_0001984 | 3300049743 | Bacteria | 12761 |
| 601 | Ga0501081_0067853 | 3300049743 | Bacteria | 2482 |
| 602 | Ga0501081_0388225 | 3300049743 | Bacteria | 1032 |
| 603 | Ga0501083_0041619 | 3300049744 | Bacteria | 3116 |
| 604 | Ga0501083_0065708 | 3300049744 | Bacteria | 2416 |
| 605 | Ga0501083_0806542 | 3300049744 | Bacteria | 611 |
| 606 | Ga0501035_0013954 | 3300049822 | Bacteria | 7412 |
| 607 | Ga0501035_0969101 | 3300049822 | Bacteria | 670 |
| 608 | Ga0501035_1464312 | 3300049822 | Bacteria | 522 |
| 609 | Ga0501045_0000662 | 3300049824 | Bacteria | 21887 |
| 610 | Ga0501045_0012663 | 3300049824 | Bacteria | 5938 |
| 611 | Ga0501045_0157129 | 3300049824 | Bacteria | 1692 |
| 612 | Ga0501045_0211106 | 3300049824 | Bacteria | 1446 |
| 613 | Ga0501045_0589161 | 3300049824 | Bacteria | 824 |
| 614 | Ga0501204_051297 | 3300049850 | Bacteria | 633 |
| 615 | nmdc:mga05p37_1414500_c1 | 3300050507 | Bacteria | 699 |
| 616 | nmdc:mga05p37_28485_c1 | 3300050507 | Bacteria | 6810 |
| 617 | nmdc:mga05p37_445_c1 | 3300050507 | Bacteria | 45012 |
| 618 | nmdc:mga05p37_479260_c1 | 3300050507 | Bacteria | 1433 |
| 619 | nmdc:mga05p37_515766_c1 | 3300050507 | Bacteria | 1368 |
| 620 | nmdc:mga05p37_712_c1 | 3300050507 | Bacteria | 36873 |
| 621 | nmdc:mga05p37_971965_c1 | 3300050507 | Bacteria | 906 |
| 622 | nmdc:mga09592_102197_c1 | 3300050508 | Bacteria | 2456 |
| 623 | nmdc:mga09592_116376_c1 | 3300050508 | Bacteria | 2294 |
| 624 | nmdc:mga09592_118_c1 | 3300050508 | Bacteria | 50210 |
| 625 | nmdc:mga09592_134796_c1 | 3300050508 | Bacteria | 2127 |
| 626 | nmdc:mga09592_172410_c1 | 3300050508 | Bacteria | 1871 |
| 627 | nmdc:mga09592_1745376_c1 | 3300050508 | Bacteria | 501 |
| 628 | nmdc:mga09592_496_c1 | 3300050508 | Bacteria | 29603 |
| 629 | nmdc:mga0qj67_201907_c1 | 3300050509 | Bacteria | 1615 |
| 630 | nmdc:mga0qj67_329005_c1 | 3300050509 | Bacteria | 1237 |
| 631 | nmdc:mga0qj67_654625_c1 | 3300050509 | Bacteria | 838 |
| 632 | nmdc:mga0qj67_779477_c1 | 3300050509 | Bacteria | 758 |
| 633 | nmdc:mga06r32_1480520_c1 | 3300050510 | Bacteria | 619 |
| 634 | nmdc:mga06r32_17949_c1 | 3300050510 | Bacteria | 6469 |
| 635 | nmdc:mga06r32_18701_c1 | 3300050510 | Bacteria | 6348 |
| 636 | nmdc:mga06r32_209471_c1 | 3300050510 | Bacteria | 1937 |
| 637 | nmdc:mga06r32_60743_c1 | 3300050510 | Bacteria | 3638 |
| 638 | nmdc:mga06r32_835358_c1 | 3300050510 | Bacteria | 880 |
| 639 | nmdc:mga08y16_162923_c1 | 3300050511 | Bacteria | 2317 |
| 640 | nmdc:mga08y16_32621_c1 | 3300050511 | Bacteria | 5474 |
| 641 | nmdc:mga08y16_34152_c1 | 3300050511 | Bacteria | 5343 |
| 642 | nmdc:mga08y16_612669_c1 | 3300050511 | Bacteria | 1096 |
| 643 | nmdc:mga0n895_1108_c1 | 3300050512 | Bacteria | 19675 |
| 644 | nmdc:mga0n895_1527_c1 | 3300050512 | Bacteria | 17386 |
| 645 | nmdc:mga0n895_39818_c1 | 3300050512 | Bacteria | 4564 |
| 646 | nmdc:mga0rr50_2902_c1 | 3300050513 | Bacteria | 9778 |
| 647 | nmdc:mga0rr50_37680_c1 | 3300050513 | Bacteria | 3493 |
| 648 | nmdc:mga08x19_1007480_c1 | 3300050514 | Bacteria | 592 |
| 649 | nmdc:mga08x19_106982_c1 | 3300050514 | Bacteria | 1861 |
| 650 | nmdc:mga08x19_1218441_c1 | 3300050514 | Bacteria | 533 |
| 651 | nmdc:mga08x19_16842_c1 | 3300050514 | Bacteria | 4464 |
| 652 | nmdc:mga08x19_176432_c1 | 3300050514 | Bacteria | 1457 |
| 653 | nmdc:mga08x19_264418_c1 | 3300050514 | Bacteria | 1190 |
| 654 | nmdc:mga08x19_639_c2 | 3300050514 | Bacteria | 6743 |
| 655 | nmdc:mga08x19_7012_c1 | 3300050514 | Bacteria | 6691 |
| 656 | nmdc:mga0a205_165465_c1 | 3300050515 | Bacteria | 2107 |
| 657 | nmdc:mga0a205_189685_c1 | 3300050515 | Bacteria | 1948 |
| 658 | nmdc:mga0a205_2500_c1 | 3300050515 | Bacteria | 16211 |
| 659 | nmdc:mga0a205_600391_c1 | 3300050515 | Bacteria | 954 |
| 660 | nmdc:mga0a205_659087_c1 | 3300050515 | Bacteria | 898 |
| 661 | nmdc:mga0a205_75085_c1 | 3300050515 | Bacteria | 3266 |
| 662 | Ga0495601_0080581 | 3300053077 | Bacteria | 2089 |
| 663 | Ga0495595_0641243 | 3300053084 | Unclassified | 544 |
| 664 | Ga0501084_0004084 | 3300054114 | Bacteria | 11890 |
| 665 | Ga0501084_0031894 | 3300054114 | Bacteria | 4407 |
| 666 | Ga0501084_0042590 | 3300054114 | Bacteria | 3798 |
| 667 | Ga0501084_0673225 | 3300054114 | Bacteria | 873 |
| 668 | Ga0501084_0750330 | 3300054114 | Bacteria | 822 |
| 669 | Ga0501084_1311624 | 3300054114 | Bacteria | 607 |
| 670 | Ga0590071_065313 | 3300059421 | Bacteria | 893 |
| 671 | Ga0590077_020785 | 3300059426 | Bacteria | 1395 |
| 672 | Ga0501082_0028363 | 3300060353 | Bacteria | 4824 |
| 673 | Ga0501082_0029850 | 3300060353 | Bacteria | 4697 |
| 674 | Ga0501082_0332696 | 3300060353 | Bacteria | 1323 |
| 675 | Ga0530510_0001597 | 3300061734 | Bacteria | 15298 |
| 676 | Ga0530510_0005498 | 3300061734 | Bacteria | 8774 |
| 677 | Ga0530510_0114121 | 3300061734 | Bacteria | 1980 |
| 678 | Ga0530510_0251986 | 3300061734 | Bacteria | 1316 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046675 | Ga0495657_0768543 | Ga0495657_0768543_13_366 | 117 |
| 2 | 3300005356 | Ga0070674_101575343 | Ga0070674_1015753432 | 122 |
| 3 | 3300027671 | Ga0209588_1193996 | Ga0209588_11939961 | 123 |
| 4 | 3300005336 | Ga0070680_100085806 | Ga0070680_1000858063 | 124 |
| 5 | 3300005345 | Ga0070692_10072867 | Ga0070692_100728673 | 124 |
| 6 | 3300005347 | Ga0070668_100083706 | Ga0070668_1000837062 | 124 |
| 7 | 3300005353 | Ga0070669_100014286 | Ga0070669_1000142862 | 124 |
| 8 | 3300005355 | Ga0070671_100414599 | Ga0070671_1004145992 | 124 |
| 9 | 3300005364 | Ga0070673_100758394 | Ga0070673_1007583941 | 124 |
| 10 | 3300005441 | Ga0070700_100004291 | Ga0070700_1000042912 | 124 |
| 11 | 3300005441 | Ga0070700_101126533 | Ga0070700_1011265332 | 124 |
| 12 | 3300005457 | Ga0070662_100501968 | Ga0070662_1005019682 | 124 |
| 13 | 3300005459 | Ga0068867_100003301 | Ga0068867_1000033019 | 124 |
| 14 | 3300005545 | Ga0070695_100080342 | Ga0070695_1000803422 | 124 |
| 15 | 3300005549 | Ga0070704_101007498 | Ga0070704_1010074982 | 124 |
| 16 | 3300005719 | Ga0068861_100031913 | Ga0068861_1000319136 | 124 |
| 17 | 3300005844 | Ga0068862_102332943 | Ga0068862_1023329431 | 124 |
| 18 | 3300006846 | Ga0075430_100270145 | Ga0075430_1002701452 | 124 |
| 19 | 3300006846 | Ga0075430_100647409 | Ga0075430_1006474092 | 124 |
| 20 | 3300006880 | Ga0075429_100464842 | Ga0075429_1004648422 | 124 |
| 21 | 3300009553 | Ga0105249_11723223 | Ga0105249_117232232 | 124 |
| 22 | 3300013306 | Ga0163162_11766392 | Ga0163162_117663922 | 124 |
| 23 | 3300025923 | Ga0207681_10004479 | Ga0207681_100044799 | 124 |
| 24 | 3300025960 | Ga0207651_10659630 | Ga0207651_106596302 | 124 |
| 25 | 3300025972 | Ga0207668_10362506 | Ga0207668_103625062 | 124 |
| 26 | 3300028380 | Ga0268265_10998336 | Ga0268265_109983362 | 124 |
| 27 | 3300034818 | Ga0373950_0081715 | Ga0373950_0081715_257_631 | 124 |
| 28 | 3300035242 | Ga0373962_0087225 | Ga0373962_0087225_413_787 | 124 |
| 29 | 3300037068 | Ga0373925_1012308 | Ga0373925_1012308_111_485 | 124 |
| 30 | 3300046454 | Ga0495592_0158265 | Ga0495592_0158265_712_1086 | 124 |
| 31 | 3300046476 | Ga0495662_0100001 | Ga0495662_0100001_859_1233 | 124 |
| 32 | 3300046511 | Ga0495608_0570658 | Ga0495608_0570658_270_644 | 124 |
| 33 | 3300046517 | Ga0495630_0468563 | Ga0495630_0468563_57_431 | 124 |
| 34 | 3300046533 | Ga0495640_0038602 | Ga0495640_0038602_1424_1798 | 124 |
| 35 | 3300046642 | Ga0495634_0619985 | Ga0495634_0619985_46_420 | 124 |
| 36 | 3300046664 | Ga0495659_0423511 | Ga0495659_0423511_62_436 | 124 |
| 37 | 3300046690 | Ga0495624_0205310 | Ga0495624_0205310_284_658 | 124 |
| 38 | 3300047319 | Ga0495674_0162082 | Ga0495674_0162082_1312_1686 | 124 |
| 39 | 3300050508 | nmdc:mga09592_172410_c1 | nmdc:mga09592_172410_c1_727_1101 | 124 |
| 40 | 3300050509 | nmdc:mga0qj67_329005_c1 | nmdc:mga0qj67_329005_c1_57_431 | 124 |
| 41 | 3300050510 | nmdc:mga06r32_1480520_c1 | nmdc:mga06r32_1480520_c1_75_449 | 124 |
| 42 | 3300053077 | Ga0495601_0080581 | Ga0495601_0080581_472_846 | 124 |
| 43 | 3300005439 | Ga0070711_100410830 | Ga0070711_1004108302 | 127 |
| 44 | 3300035410 | Ga0373924_0381895 | Ga0373924_0381895_73_465 | 127 |
| 45 | 3300049568 | Ga0501031_0068233 | Ga0501031_0068233_1001_1384 | 127 |
| 46 | 3300049568 | Ga0501031_0497834 | Ga0501031_0497834_123_506 | 127 |
| 47 | 3300049569 | Ga0501032_0012925 | Ga0501032_0012925_4544_4927 | 127 |
| 48 | 3300049570 | Ga0501033_0007637 | Ga0501033_0007637_4825_5208 | 127 |
| 49 | 3300049570 | Ga0501033_0659134 | Ga0501033_0659134_131_514 | 127 |
| 50 | 3300049571 | Ga0501034_0138074 | Ga0501034_0138074_26_409 | 127 |
| 51 | 3300049572 | Ga0501036_0005367 | Ga0501036_0005367_3716_4099 | 127 |
| 52 | 3300049572 | Ga0501036_0248344 | Ga0501036_0248344_495_878 | 127 |
| 53 | 3300049574 | Ga0501038_0005959 | Ga0501038_0005959_5316_5699 | 127 |
| 54 | 3300049574 | Ga0501038_0023410 | Ga0501038_0023410_3378_3761 | 127 |
| 55 | 3300049575 | Ga0501039_0000350 | Ga0501039_0000350_27000_27383 | 127 |
| 56 | 3300049575 | Ga0501039_0169004 | Ga0501039_0169004_811_1194 | 127 |
| 57 | 3300049576 | Ga0501040_0000076 | Ga0501040_0000076_40934_41317 | 127 |
| 58 | 3300049576 | Ga0501040_0057572 | Ga0501040_0057572_1015_1398 | 127 |
| 59 | 3300049577 | Ga0501041_0002310 | Ga0501041_0002310_5058_5441 | 127 |
| 60 | 3300049577 | Ga0501041_0018963 | Ga0501041_0018963_1941_2324 | 127 |
| 61 | 3300049578 | Ga0501042_0001348 | Ga0501042_0001348_5407_5790 | 127 |
| 62 | 3300049578 | Ga0501042_0032166 | Ga0501042_0032166_3190_3573 | 127 |
| 63 | 3300049579 | Ga0501043_0038121 | Ga0501043_0038121_2050_2433 | 127 |
| 64 | 3300049579 | Ga0501043_0066693 | Ga0501043_0066693_478_861 | 127 |
| 65 | 3300049580 | Ga0501046_0004903 | Ga0501046_0004903_5594_5977 | 127 |
| 66 | 3300049580 | Ga0501046_0083740 | Ga0501046_0083740_108_491 | 127 |
| 67 | 3300049581 | Ga0501047_0039745 | Ga0501047_0039745_1932_2315 | 127 |
| 68 | 3300049582 | Ga0501048_0002981 | Ga0501048_0002981_7224_7607 | 127 |
| 69 | 3300049582 | Ga0501048_0064376 | Ga0501048_0064376_1465_1848 | 127 |
| 70 | 3300049584 | Ga0501068_0096208 | Ga0501068_0096208_620_1003 | 127 |
| 71 | 3300049586 | Ga0501070_0026559 | Ga0501070_0026559_4153_4536 | 127 |
| 72 | 3300049587 | Ga0501071_0012748 | Ga0501071_0012748_4535_4918 | 127 |
| 73 | 3300049587 | Ga0501071_0013763 | Ga0501071_0013763_2692_3075 | 127 |
| 74 | 3300049588 | Ga0501072_0004702 | Ga0501072_0004702_7734_8117 | 127 |
| 75 | 3300049588 | Ga0501072_0008686 | Ga0501072_0008686_5650_6033 | 127 |
| 76 | 3300049590 | Ga0501074_0024704 | Ga0501074_0024704_3050_3433 | 127 |
| 77 | 3300049590 | Ga0501074_0069474 | Ga0501074_0069474_527_910 | 127 |
| 78 | 3300049591 | Ga0501075_0002705 | Ga0501075_0002705_8283_8666 | 127 |
| 79 | 3300049591 | Ga0501075_0068593 | Ga0501075_0068593_977_1360 | 127 |
| 80 | 3300049592 | Ga0501076_0000478 | Ga0501076_0000478_6560_6943 | 127 |
| 81 | 3300049592 | Ga0501076_0002331 | Ga0501076_0002331_6956_7339 | 127 |
| 82 | 3300049593 | Ga0501077_0002380 | Ga0501077_0002380_5527_5910 | 127 |
| 83 | 3300049741 | Ga0501079_0002229 | Ga0501079_0002229_6677_7060 | 127 |
| 84 | 3300049741 | Ga0501079_0032959 | Ga0501079_0032959_1740_2123 | 127 |
| 85 | 3300049742 | Ga0501080_0042211 | Ga0501080_0042211_2019_2402 | 127 |
| 86 | 3300049742 | Ga0501080_0118705 | Ga0501080_0118705_836_1219 | 127 |
| 87 | 3300049743 | Ga0501081_0000032 | Ga0501081_0000032_5352_5735 | 127 |
| 88 | 3300049743 | Ga0501081_0001984 | Ga0501081_0001984_7762_8145 | 127 |
| 89 | 3300049744 | Ga0501083_0041619 | Ga0501083_0041619_1040_1423 | 127 |
| 90 | 3300049744 | Ga0501083_0065708 | Ga0501083_0065708_1719_2102 | 127 |
| 91 | 3300049822 | Ga0501035_0013954 | Ga0501035_0013954_2148_2531 | 127 |
| 92 | 3300049822 | Ga0501035_0969101 | Ga0501035_0969101_264_647 | 127 |
| 93 | 3300049824 | Ga0501045_0000662 | Ga0501045_0000662_16041_16424 | 127 |
| 94 | 3300050509 | nmdc:mga0qj67_201907_c1 | nmdc:mga0qj67_201907_c1_824_1207 | 127 |
| 95 | 3300054114 | Ga0501084_0004084 | Ga0501084_0004084_5496_5879 | 127 |
| 96 | 3300054114 | Ga0501084_0031894 | Ga0501084_0031894_1235_1618 | 127 |
| 97 | 3300060353 | Ga0501082_0028363 | Ga0501082_0028363_1808_2191 | 127 |
| 98 | 3300060353 | Ga0501082_0029850 | Ga0501082_0029850_2844_3227 | 127 |
| 99 | 3300061734 | Ga0530510_0001597 | Ga0530510_0001597_5171_5554 | 127 |
| 100 | 3300061734 | Ga0530510_0005498 | Ga0530510_0005498_2151_2534 | 127 |
| 101 | 3300005338 | Ga0068868_100655748 | Ga0068868_1006557482 | 129 |
| 102 | 3300005458 | Ga0070681_10069603 | Ga0070681_100696032 | 130 |
| 103 | 3300005458 | Ga0070681_10130057 | Ga0070681_101300573 | 130 |
| 104 | 3300005544 | Ga0070686_100765078 | Ga0070686_1007650782 | 130 |
| 105 | 3300005614 | Ga0068856_100101355 | Ga0068856_1001013553 | 130 |
| 106 | 3300010375 | Ga0105239_12368365 | Ga0105239_123683651 | 130 |
| 107 | 3300025905 | Ga0207685_10186108 | Ga0207685_101861082 | 130 |
| 108 | 3300025912 | Ga0207707_10100720 | Ga0207707_101007203 | 130 |
| 109 | 3300025912 | Ga0207707_10110698 | Ga0207707_101106983 | 130 |
| 110 | 3300025921 | Ga0207652_10360226 | Ga0207652_103602262 | 130 |
| 111 | 3300025944 | Ga0207661_10207622 | Ga0207661_102076222 | 130 |
| 112 | 3300026078 | Ga0207702_10059836 | Ga0207702_100598363 | 130 |
| 113 | 3300035092 | Ga0373952_0129361 | Ga0373952_0129361_141_533 | 130 |
| 114 | 3300035121 | Ga0373960_0004703 | Ga0373960_0004703_1285_1677 | 130 |
| 115 | 3300035172 | Ga0373955_0149578 | Ga0373955_0149578_109_510 | 130 |
| 116 | 3300035172 | Ga0373955_0426735 | Ga0373955_0426735_25_426 | 130 |
| 117 | 3300035724 | Ga0373933_0281731 | Ga0373933_0281731_520_921 | 130 |
| 118 | 3300046529 | Ga0495652_0900204 | Ga0495652_0900204_115_516 | 130 |
| 119 | 3300049576 | Ga0501040_0094250 | Ga0501040_0094250_1049_1444 | 130 |
| 120 | 3300049582 | Ga0501048_0124176 | Ga0501048_0124176_1194_1589 | 130 |
| 121 | 3300049587 | Ga0501071_0162282 | Ga0501071_0162282_373_768 | 130 |
| 122 | 3300049588 | Ga0501072_0296834 | Ga0501072_0296834_534_929 | 130 |
| 123 | 3300049591 | Ga0501075_0155564 | Ga0501075_0155564_1150_1545 | 130 |
| 124 | 3300049824 | Ga0501045_0211106 | Ga0501045_0211106_737_1132 | 130 |
| 125 | 3300053084 | Ga0495595_0641243 | Ga0495595_0641243_36_437 | 130 |
| 126 | 3300005330 | Ga0070690_100392717 | Ga0070690_1003927172 | 131 |
| 127 | 3300005330 | Ga0070690_100450105 | Ga0070690_1004501052 | 131 |
| 128 | 3300005334 | Ga0068869_100043804 | Ga0068869_1000438042 | 131 |
| 129 | 3300005334 | Ga0068869_100162448 | Ga0068869_1001624482 | 131 |
| 130 | 3300005336 | Ga0070680_100023291 | Ga0070680_1000232913 | 131 |
| 131 | 3300005336 | Ga0070680_100053775 | Ga0070680_1000537752 | 131 |
| 132 | 3300005338 | Ga0068868_100003297 | Ga0068868_10000329712 | 131 |
| 133 | 3300005338 | Ga0068868_100278957 | Ga0068868_1002789572 | 131 |
| 134 | 3300005340 | Ga0070689_100070658 | Ga0070689_1000706582 | 131 |
| 135 | 3300005340 | Ga0070689_100297526 | Ga0070689_1002975262 | 131 |
| 136 | 3300005340 | Ga0070689_100334371 | Ga0070689_1003343712 | 131 |
| 137 | 3300005340 | Ga0070689_100647650 | Ga0070689_1006476501 | 131 |
| 138 | 3300005340 | Ga0070689_100769563 | Ga0070689_1007695631 | 131 |
| 139 | 3300005341 | Ga0070691_10016874 | Ga0070691_100168742 | 131 |
| 140 | 3300005341 | Ga0070691_10670221 | Ga0070691_106702211 | 131 |
| 141 | 3300005343 | Ga0070687_100001183 | Ga0070687_1000011839 | 131 |
| 142 | 3300005343 | Ga0070687_100481459 | Ga0070687_1004814592 | 131 |
| 143 | 3300005345 | Ga0070692_10005023 | Ga0070692_100050236 | 131 |
| 144 | 3300005345 | Ga0070692_10042596 | Ga0070692_100425962 | 131 |
| 145 | 3300005353 | Ga0070669_100293037 | Ga0070669_1002930371 | 131 |
| 146 | 3300005353 | Ga0070669_100988672 | Ga0070669_1009886721 | 131 |
| 147 | 3300005354 | Ga0070675_100064647 | Ga0070675_1000646472 | 131 |
| 148 | 3300005354 | Ga0070675_100669291 | Ga0070675_1006692912 | 131 |
| 149 | 3300005354 | Ga0070675_100672136 | Ga0070675_1006721362 | 131 |
| 150 | 3300005355 | Ga0070671_100225462 | Ga0070671_1002254622 | 131 |
| 151 | 3300005355 | Ga0070671_100608297 | Ga0070671_1006082972 | 131 |
| 152 | 3300005364 | Ga0070673_100267659 | Ga0070673_1002676592 | 131 |
| 153 | 3300005364 | Ga0070673_100331255 | Ga0070673_1003312552 | 131 |
| 154 | 3300005365 | Ga0070688_100039334 | Ga0070688_1000393343 | 131 |
| 155 | 3300005365 | Ga0070688_100743372 | Ga0070688_1007433721 | 131 |
| 156 | 3300005365 | Ga0070688_101607078 | Ga0070688_1016070781 | 131 |
| 157 | 3300005406 | Ga0070703_10160872 | Ga0070703_101608722 | 131 |
| 158 | 3300005437 | Ga0070710_10183223 | Ga0070710_101832232 | 131 |
| 159 | 3300005438 | Ga0070701_10013032 | Ga0070701_100130322 | 131 |
| 160 | 3300005439 | Ga0070711_100930807 | Ga0070711_1009308072 | 131 |
| 161 | 3300005440 | Ga0070705_100002410 | Ga0070705_1000024103 | 131 |
| 162 | 3300005440 | Ga0070705_100219092 | Ga0070705_1002190922 | 131 |
| 163 | 3300005440 | Ga0070705_100436759 | Ga0070705_1004367592 | 131 |
| 164 | 3300005440 | Ga0070705_100730374 | Ga0070705_1007303742 | 131 |
| 165 | 3300005441 | Ga0070700_100003267 | Ga0070700_1000032673 | 131 |
| 166 | 3300005441 | Ga0070700_100126370 | Ga0070700_1001263703 | 131 |
| 167 | 3300005441 | Ga0070700_100415063 | Ga0070700_1004150632 | 131 |
| 168 | 3300005444 | Ga0070694_100015084 | Ga0070694_1000150845 | 131 |
| 169 | 3300005444 | Ga0070694_100030631 | Ga0070694_1000306313 | 131 |
| 170 | 3300005444 | Ga0070694_100093878 | Ga0070694_1000938782 | 131 |
| 171 | 3300005444 | Ga0070694_100313374 | Ga0070694_1003133742 | 131 |
| 172 | 3300005444 | Ga0070694_100339024 | Ga0070694_1003390242 | 131 |
| 173 | 3300005444 | Ga0070694_100496089 | Ga0070694_1004960892 | 131 |
| 174 | 3300005444 | Ga0070694_100881369 | Ga0070694_1008813692 | 131 |
| 175 | 3300005444 | Ga0070694_100982963 | Ga0070694_1009829632 | 131 |
| 176 | 3300005445 | Ga0070708_100738210 | Ga0070708_1007382102 | 131 |
| 177 | 3300005457 | Ga0070662_100962020 | Ga0070662_1009620201 | 131 |
| 178 | 3300005459 | Ga0068867_100005090 | Ga0068867_1000050909 | 131 |
| 179 | 3300005466 | Ga0070685_10317553 | Ga0070685_103175532 | 131 |
| 180 | 3300005467 | Ga0070706_100182610 | Ga0070706_1001826102 | 131 |
| 181 | 3300005468 | Ga0070707_100251262 | Ga0070707_1002512622 | 131 |
| 182 | 3300005468 | Ga0070707_101370211 | Ga0070707_1013702112 | 131 |
| 183 | 3300005468 | Ga0070707_102083162 | Ga0070707_1020831621 | 131 |
| 184 | 3300005471 | Ga0070698_100084915 | Ga0070698_1000849153 | 131 |
| 185 | 3300005471 | Ga0070698_100620727 | Ga0070698_1006207271 | 131 |
| 186 | 3300005471 | Ga0070698_100817637 | Ga0070698_1008176372 | 131 |
| 187 | 3300005518 | Ga0070699_100105120 | Ga0070699_1001051202 | 131 |
| 188 | 3300005518 | Ga0070699_100286144 | Ga0070699_1002861442 | 131 |
| 189 | 3300005518 | Ga0070699_101477986 | Ga0070699_1014779861 | 131 |
| 190 | 3300005530 | Ga0070679_100058786 | Ga0070679_1000587863 | 131 |
| 191 | 3300005535 | Ga0070684_100197257 | Ga0070684_1001972572 | 131 |
| 192 | 3300005535 | Ga0070684_100335744 | Ga0070684_1003357442 | 131 |
| 193 | 3300005536 | Ga0070697_100006226 | Ga0070697_1000062269 | 131 |
| 194 | 3300005536 | Ga0070697_100100419 | Ga0070697_1001004192 | 131 |
| 195 | 3300005544 | Ga0070686_100017279 | Ga0070686_1000172794 | 131 |
| 196 | 3300005544 | Ga0070686_100059064 | Ga0070686_1000590643 | 131 |
| 197 | 3300005545 | Ga0070695_100015945 | Ga0070695_1000159454 | 131 |
| 198 | 3300005545 | Ga0070695_100033902 | Ga0070695_1000339023 | 131 |
| 199 | 3300005545 | Ga0070695_100140987 | Ga0070695_1001409872 | 131 |
| 200 | 3300005545 | Ga0070695_100165845 | Ga0070695_1001658452 | 131 |
| 201 | 3300005546 | Ga0070696_100012095 | Ga0070696_1000120954 | 131 |
| 202 | 3300005546 | Ga0070696_100151796 | Ga0070696_1001517962 | 131 |
| 203 | 3300005546 | Ga0070696_100158442 | Ga0070696_1001584422 | 131 |
| 204 | 3300005546 | Ga0070696_100255795 | Ga0070696_1002557952 | 131 |
| 205 | 3300005546 | Ga0070696_100554158 | Ga0070696_1005541582 | 131 |
| 206 | 3300005546 | Ga0070696_101718916 | Ga0070696_1017189161 | 131 |
| 207 | 3300005547 | Ga0070693_100001350 | Ga0070693_10000135012 | 131 |
| 208 | 3300005547 | Ga0070693_100062656 | Ga0070693_1000626563 | 131 |
| 209 | 3300005547 | Ga0070693_100273427 | Ga0070693_1002734272 | 131 |
| 210 | 3300005547 | Ga0070693_100646542 | Ga0070693_1006465421 | 131 |
| 211 | 3300005549 | Ga0070704_100038400 | Ga0070704_1000384002 | 131 |
| 212 | 3300005549 | Ga0070704_100231403 | Ga0070704_1002314032 | 131 |
| 213 | 3300005549 | Ga0070704_100416412 | Ga0070704_1004164121 | 131 |
| 214 | 3300005549 | Ga0070704_100861017 | Ga0070704_1008610172 | 131 |
| 215 | 3300005563 | Ga0068855_100022771 | Ga0068855_1000227712 | 131 |
| 216 | 3300005564 | Ga0070664_101232598 | Ga0070664_1012325982 | 131 |
| 217 | 3300005578 | Ga0068854_100056717 | Ga0068854_1000567173 | 131 |
| 218 | 3300005614 | Ga0068856_100315526 | Ga0068856_1003155262 | 131 |
| 219 | 3300005615 | Ga0070702_100000150 | Ga0070702_10000015017 | 131 |
| 220 | 3300005615 | Ga0070702_100100344 | Ga0070702_1001003442 | 131 |
| 221 | 3300005616 | Ga0068852_101697873 | Ga0068852_1016978732 | 131 |
| 222 | 3300005617 | Ga0068859_100141587 | Ga0068859_1001415872 | 131 |
| 223 | 3300005617 | Ga0068859_101203378 | Ga0068859_1012033782 | 131 |
| 224 | 3300005617 | Ga0068859_101759604 | Ga0068859_1017596042 | 131 |
| 225 | 3300005618 | Ga0068864_100026496 | Ga0068864_1000264965 | 131 |
| 226 | 3300005718 | Ga0068866_10006202 | Ga0068866_100062023 | 131 |
| 227 | 3300005719 | Ga0068861_100056123 | Ga0068861_1000561233 | 131 |
| 228 | 3300005719 | Ga0068861_100388655 | Ga0068861_1003886552 | 131 |
| 229 | 3300005840 | Ga0068870_10074806 | Ga0068870_100748062 | 131 |
| 230 | 3300005841 | Ga0068863_100474479 | Ga0068863_1004744792 | 131 |
| 231 | 3300005841 | Ga0068863_100572790 | Ga0068863_1005727902 | 131 |
| 232 | 3300005842 | Ga0068858_100050263 | Ga0068858_1000502634 | 131 |
| 233 | 3300005842 | Ga0068858_100375570 | Ga0068858_1003755702 | 131 |
| 234 | 3300005843 | Ga0068860_100031234 | Ga0068860_1000312343 | 131 |
| 235 | 3300005844 | Ga0068862_100051652 | Ga0068862_1000516523 | 131 |
| 236 | 3300005844 | Ga0068862_100349869 | Ga0068862_1003498692 | 131 |
| 237 | 3300005985 | Ga0081539_10000917 | Ga0081539_1000091720 | 131 |
| 238 | 3300006173 | Ga0070716_100505875 | Ga0070716_1005058751 | 131 |
| 239 | 3300006173 | Ga0070716_101160223 | Ga0070716_1011602232 | 131 |
| 240 | 3300006237 | Ga0097621_100013058 | Ga0097621_1000130588 | 131 |
| 241 | 3300006237 | Ga0097621_100015779 | Ga0097621_1000157794 | 131 |
| 242 | 3300006358 | Ga0068871_100007963 | Ga0068871_1000079636 | 131 |
| 243 | 3300006358 | Ga0068871_100448131 | Ga0068871_1004481312 | 131 |
| 244 | 3300006844 | Ga0075428_100002475 | Ga0075428_10000247516 | 131 |
| 245 | 3300006844 | Ga0075428_100029340 | Ga0075428_1000293406 | 131 |
| 246 | 3300006844 | Ga0075428_100052500 | Ga0075428_1000525003 | 131 |
| 247 | 3300006844 | Ga0075428_100068580 | Ga0075428_1000685803 | 131 |
| 248 | 3300006846 | Ga0075430_100009696 | Ga0075430_1000096962 | 131 |
| 249 | 3300006846 | Ga0075430_100286514 | Ga0075430_1002865142 | 131 |
| 250 | 3300006846 | Ga0075430_100410019 | Ga0075430_1004100192 | 131 |
| 251 | 3300006846 | Ga0075430_101460236 | Ga0075430_1014602362 | 131 |
| 252 | 3300006847 | Ga0075431_100003827 | Ga0075431_1000038277 | 131 |
| 253 | 3300006847 | Ga0075431_100063456 | Ga0075431_1000634564 | 131 |
| 254 | 3300006847 | Ga0075431_100113019 | Ga0075431_1001130192 | 131 |
| 255 | 3300006847 | Ga0075431_100115567 | Ga0075431_1001155672 | 131 |
| 256 | 3300006847 | Ga0075431_100195190 | Ga0075431_1001951902 | 131 |
| 257 | 3300006847 | Ga0075431_100224493 | Ga0075431_1002244932 | 131 |
| 258 | 3300006852 | Ga0075433_10003619 | Ga0075433_100036194 | 131 |
| 259 | 3300006852 | Ga0075433_10058017 | Ga0075433_100580174 | 131 |
| 260 | 3300006852 | Ga0075433_10088354 | Ga0075433_100883542 | 131 |
| 261 | 3300006852 | Ga0075433_10530753 | Ga0075433_105307532 | 131 |
| 262 | 3300006852 | Ga0075433_11507414 | Ga0075433_115074142 | 131 |
| 263 | 3300006871 | Ga0075434_100000003 | Ga0075434_100000003126 | 131 |
| 264 | 3300006871 | Ga0075434_100002400 | Ga0075434_10000240013 | 131 |
| 265 | 3300006871 | Ga0075434_100967170 | Ga0075434_1009671702 | 131 |
| 266 | 3300006871 | Ga0075434_102227579 | Ga0075434_1022275792 | 131 |
| 267 | 3300006880 | Ga0075429_100000113 | Ga0075429_1000001138 | 131 |
| 268 | 3300006880 | Ga0075429_100004277 | Ga0075429_1000042773 | 131 |
| 269 | 3300006880 | Ga0075429_100171323 | Ga0075429_1001713232 | 131 |
| 270 | 3300006880 | Ga0075429_100339175 | Ga0075429_1003391752 | 131 |
| 271 | 3300006881 | Ga0068865_100027903 | Ga0068865_1000279033 | 131 |
| 272 | 3300006881 | Ga0068865_100251799 | Ga0068865_1002517991 | 131 |
| 273 | 3300006914 | Ga0075436_100002673 | Ga0075436_1000026733 | 131 |
| 274 | 3300006914 | Ga0075436_100004352 | Ga0075436_1000043528 | 131 |
| 275 | 3300006914 | Ga0075436_100012300 | Ga0075436_1000123006 | 131 |
| 276 | 3300006914 | Ga0075436_100215520 | Ga0075436_1002155202 | 131 |
| 277 | 3300006931 | Ga0097620_100090854 | Ga0097620_1000908543 | 131 |
| 278 | 3300006931 | Ga0097620_100141582 | Ga0097620_1001415823 | 131 |
| 279 | 3300006931 | Ga0097620_101203323 | Ga0097620_1012033232 | 131 |
| 280 | 3300006931 | Ga0097620_101759687 | Ga0097620_1017596872 | 131 |
| 281 | 3300007076 | Ga0075435_100000265 | Ga0075435_10000026512 | 131 |
| 282 | 3300007076 | Ga0075435_100006583 | Ga0075435_1000065832 | 131 |
| 283 | 3300007076 | Ga0075435_100012648 | Ga0075435_1000126485 | 131 |
| 284 | 3300007076 | Ga0075435_100349880 | Ga0075435_1003498802 | 131 |
| 285 | 3300007076 | Ga0075435_100444030 | Ga0075435_1004440302 | 131 |
| 286 | 3300007076 | Ga0075435_101502036 | Ga0075435_1015020361 | 131 |
| 287 | 3300007265 | Ga0099794_10042962 | Ga0099794_100429622 | 131 |
| 288 | 3300007265 | Ga0099794_10221259 | Ga0099794_102212592 | 131 |
| 289 | 3300007265 | Ga0099794_10675562 | Ga0099794_106755622 | 131 |
| 290 | 3300009094 | Ga0111539_10040746 | Ga0111539_100407465 | 131 |
| 291 | 3300009094 | Ga0111539_10043099 | Ga0111539_100430994 | 131 |
| 292 | 3300009094 | Ga0111539_10053145 | Ga0111539_100531456 | 131 |
| 293 | 3300009094 | Ga0111539_11524036 | Ga0111539_115240362 | 131 |
| 294 | 3300009094 | Ga0111539_13320185 | Ga0111539_133201851 | 131 |
| 295 | 3300009098 | Ga0105245_10007925 | Ga0105245_100079253 | 131 |
| 296 | 3300009098 | Ga0105245_10474760 | Ga0105245_104747603 | 131 |
| 297 | 3300009098 | Ga0105245_11792352 | Ga0105245_117923522 | 131 |
| 298 | 3300009147 | Ga0114129_10002343 | Ga0114129_100023437 | 131 |
| 299 | 3300009147 | Ga0114129_10005124 | Ga0114129_100051248 | 131 |
| 300 | 3300009147 | Ga0114129_10591361 | Ga0114129_105913612 | 131 |
| 301 | 3300009147 | Ga0114129_10750029 | Ga0114129_107500292 | 131 |
| 302 | 3300009147 | Ga0114129_11563404 | Ga0114129_115634042 | 131 |
| 303 | 3300009148 | Ga0105243_10002517 | Ga0105243_1000251715 | 131 |
| 304 | 3300009148 | Ga0105243_10011311 | Ga0105243_100113114 | 131 |
| 305 | 3300009174 | Ga0105241_10018460 | Ga0105241_100184602 | 131 |
| 306 | 3300009176 | Ga0105242_10045232 | Ga0105242_100452324 | 131 |
| 307 | 3300009176 | Ga0105242_11052479 | Ga0105242_110524792 | 131 |
| 308 | 3300009176 | Ga0105242_11344288 | Ga0105242_113442882 | 131 |
| 309 | 3300009177 | Ga0105248_10681871 | Ga0105248_106818712 | 131 |
| 310 | 3300009553 | Ga0105249_10599057 | Ga0105249_105990572 | 131 |
| 311 | 3300010159 | Ga0099796_10297668 | Ga0099796_102976682 | 131 |
| 312 | 3300010375 | Ga0105239_10054903 | Ga0105239_100549034 | 131 |
| 313 | 3300011119 | Ga0105246_10215792 | Ga0105246_102157923 | 131 |
| 314 | 3300012495 | Ga0157323_1022974 | Ga0157323_10229742 | 131 |
| 315 | 3300013102 | Ga0157371_10547663 | Ga0157371_105476632 | 131 |
| 316 | 3300013105 | Ga0157369_11014634 | Ga0157369_110146342 | 131 |
| 317 | 3300013297 | Ga0157378_10044867 | Ga0157378_100448674 | 131 |
| 318 | 3300013297 | Ga0157378_12000728 | Ga0157378_120007282 | 131 |
| 319 | 3300013306 | Ga0163162_10147320 | Ga0163162_101473203 | 131 |
| 320 | 3300013307 | Ga0157372_11512596 | Ga0157372_115125962 | 131 |
| 321 | 3300013308 | Ga0157375_11041413 | Ga0157375_110414132 | 131 |
| 322 | 3300014326 | Ga0157380_10011055 | Ga0157380_100110552 | 131 |
| 323 | 3300014326 | Ga0157380_10038302 | Ga0157380_100383024 | 131 |
| 324 | 3300014326 | Ga0157380_10051886 | Ga0157380_100518862 | 131 |
| 325 | 3300014745 | Ga0157377_10246557 | Ga0157377_102465572 | 131 |
| 326 | 3300014969 | Ga0157376_10105119 | Ga0157376_101051192 | 131 |
| 327 | 3300014969 | Ga0157376_10133587 | Ga0157376_101335872 | 131 |
| 328 | 3300014969 | Ga0157376_10814479 | Ga0157376_108144792 | 131 |
| 329 | 3300025885 | Ga0207653_10012100 | Ga0207653_100121004 | 131 |
| 330 | 3300025885 | Ga0207653_10116829 | Ga0207653_101168292 | 131 |
| 331 | 3300025898 | Ga0207692_10462171 | Ga0207692_104621712 | 131 |
| 332 | 3300025899 | Ga0207642_10028143 | Ga0207642_100281432 | 131 |
| 333 | 3300025901 | Ga0207688_10793980 | Ga0207688_107939801 | 131 |
| 334 | 3300025907 | Ga0207645_10058527 | Ga0207645_100585272 | 131 |
| 335 | 3300025908 | Ga0207643_10055492 | Ga0207643_100554922 | 131 |
| 336 | 3300025908 | Ga0207643_10073660 | Ga0207643_100736602 | 131 |
| 337 | 3300025908 | Ga0207643_10129279 | Ga0207643_101292792 | 131 |
| 338 | 3300025911 | Ga0207654_10323293 | Ga0207654_103232931 | 131 |
| 339 | 3300025912 | Ga0207707_10580787 | Ga0207707_105807872 | 131 |
| 340 | 3300025916 | Ga0207663_11270701 | Ga0207663_112707011 | 131 |
| 341 | 3300025917 | Ga0207660_10061693 | Ga0207660_100616933 | 131 |
| 342 | 3300025917 | Ga0207660_10201382 | Ga0207660_102013822 | 131 |
| 343 | 3300025917 | Ga0207660_10234177 | Ga0207660_102341772 | 131 |
| 344 | 3300025917 | Ga0207660_11418754 | Ga0207660_114187542 | 131 |
| 345 | 3300025918 | Ga0207662_10000110 | Ga0207662_1000011038 | 131 |
| 346 | 3300025918 | Ga0207662_10210781 | Ga0207662_102107812 | 131 |
| 347 | 3300025921 | Ga0207652_10105016 | Ga0207652_101050163 | 131 |
| 348 | 3300025922 | Ga0207646_10352686 | Ga0207646_103526862 | 131 |
| 349 | 3300025922 | Ga0207646_10651153 | Ga0207646_106511532 | 131 |
| 350 | 3300025926 | Ga0207659_10024907 | Ga0207659_100249073 | 131 |
| 351 | 3300025926 | Ga0207659_10533073 | Ga0207659_105330732 | 131 |
| 352 | 3300025927 | Ga0207687_10027468 | Ga0207687_100274682 | 131 |
| 353 | 3300025929 | Ga0207664_10210879 | Ga0207664_102108792 | 131 |
| 354 | 3300025931 | Ga0207644_10485751 | Ga0207644_104857512 | 131 |
| 355 | 3300025933 | Ga0207706_10519113 | Ga0207706_105191132 | 131 |
| 356 | 3300025933 | Ga0207706_10915187 | Ga0207706_109151871 | 131 |
| 357 | 3300025935 | Ga0207709_10003963 | Ga0207709_100039634 | 131 |
| 358 | 3300025936 | Ga0207670_10001969 | Ga0207670_100019693 | 131 |
| 359 | 3300025936 | Ga0207670_10081697 | Ga0207670_100816972 | 131 |
| 360 | 3300025936 | Ga0207670_10102930 | Ga0207670_101029303 | 131 |
| 361 | 3300025936 | Ga0207670_10278294 | Ga0207670_102782942 | 131 |
| 362 | 3300025936 | Ga0207670_10915875 | Ga0207670_109158752 | 131 |
| 363 | 3300025938 | Ga0207704_10002884 | Ga0207704_100028842 | 131 |
| 364 | 3300025938 | Ga0207704_10305933 | Ga0207704_103059333 | 131 |
| 365 | 3300025939 | Ga0207665_10655714 | Ga0207665_106557142 | 131 |
| 366 | 3300025939 | Ga0207665_10897017 | Ga0207665_108970172 | 131 |
| 367 | 3300025940 | Ga0207691_10234423 | Ga0207691_102344232 | 131 |
| 368 | 3300025942 | Ga0207689_10006996 | Ga0207689_100069963 | 131 |
| 369 | 3300025942 | Ga0207689_10056573 | Ga0207689_100565734 | 131 |
| 370 | 3300025949 | Ga0207667_10044504 | Ga0207667_100445043 | 131 |
| 371 | 3300025949 | Ga0207667_10488260 | Ga0207667_104882602 | 131 |
| 372 | 3300025960 | Ga0207651_10165724 | Ga0207651_101657242 | 131 |
| 373 | 3300025960 | Ga0207651_10355994 | Ga0207651_103559942 | 131 |
| 374 | 3300025981 | Ga0207640_10124454 | Ga0207640_101244543 | 131 |
| 375 | 3300025981 | Ga0207640_11934422 | Ga0207640_119344222 | 131 |
| 376 | 3300026023 | Ga0207677_10047524 | Ga0207677_100475242 | 131 |
| 377 | 3300026023 | Ga0207677_10659034 | Ga0207677_106590342 | 131 |
| 378 | 3300026035 | Ga0207703_10045480 | Ga0207703_100454803 | 131 |
| 379 | 3300026075 | Ga0207708_10006584 | Ga0207708_100065843 | 131 |
| 380 | 3300026075 | Ga0207708_10187933 | Ga0207708_101879332 | 131 |
| 381 | 3300026078 | Ga0207702_10388489 | Ga0207702_103884892 | 131 |
| 382 | 3300026088 | Ga0207641_10467913 | Ga0207641_104679132 | 131 |
| 383 | 3300026088 | Ga0207641_10659087 | Ga0207641_106590872 | 131 |
| 384 | 3300026089 | Ga0207648_10001025 | Ga0207648_100010256 | 131 |
| 385 | 3300026089 | Ga0207648_10029600 | Ga0207648_100296004 | 131 |
| 386 | 3300026089 | Ga0207648_11309733 | Ga0207648_113097332 | 131 |
| 387 | 3300026095 | Ga0207676_10027624 | Ga0207676_100276243 | 131 |
| 388 | 3300026116 | Ga0207674_10287035 | Ga0207674_102870352 | 131 |
| 389 | 3300026118 | Ga0207675_100005378 | Ga0207675_10000537812 | 131 |
| 390 | 3300026118 | Ga0207675_100005981 | Ga0207675_1000059816 | 131 |
| 391 | 3300026118 | Ga0207675_100134757 | Ga0207675_1001347572 | 131 |
| 392 | 3300026118 | Ga0207675_100296453 | Ga0207675_1002964532 | 131 |
| 393 | 3300026121 | Ga0207683_10567092 | Ga0207683_105670922 | 131 |
| 394 | 3300026142 | Ga0207698_11423686 | Ga0207698_114236862 | 131 |
| 395 | 3300027360 | Ga0209969_1029605 | Ga0209969_10296052 | 131 |
| 396 | 3300027364 | Ga0209967_1000306 | Ga0209967_10003061 | 131 |
| 397 | 3300027378 | Ga0209981_1005511 | Ga0209981_10055112 | 131 |
| 398 | 3300027462 | Ga0210000_1005821 | Ga0210000_10058212 | 131 |
| 399 | 3300027462 | Ga0210000_1008946 | Ga0210000_10089462 | 131 |
| 400 | 3300027471 | Ga0209995_1016044 | Ga0209995_10160442 | 131 |
| 401 | 3300027471 | Ga0209995_1061830 | Ga0209995_10618302 | 131 |
| 402 | 3300027543 | Ga0209999_1009943 | Ga0209999_10099432 | 131 |
| 403 | 3300027543 | Ga0209999_1019295 | Ga0209999_10192952 | 131 |
| 404 | 3300027671 | Ga0209588_1015516 | Ga0209588_10155163 | 131 |
| 405 | 3300027682 | Ga0209971_1020839 | Ga0209971_10208392 | 131 |
| 406 | 3300027695 | Ga0209966_1006695 | Ga0209966_10066952 | 131 |
| 407 | 3300027907 | Ga0207428_10155375 | Ga0207428_101553752 | 131 |
| 408 | 3300027907 | Ga0207428_10232569 | Ga0207428_102325692 | 131 |
| 409 | 3300028380 | Ga0268265_10041489 | Ga0268265_100414893 | 131 |
| 410 | 3300028380 | Ga0268265_10483989 | Ga0268265_104839892 | 131 |
| 411 | 3300028380 | Ga0268265_10763644 | Ga0268265_107636442 | 131 |
| 412 | 3300028381 | Ga0268264_10059685 | Ga0268264_100596852 | 131 |
| 413 | 3300028381 | Ga0268264_11426392 | Ga0268264_114263922 | 131 |
| 414 | 3300031548 | Ga0307408_100323497 | Ga0307408_1003234972 | 131 |
| 415 | 3300031548 | Ga0307408_101388735 | Ga0307408_1013887352 | 131 |
| 416 | 3300031691 | Ga0316579_10005614 | Ga0316579_100056145 | 131 |
| 417 | 3300031731 | Ga0307405_10313158 | Ga0307405_103131582 | 131 |
| 418 | 3300031731 | Ga0307405_11355342 | Ga0307405_113553422 | 131 |
| 419 | 3300031824 | Ga0307413_10419453 | Ga0307413_104194532 | 131 |
| 420 | 3300031852 | Ga0307410_10972283 | Ga0307410_109722832 | 131 |
| 421 | 3300031911 | Ga0307412_10082296 | Ga0307412_100822962 | 131 |
| 422 | 3300031911 | Ga0307412_10624557 | Ga0307412_106245572 | 131 |
| 423 | 3300031995 | Ga0307409_100120641 | Ga0307409_1001206414 | 131 |
| 424 | 3300031995 | Ga0307409_101974181 | Ga0307409_1019741812 | 131 |
| 425 | 3300032002 | Ga0307416_100150202 | Ga0307416_1001502022 | 131 |
| 426 | 3300032002 | Ga0307416_100259564 | Ga0307416_1002595642 | 131 |
| 427 | 3300032002 | Ga0307416_100338885 | Ga0307416_1003388852 | 131 |
| 428 | 3300032002 | Ga0307416_100540611 | Ga0307416_1005406112 | 131 |
| 429 | 3300032002 | Ga0307416_100683485 | Ga0307416_1006834852 | 131 |
| 430 | 3300032002 | Ga0307416_101687942 | Ga0307416_1016879422 | 131 |
| 431 | 3300032002 | Ga0307416_102390712 | Ga0307416_1023907122 | 131 |
| 432 | 3300032005 | Ga0307411_10513741 | Ga0307411_105137412 | 131 |
| 433 | 3300032133 | Ga0316583_10017222 | Ga0316583_100172224 | 131 |
| 434 | 3300032133 | Ga0316583_10088371 | Ga0316583_100883712 | 131 |
| 435 | 3300034957 | Ga0373938_0083255 | Ga0373938_0083255_348_743 | 131 |
| 436 | 3300034957 | Ga0373938_0101291 | Ga0373938_0101291_283_678 | 131 |
| 437 | 3300035083 | Ga0373926_0001668 | Ga0373926_0001668_6238_6633 | 131 |
| 438 | 3300035084 | Ga0373928_0114796 | Ga0373928_0114796_72_467 | 131 |
| 439 | 3300035085 | Ga0373929_0241720 | Ga0373929_0241720_103_507 | 131 |
| 440 | 3300035088 | Ga0373940_0003072 | Ga0373940_0003072_1254_1649 | 131 |
| 441 | 3300035089 | Ga0373944_0010854 | Ga0373944_0010854_662_1057 | 131 |
| 442 | 3300035090 | Ga0373949_0020008 | Ga0373949_0020008_553_948 | 131 |
| 443 | 3300035090 | Ga0373949_0086592 | Ga0373949_0086592_267_662 | 131 |
| 444 | 3300035091 | Ga0373951_0012149 | Ga0373951_0012149_980_1375 | 131 |
| 445 | 3300035092 | Ga0373952_0002445 | Ga0373952_0002445_1466_1861 | 131 |
| 446 | 3300035111 | Ga0373923_0054740 | Ga0373923_0054740_160_564 | 131 |
| 447 | 3300035111 | Ga0373923_0163207 | Ga0373923_0163207_509_904 | 131 |
| 448 | 3300035112 | Ga0373932_0006117 | Ga0373932_0006117_692_1087 | 131 |
| 449 | 3300035112 | Ga0373932_0114064 | Ga0373932_0114064_76_471 | 131 |
| 450 | 3300035112 | Ga0373932_0196321 | Ga0373932_0196321_182_577 | 131 |
| 451 | 3300035113 | Ga0373936_0086985 | Ga0373936_0086985_649_1044 | 131 |
| 452 | 3300035113 | Ga0373936_0370277 | Ga0373936_0370277_122_517 | 131 |
| 453 | 3300035114 | Ga0373939_0002793 | Ga0373939_0002793_246_641 | 131 |
| 454 | 3300035114 | Ga0373939_0075738 | Ga0373939_0075738_94_498 | 131 |
| 455 | 3300035115 | Ga0373941_0009434 | Ga0373941_0009434_478_873 | 131 |
| 456 | 3300035115 | Ga0373941_0141188 | Ga0373941_0141188_260_655 | 131 |
| 457 | 3300035115 | Ga0373941_0267043 | Ga0373941_0267043_228_623 | 131 |
| 458 | 3300035116 | Ga0373945_0003844 | Ga0373945_0003844_657_1052 | 131 |
| 459 | 3300035117 | Ga0373953_0053659 | Ga0373953_0053659_248_643 | 131 |
| 460 | 3300035118 | Ga0373954_0000028 | Ga0373954_0000028_41366_41761 | 131 |
| 461 | 3300035119 | Ga0373956_0068551 | Ga0373956_0068551_1192_1587 | 131 |
| 462 | 3300035121 | Ga0373960_0014621 | Ga0373960_0014621_622_1017 | 131 |
| 463 | 3300035121 | Ga0373960_0047523 | Ga0373960_0047523_62_457 | 131 |
| 464 | 3300035121 | Ga0373960_0353600 | Ga0373960_0353600_110_535 | 131 |
| 465 | 3300035170 | Ga0373943_0056794 | Ga0373943_0056794_294_689 | 131 |
| 466 | 3300035170 | Ga0373943_0069707 | Ga0373943_0069707_667_1062 | 131 |
| 467 | 3300035171 | Ga0373946_0008098 | Ga0373946_0008098_825_1220 | 131 |
| 468 | 3300035171 | Ga0373946_0035782 | Ga0373946_0035782_967_1362 | 131 |
| 469 | 3300035172 | Ga0373955_0009467 | Ga0373955_0009467_274_678 | 131 |
| 470 | 3300035172 | Ga0373955_0040471 | Ga0373955_0040471_1943_2338 | 131 |
| 471 | 3300035207 | Ga0373942_0089602 | Ga0373942_0089602_107_511 | 131 |
| 472 | 3300035207 | Ga0373942_0097501 | Ga0373942_0097501_58_453 | 131 |
| 473 | 3300035241 | Ga0373961_0009409 | Ga0373961_0009409_1148_1543 | 131 |
| 474 | 3300035241 | Ga0373961_0058152 | Ga0373961_0058152_298_702 | 131 |
| 475 | 3300035241 | Ga0373961_0415760 | Ga0373961_0415760_57_455 | 131 |
| 476 | 3300035410 | Ga0373924_0117818 | Ga0373924_0117818_312_716 | 131 |
| 477 | 3300035410 | Ga0373924_0192973 | Ga0373924_0192973_10_405 | 131 |
| 478 | 3300035410 | Ga0373924_0259368 | Ga0373924_0259368_160_555 | 131 |
| 479 | 3300035691 | Ga0373931_0001811 | Ga0373931_0001811_8842_9237 | 131 |
| 480 | 3300035691 | Ga0373931_0062651 | Ga0373931_0062651_1424_1828 | 131 |
| 481 | 3300035691 | Ga0373931_0103402 | Ga0373931_0103402_270_665 | 131 |
| 482 | 3300035691 | Ga0373931_0257773 | Ga0373931_0257773_79_477 | 131 |
| 483 | 3300035691 | Ga0373931_0271663 | Ga0373931_0271663_212_607 | 131 |
| 484 | 3300035691 | Ga0373931_1194730 | Ga0373931_1194730_22_447 | 131 |
| 485 | 3300035692 | Ga0373935_0016908 | Ga0373935_0016908_2305_2700 | 131 |
| 486 | 3300035695 | Ga0373927_0010069 | Ga0373927_0010069_1816_2211 | 131 |
| 487 | 3300035724 | Ga0373933_0023783 | Ga0373933_0023783_634_1038 | 131 |
| 488 | 3300035724 | Ga0373933_0024952 | Ga0373933_0024952_2461_2856 | 131 |
| 489 | 3300035725 | Ga0373947_0031901 | Ga0373947_0031901_345_740 | 131 |
| 490 | 3300035725 | Ga0373947_0102081 | Ga0373947_0102081_677_1072 | 131 |
| 491 | 3300035725 | Ga0373947_0918492 | Ga0373947_0918492_28_423 | 131 |
| 492 | 3300035725 | Ga0373947_1062996 | Ga0373947_1062996_124_528 | 131 |
| 493 | 3300036401 | Ga0373937_0001199 | Ga0373937_0001199_4266_4661 | 131 |
| 494 | 3300036401 | Ga0373937_0043315 | Ga0373937_0043315_1192_1596 | 131 |
| 495 | 3300037068 | Ga0373925_0021316 | Ga0373925_0021316_661_1056 | 131 |
| 496 | 3300037588 | Ga0316581_0075503 | Ga0316581_0075503_102_527 | 131 |
| 497 | 3300041406 | Ga0439439_0148895 | Ga0439439_0148895_11_406 | 131 |
| 498 | 3300041408 | Ga0439453_0001076 | Ga0439453_0001076_764_1159 | 131 |
| 499 | 3300041486 | Ga0451807_0627795 | Ga0451807_0627795_1503_1907 | 131 |
| 500 | 3300041997 | Ga0439431_0093512 | Ga0439431_0093512_89_484 | 131 |
| 501 | 3300041999 | Ga0439433_0126486 | Ga0439433_0126486_229_624 | 131 |
| 502 | 3300042013 | Ga0439456_048392 | Ga0439456_048392_244_639 | 131 |
| 503 | 3300042157 | Ga0439458_0095305 | Ga0439458_0095305_319_714 | 131 |
| 504 | 3300042435 | Ga0439434_0005692 | Ga0439434_0005692_259_654 | 131 |
| 505 | 3300042436 | Ga0439435_0001116 | Ga0439435_0001116_3994_4389 | 131 |
| 506 | 3300042436 | Ga0439435_0063885 | Ga0439435_0063885_561_956 | 131 |
| 507 | 3300042436 | Ga0439435_0101712 | Ga0439435_0101712_101_514 | 131 |
| 508 | 3300042437 | Ga0439444_0003523 | Ga0439444_0003523_1468_1863 | 131 |
| 509 | 3300042437 | Ga0439444_0057543 | Ga0439444_0057543_153_548 | 131 |
| 510 | 3300042461 | Ga0439460_0000526 | Ga0439460_0000526_7459_7854 | 131 |
| 511 | 3300042531 | Ga0450918_037022 | Ga0450918_037022_340_735 | 131 |
| 512 | 3300042532 | Ga0450893_0044890 | Ga0450893_0044890_204_605 | 131 |
| 513 | 3300042876 | Ga0451577_0193255 | Ga0451577_0193255_92_487 | 131 |
| 514 | 3300042876 | Ga0451577_1765589 | Ga0451577_1765589_105_500 | 131 |
| 515 | 3300044673 | Ga0453683_0481556 | Ga0453683_0481556_291_698 | 131 |
| 516 | 3300044673 | Ga0453683_1152746 | Ga0453683_1152746_80_493 | 131 |
| 517 | 3300044706 | Ga0466964_0916964 | Ga0466964_0916964_46_447 | 131 |
| 518 | 3300044901 | Ga0466960_0374563 | Ga0466960_0374563_289_684 | 131 |
| 519 | 3300045051 | Ga0451576_0009574 | Ga0451576_0009574_105_500 | 131 |
| 520 | 3300045051 | Ga0451576_0026461 | Ga0451576_0026461_522_917 | 131 |
| 521 | 3300045051 | Ga0451576_0050035 | Ga0451576_0050035_713_1108 | 131 |
| 522 | 3300045051 | Ga0451576_0111234 | Ga0451576_0111234_198_611 | 131 |
| 523 | 3300045051 | Ga0451576_0130916 | Ga0451576_0130916_1697_2092 | 131 |
| 524 | 3300045051 | Ga0451576_0132216 | Ga0451576_0132216_1373_1768 | 131 |
| 525 | 3300045051 | Ga0451576_0468176 | Ga0451576_0468176_680_1087 | 131 |
| 526 | 3300045051 | Ga0451576_1125936 | Ga0451576_1125936_193_591 | 131 |
| 527 | 3300045051 | Ga0451576_1306375 | Ga0451576_1306375_320_715 | 131 |
| 528 | 3300045051 | Ga0451576_1739017 | Ga0451576_1739017_96_491 | 131 |
| 529 | 3300045836 | Ga0466958_0184619 | Ga0466958_0184619_351_746 | 131 |
| 530 | 3300045976 | Ga0466967_0001877 | Ga0466967_0001877_2470_2865 | 131 |
| 531 | 3300046454 | Ga0495592_0583919 | Ga0495592_0583919_50_454 | 131 |
| 532 | 3300046455 | Ga0495603_0075190 | Ga0495603_0075190_494_889 | 131 |
| 533 | 3300046462 | Ga0495651_0260646 | Ga0495651_0260646_531_926 | 131 |
| 534 | 3300046472 | Ga0495580_0022250 | Ga0495580_0022250_4035_4430 | 131 |
| 535 | 3300046475 | Ga0495639_0032900 | Ga0495639_0032900_1153_1548 | 131 |
| 536 | 3300046477 | Ga0495664_0137853 | Ga0495664_0137853_934_1338 | 131 |
| 537 | 3300046499 | Ga0495594_0061586 | Ga0495594_0061586_1496_1891 | 131 |
| 538 | 3300046511 | Ga0495608_0203145 | Ga0495608_0203145_668_1063 | 131 |
| 539 | 3300046516 | Ga0495628_1214818 | Ga0495628_1214818_12_416 | 131 |
| 540 | 3300046526 | Ga0495666_0022861 | Ga0495666_0022861_521_916 | 131 |
| 541 | 3300046531 | Ga0495665_0176962 | Ga0495665_0176962_71_466 | 131 |
| 542 | 3300046535 | Ga0495586_0009470 | Ga0495586_0009470_2468_2863 | 131 |
| 543 | 3300046537 | Ga0495598_0254348 | Ga0495598_0254348_130_525 | 131 |
| 544 | 3300046538 | Ga0495609_0444313 | Ga0495609_0444313_61_456 | 131 |
| 545 | 3300046539 | Ga0495621_0186669 | Ga0495621_0186669_192_590 | 131 |
| 546 | 3300046539 | Ga0495621_0236985 | Ga0495621_0236985_169_564 | 131 |
| 547 | 3300046559 | Ga0495667_0186941 | Ga0495667_0186941_590_994 | 131 |
| 548 | 3300046615 | Ga0495656_0152189 | Ga0495656_0152189_709_1104 | 131 |
| 549 | 3300046663 | Ga0495635_0432834 | Ga0495635_0432834_226_630 | 131 |
| 550 | 3300046664 | Ga0495659_0023464 | Ga0495659_0023464_203_598 | 131 |
| 551 | 3300046674 | Ga0495588_0050293 | Ga0495588_0050293_618_1013 | 131 |
| 552 | 3300046675 | Ga0495657_0084499 | Ga0495657_0084499_808_1203 | 131 |
| 553 | 3300046679 | Ga0495623_0531752 | Ga0495623_0531752_84_479 | 131 |
| 554 | 3300046681 | Ga0495647_0000776 | Ga0495647_0000776_8077_8472 | 131 |
| 555 | 3300046683 | Ga0495658_0103694 | Ga0495658_0103694_853_1248 | 131 |
| 556 | 3300046684 | Ga0495669_0122826 | Ga0495669_0122826_681_1076 | 131 |
| 557 | 3300047317 | Ga0495604_0441724 | Ga0495604_0441724_68_463 | 131 |
| 558 | 3300047317 | Ga0495604_0723344 | Ga0495604_0723344_160_564 | 131 |
| 559 | 3300047318 | Ga0495636_0542830 | Ga0495636_0542830_123_536 | 131 |
| 560 | 3300047319 | Ga0495674_0353399 | Ga0495674_0353399_115_519 | 131 |
| 561 | 3300047321 | Ga0495676_0516363 | Ga0495676_0516363_225_620 | 131 |
| 562 | 3300047322 | Ga0495680_0101441 | Ga0495680_0101441_770_1174 | 131 |
| 563 | 3300047444 | Ga0495675_0262560 | Ga0495675_0262560_523_918 | 131 |
| 564 | 3300049521 | Ga0501298_108933 | Ga0501298_108933_119_514 | 131 |
| 565 | 3300049522 | Ga0501299_028701 | Ga0501299_028701_636_1031 | 131 |
| 566 | 3300049522 | Ga0501299_209041 | Ga0501299_209041_101_496 | 131 |
| 567 | 3300049568 | Ga0501031_0100824 | Ga0501031_0100824_900_1295 | 131 |
| 568 | 3300049568 | Ga0501031_0547852 | Ga0501031_0547852_194_589 | 131 |
| 569 | 3300049570 | Ga0501033_0777852 | Ga0501033_0777852_161_556 | 131 |
| 570 | 3300049572 | Ga0501036_0097488 | Ga0501036_0097488_143_538 | 131 |
| 571 | 3300049572 | Ga0501036_0480845 | Ga0501036_0480845_26_421 | 131 |
| 572 | 3300049572 | Ga0501036_1113491 | Ga0501036_1113491_119_514 | 131 |
| 573 | 3300049572 | Ga0501036_1698377 | Ga0501036_1698377_20_415 | 131 |
| 574 | 3300049573 | Ga0501037_0554453 | Ga0501037_0554453_14_409 | 131 |
| 575 | 3300049574 | Ga0501038_0648140 | Ga0501038_0648140_269_664 | 131 |
| 576 | 3300049574 | Ga0501038_1138075 | Ga0501038_1138075_87_482 | 131 |
| 577 | 3300049575 | Ga0501039_0041323 | Ga0501039_0041323_698_1093 | 131 |
| 578 | 3300049575 | Ga0501039_0075897 | Ga0501039_0075897_1581_1976 | 131 |
| 579 | 3300049575 | Ga0501039_0082947 | Ga0501039_0082947_1041_1436 | 131 |
| 580 | 3300049576 | Ga0501040_0030565 | Ga0501040_0030565_2335_2730 | 131 |
| 581 | 3300049576 | Ga0501040_0136343 | Ga0501040_0136343_484_879 | 131 |
| 582 | 3300049576 | Ga0501040_0203466 | Ga0501040_0203466_223_618 | 131 |
| 583 | 3300049577 | Ga0501041_0125174 | Ga0501041_0125174_620_1015 | 131 |
| 584 | 3300049577 | Ga0501041_0476101 | Ga0501041_0476101_215_610 | 131 |
| 585 | 3300049578 | Ga0501042_0120236 | Ga0501042_0120236_893_1288 | 131 |
| 586 | 3300049578 | Ga0501042_0358663 | Ga0501042_0358663_268_663 | 131 |
| 587 | 3300049578 | Ga0501042_0418088 | Ga0501042_0418088_320_715 | 131 |
| 588 | 3300049579 | Ga0501043_0338490 | Ga0501043_0338490_637_1032 | 131 |
| 589 | 3300049580 | Ga0501046_0207868 | Ga0501046_0207868_738_1133 | 131 |
| 590 | 3300049580 | Ga0501046_0789840 | Ga0501046_0789840_189_596 | 131 |
| 591 | 3300049582 | Ga0501048_0046947 | Ga0501048_0046947_2143_2538 | 131 |
| 592 | 3300049582 | Ga0501048_0208786 | Ga0501048_0208786_628_1023 | 131 |
| 593 | 3300049582 | Ga0501048_0596671 | Ga0501048_0596671_199_594 | 131 |
| 594 | 3300049584 | Ga0501068_0690709 | Ga0501068_0690709_52_447 | 131 |
| 595 | 3300049585 | Ga0501069_0631699 | Ga0501069_0631699_78_473 | 131 |
| 596 | 3300049586 | Ga0501070_1059041 | Ga0501070_1059041_168_563 | 131 |
| 597 | 3300049587 | Ga0501071_0322060 | Ga0501071_0322060_477_872 | 131 |
| 598 | 3300049587 | Ga0501071_0408595 | Ga0501071_0408595_99_494 | 131 |
| 599 | 3300049587 | Ga0501071_1537671 | Ga0501071_1537671_40_435 | 131 |
| 600 | 3300049588 | Ga0501072_0136067 | Ga0501072_0136067_1191_1586 | 131 |
| 601 | 3300049588 | Ga0501072_0409190 | Ga0501072_0409190_56_451 | 131 |
| 602 | 3300049588 | Ga0501072_0452321 | Ga0501072_0452321_519_914 | 131 |
| 603 | 3300049588 | Ga0501072_0589166 | Ga0501072_0589166_350_745 | 131 |
| 604 | 3300049588 | Ga0501072_0928142 | Ga0501072_0928142_154_549 | 131 |
| 605 | 3300049590 | Ga0501074_0171059 | Ga0501074_0171059_217_612 | 131 |
| 606 | 3300049590 | Ga0501074_0651862 | Ga0501074_0651862_277_672 | 131 |
| 607 | 3300049591 | Ga0501075_0023756 | Ga0501075_0023756_2636_3031 | 131 |
| 608 | 3300049591 | Ga0501075_0990944 | Ga0501075_0990944_163_558 | 131 |
| 609 | 3300049592 | Ga0501076_0131949 | Ga0501076_0131949_938_1333 | 131 |
| 610 | 3300049592 | Ga0501076_0485268 | Ga0501076_0485268_324_719 | 131 |
| 611 | 3300049592 | Ga0501076_0597789 | Ga0501076_0597789_340_735 | 131 |
| 612 | 3300049593 | Ga0501077_0286710 | Ga0501077_0286710_553_948 | 131 |
| 613 | 3300049656 | Ga0501209_149947 | Ga0501209_149947_241_636 | 131 |
| 614 | 3300049668 | Ga0501233_025851 | Ga0501233_025851_638_1033 | 131 |
| 615 | 3300049705 | Ga0501225_0064879 | Ga0501225_0064879_442_837 | 131 |
| 616 | 3300049741 | Ga0501079_0139368 | Ga0501079_0139368_211_606 | 131 |
| 617 | 3300049741 | Ga0501079_0424736 | Ga0501079_0424736_377_772 | 131 |
| 618 | 3300049741 | Ga0501079_1047708 | Ga0501079_1047708_92_487 | 131 |
| 619 | 3300049743 | Ga0501081_0067853 | Ga0501081_0067853_2000_2395 | 131 |
| 620 | 3300049743 | Ga0501081_0388225 | Ga0501081_0388225_440_835 | 131 |
| 621 | 3300049744 | Ga0501083_0806542 | Ga0501083_0806542_146_541 | 131 |
| 622 | 3300049822 | Ga0501035_1464312 | Ga0501035_1464312_46_441 | 131 |
| 623 | 3300049824 | Ga0501045_0012663 | Ga0501045_0012663_2192_2587 | 131 |
| 624 | 3300049824 | Ga0501045_0157129 | Ga0501045_0157129_788_1183 | 131 |
| 625 | 3300049824 | Ga0501045_0589161 | Ga0501045_0589161_227_622 | 131 |
| 626 | 3300049850 | Ga0501204_051297 | Ga0501204_051297_114_509 | 131 |
| 627 | 3300050507 | nmdc:mga05p37_1414500_c1 | nmdc:mga05p37_1414500_c1_13_408 | 131 |
| 628 | 3300050507 | nmdc:mga05p37_28485_c1 | nmdc:mga05p37_28485_c1_1249_1644 | 131 |
| 629 | 3300050507 | nmdc:mga05p37_445_c1 | nmdc:mga05p37_445_c1_6253_6666 | 131 |
| 630 | 3300050507 | nmdc:mga05p37_479260_c1 | nmdc:mga05p37_479260_c1_217_612 | 131 |
| 631 | 3300050507 | nmdc:mga05p37_515766_c1 | nmdc:mga05p37_515766_c1_311_706 | 131 |
| 632 | 3300050507 | nmdc:mga05p37_712_c1 | nmdc:mga05p37_712_c1_10675_11070 | 131 |
| 633 | 3300050507 | nmdc:mga05p37_971965_c1 | nmdc:mga05p37_971965_c1_143_538 | 131 |
| 634 | 3300050508 | nmdc:mga09592_102197_c1 | nmdc:mga09592_102197_c1_633_1028 | 131 |
| 635 | 3300050508 | nmdc:mga09592_116376_c1 | nmdc:mga09592_116376_c1_1304_1699 | 131 |
| 636 | 3300050508 | nmdc:mga09592_118_c1 | nmdc:mga09592_118_c1_38740_39153 | 131 |
| 637 | 3300050508 | nmdc:mga09592_134796_c1 | nmdc:mga09592_134796_c1_1282_1677 | 131 |
| 638 | 3300050508 | nmdc:mga09592_1745376_c1 | nmdc:mga09592_1745376_c1_95_490 | 131 |
| 639 | 3300050508 | nmdc:mga09592_496_c1 | nmdc:mga09592_496_c1_9853_10248 | 131 |
| 640 | 3300050509 | nmdc:mga0qj67_654625_c1 | nmdc:mga0qj67_654625_c1_228_623 | 131 |
| 641 | 3300050509 | nmdc:mga0qj67_779477_c1 | nmdc:mga0qj67_779477_c1_284_679 | 131 |
| 642 | 3300050510 | nmdc:mga06r32_17949_c1 | nmdc:mga06r32_17949_c1_1472_1885 | 131 |
| 643 | 3300050510 | nmdc:mga06r32_18701_c1 | nmdc:mga06r32_18701_c1_2961_3374 | 131 |
| 644 | 3300050510 | nmdc:mga06r32_209471_c1 | nmdc:mga06r32_209471_c1_535_930 | 131 |
| 645 | 3300050510 | nmdc:mga06r32_60743_c1 | nmdc:mga06r32_60743_c1_1491_1886 | 131 |
| 646 | 3300050510 | nmdc:mga06r32_835358_c1 | nmdc:mga06r32_835358_c1_322_717 | 131 |
| 647 | 3300050511 | nmdc:mga08y16_162923_c1 | nmdc:mga08y16_162923_c1_1531_1926 | 131 |
| 648 | 3300050511 | nmdc:mga08y16_32621_c1 | nmdc:mga08y16_32621_c1_1398_1793 | 131 |
| 649 | 3300050511 | nmdc:mga08y16_34152_c1 | nmdc:mga08y16_34152_c1_609_1004 | 131 |
| 650 | 3300050511 | nmdc:mga08y16_612669_c1 | nmdc:mga08y16_612669_c1_175_570 | 131 |
| 651 | 3300050512 | nmdc:mga0n895_1108_c1 | nmdc:mga0n895_1108_c1_8365_8760 | 131 |
| 652 | 3300050512 | nmdc:mga0n895_1527_c1 | nmdc:mga0n895_1527_c1_13564_13959 | 131 |
| 653 | 3300050512 | nmdc:mga0n895_39818_c1 | nmdc:mga0n895_39818_c1_2663_3103 | 131 |
| 654 | 3300050513 | nmdc:mga0rr50_2902_c1 | nmdc:mga0rr50_2902_c1_5359_5754 | 131 |
| 655 | 3300050513 | nmdc:mga0rr50_37680_c1 | nmdc:mga0rr50_37680_c1_1623_2018 | 131 |
| 656 | 3300050514 | nmdc:mga08x19_1007480_c1 | nmdc:mga08x19_1007480_c1_80_475 | 131 |
| 657 | 3300050514 | nmdc:mga08x19_106982_c1 | nmdc:mga08x19_106982_c1_471_866 | 131 |
| 658 | 3300050514 | nmdc:mga08x19_1218441_c1 | nmdc:mga08x19_1218441_c1_65_490 | 131 |
| 659 | 3300050514 | nmdc:mga08x19_16842_c1 | nmdc:mga08x19_16842_c1_2799_3197 | 131 |
| 660 | 3300050514 | nmdc:mga08x19_176432_c1 | nmdc:mga08x19_176432_c1_408_803 | 131 |
| 661 | 3300050514 | nmdc:mga08x19_264418_c1 | nmdc:mga08x19_264418_c1_401_796 | 131 |
| 662 | 3300050514 | nmdc:mga08x19_639_c2 | nmdc:mga08x19_639_c2_4617_5012 | 131 |
| 663 | 3300050514 | nmdc:mga08x19_7012_c1 | nmdc:mga08x19_7012_c1_865_1260 | 131 |
| 664 | 3300050515 | nmdc:mga0a205_165465_c1 | nmdc:mga0a205_165465_c1_1089_1484 | 131 |
| 665 | 3300050515 | nmdc:mga0a205_189685_c1 | nmdc:mga0a205_189685_c1_1498_1893 | 131 |
| 666 | 3300050515 | nmdc:mga0a205_2500_c1 | nmdc:mga0a205_2500_c1_8349_8744 | 131 |
| 667 | 3300050515 | nmdc:mga0a205_600391_c1 | nmdc:mga0a205_600391_c1_471_866 | 131 |
| 668 | 3300050515 | nmdc:mga0a205_659087_c1 | nmdc:mga0a205_659087_c1_293_688 | 131 |
| 669 | 3300050515 | nmdc:mga0a205_75085_c1 | nmdc:mga0a205_75085_c1_1988_2383 | 131 |
| 670 | 3300054114 | Ga0501084_0042590 | Ga0501084_0042590_3247_3642 | 131 |
| 671 | 3300054114 | Ga0501084_0673225 | Ga0501084_0673225_451_846 | 131 |
| 672 | 3300054114 | Ga0501084_0750330 | Ga0501084_0750330_412_807 | 131 |
| 673 | 3300054114 | Ga0501084_1311624 | Ga0501084_1311624_196_591 | 131 |
| 674 | 3300059421 | Ga0590071_065313 | Ga0590071_065313_388_783 | 131 |
| 675 | 3300059426 | Ga0590077_020785 | Ga0590077_020785_896_1291 | 131 |
| 676 | 3300060353 | Ga0501082_0332696 | Ga0501082_0332696_625_1020 | 131 |
| 677 | 3300061734 | Ga0530510_0114121 | Ga0530510_0114121_165_560 | 131 |
| 678 | 3300061734 | Ga0530510_0251986 | Ga0530510_0251986_862_1257 | 131 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1zki-assembly1.cif.gz_B | structure of conserved protein pa5202 from pseudomonas aeruginosa | 0.9508 | 12 | 129 |
| 3dkz-assembly1.cif.gz_A | crystal structure of the q7w9w5_borpa protein from bordetella parapertussis. northeast structural genomics consortium target bpr208c. | 0.9454 | 12 | 128 |
| 3nwz-assembly2.cif.gz_C | crystal structure of bh2602 protein from bacillus halodurans with coa, northeast structural genomics consortium target bhr199 | 0.9417 | 31 | 128 |
| 3nwz-assembly3.cif.gz_D | crystal structure of bh2602 protein from bacillus halodurans with coa, northeast structural genomics consortium target bhr199 | 0.9381 | 32 | 128 |
| 3gek-assembly2.cif.gz_A | crystal structure of putative thioesterase yhda from lactococcus lactis. northeast structural genomics consortium target kr113 | 0.9282 | 29 | 129 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1zkiB00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9483 | 12 | 129 | 3.10.129.10 |
| 3dkzB00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9431 | 12 | 128 | 3.10.129.10 |
| 3nwzD00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9216 | 32 | 128 | 3.10.129.10 |
| af_Q9M2E4_49_183_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9175 | 20 | 128 | 3.10.129.10 |
| af_A0A1D6F200_19_155_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9156 | 19 | 131 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522VK87-F1-model_v4 | PaaI family thioesterase | 0.9891 | 1 | 131 |
GO:0016790
|
| AF-A0A522VK87-F1-model_v4 | PaaI family thioesterase | 0.9816 | 1 | 131 |
GO:0016790
|
| AF-A0A3B8X8Z3-F1-model_v4 | PaaI family thioesterase | 0.9768 | 1 | 130 |
GO:0016289
|
| AF-A0A2V7CWB0-F1-model_v4 | Phenylacetic acid degradation protein | 0.9752 | 1 | 131 |
|
| AF-A0A843SGM2-F1-model_v4 | PaaI family thioesterase | 0.9752 | 2 | 131 |
GO:0016790
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar