F474591

General Info

Members Datasets Scaffolds Average Seq Length
677 204 1354 267

Family's Representative Sequence

Representative Sequence 3300031241|Ga0265325_10103886|Ga0265325_101038861
Length 276
Sequence MPTDFHIVVCAGIVPDPLQTLEPTTGPNGPGIKNEMVLPAVLDPWAASALYEAANLAAKQQGSKVWLVSLGPKAKLQQVMMSVAQKVSFELVPVDGPIGGFPDAQATAAVLADAIAVIPGLDRERLLVFGGWESATRGAGVTLQLVGERLGIADQFQGVDAIDIRPDGPNAGSFEVLERVEGGRHQVSVCAGAPAVLGWATGNLAEPRNNPQVGMANMRTIMPALQKAKTVALEANGLHYVSVSLPKQQRTTRVEKNMSADEIASELVAWIGQDSQ

Samples

Sample ID Description Type Environment
1 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
113 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
114 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
115 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
116 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
117 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
118 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
119 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
122 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
123 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
124 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
125 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
126 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
127 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
128 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
129 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
133 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
136 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
139 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
140 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
142 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
143 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
144 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
154 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
155 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
165 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
166 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
171 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
172 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
179 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
180 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
188 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
189 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
190 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
202 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
203 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.95
Rhizosphere 96.9
Stem 0
Stem Tuber 0
Unclassified 11.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265325_10103886 3300031241 Bacteria 1388
2 rootH1_10300435 3300003323 Bacteria 1222
3 Ga0070658_10070224 3300005327 Bacteria 2867
4 Ga0070658_10247563 3300005327 Bacteria 1512
5 Ga0070683_100000026 3300005329 Bacteria 172308
6 Ga0070683_100000282 3300005329 Bacteria 34970
7 Ga0070683_100143624 3300005329 Bacteria 2261
8 Ga0070670_100110957 3300005331 Bacteria 2363
9 Ga0068869_100013385 3300005334 Bacteria 5456
10 Ga0070680_100009538 3300005336 Bacteria 7456
11 Ga0068868_100080216 3300005338 Bacteria 2615
12 Ga0070660_100010134 3300005339 Bacteria 6651
13 Ga0070661_100008281 3300005344 Bacteria 7177
14 Ga0070661_100019455 3300005344 Bacteria 4839
15 Ga0070661_100055414 3300005344 Unclassified 2903
16 Ga0070661_100274250 3300005344 Bacteria 1307
17 Ga0070671_100044626 3300005355 Bacteria 3684
18 Ga0070671_100054642 3300005355 Bacteria 3320
19 Ga0070671_100117457 3300005355 Bacteria 2237
20 Ga0070673_100124177 3300005364 Bacteria 2158
21 Ga0070667_100003517 3300005367 Bacteria 13342
22 Ga0070667_100299946 3300005367 Bacteria 1446
23 Ga0070714_100001263 3300005435 Bacteria 18267
24 Ga0070714_100224754 3300005435 Bacteria 1727
25 Ga0070714_100333092 3300005435 Unclassified 1422
26 Ga0070713_100003077 3300005436 Bacteria 10965
27 Ga0070713_100004121 3300005436 Bacteria 9691
28 Ga0070713_100014155 3300005436 Bacteria 5911
29 Ga0070713_100124300 3300005436 Bacteria 2267
30 Ga0070713_100552905 3300005436 Bacteria 1090
31 Ga0070711_100004372 3300005439 Bacteria 8326
32 Ga0070662_100052314 3300005457 Bacteria 2951
33 Ga0070681_10001126 3300005458 Bacteria 22953
34 Ga0070681_10134513 3300005458 Unclassified 2403
35 Ga0070679_100043017 3300005530 Bacteria 4499
36 Ga0070684_100000012 3300005535 Bacteria 167850
37 Ga0070684_100001159 3300005535 Bacteria 18932
38 Ga0070684_100035397 3300005535 Bacteria 4274
39 Ga0070684_100043481 3300005535 Bacteria 3880
40 Ga0070684_100129547 3300005535 Unclassified 2275
41 Ga0070684_100190297 3300005535 Bacteria 1867
42 Ga0070684_100589636 3300005535 Bacteria 1033
43 Ga0068853_100000333 3300005539 Bacteria 33063
44 Ga0070693_100032934 3300005547 Bacteria 2855
45 Ga0070665_100230401 3300005548 Bacteria 1852
46 Ga0070665_100423398 3300005548 Bacteria 1340
47 Ga0068855_100003357 3300005563 Bacteria 19600
48 Ga0068855_100008795 3300005563 Bacteria 12205
49 Ga0068855_100044214 3300005563 Bacteria 5272
50 Ga0068855_100058817 3300005563 Bacteria 4499
51 Ga0068855_100121476 3300005563 Bacteria 2989
52 Ga0068855_100162780 3300005563 Bacteria 2531
53 Ga0068855_100543661 3300005563 Bacteria 1258
54 Ga0070664_100086357 3300005564 Bacteria 2711
55 Ga0070664_100243088 3300005564 Bacteria 1616
56 Ga0068857_100009334 3300005577 Bacteria 8516
57 Ga0068857_100017542 3300005577 Bacteria 6276
58 Ga0068857_100104551 3300005577 Bacteria 2542
59 Ga0068857_100305271 3300005577 Bacteria 1468
60 Ga0068854_100070484 3300005578 Unclassified 2555
61 Ga0068854_100113105 3300005578 Unclassified 2050
62 Ga0068856_100002161 3300005614 Bacteria 20367
63 Ga0068856_100008946 3300005614 Bacteria 9741
64 Ga0068856_100036509 3300005614 Unclassified 4818
65 Ga0068856_100048288 3300005614 Bacteria 4193
66 Ga0068856_100048644 3300005614 Unclassified 4179
67 Ga0068856_100085783 3300005614 Bacteria 3128
68 Ga0068856_100099309 3300005614 Bacteria 2902
69 Ga0068856_100317802 3300005614 Bacteria 1574
70 Ga0068852_100000017 3300005616 Bacteria 132313
71 Ga0068852_100000676 3300005616 Bacteria 22371
72 Ga0068852_100027078 3300005616 Bacteria 4668
73 Ga0068852_100055695 3300005616 Bacteria 3414
74 Ga0068852_100191176 3300005616 Bacteria 1932
75 Ga0068852_100273533 3300005616 Bacteria 1626
76 Ga0068852_100618775 3300005616 Bacteria 1088
77 Ga0068859_100002738 3300005617 Bacteria 17886
78 Ga0068859_100088276 3300005617 Bacteria 3150
79 Ga0068864_100015071 3300005618 Bacteria 6425
80 Ga0068864_100272506 3300005618 Bacteria 1577
81 Ga0068851_10004801 3300005834 Bacteria 6117
82 Ga0068851_10010464 3300005834 Bacteria 4333
83 Ga0068851_10010677 3300005834 Bacteria 4290
84 Ga0068851_10154891 3300005834 Bacteria 1255
85 Ga0068863_100003424 3300005841 Bacteria 15637
86 Ga0068863_100068396 3300005841 Bacteria 3360
87 Ga0068863_100082246 3300005841 Bacteria 3051
88 Ga0068858_100022417 3300005842 Bacteria 5894
89 Ga0068858_100053026 3300005842 Bacteria 3753
90 Ga0068860_100013582 3300005843 Bacteria 7984
91 Ga0068860_100061644 3300005843 Bacteria 3563
92 Ga0070717_10025158 3300006028 Bacteria 4730
93 Ga0070717_10044393 3300006028 Unclassified 3629
94 Ga0070717_10364564 3300006028 Bacteria 1294
95 Ga0070712_100226454 3300006175 Bacteria 1483
96 Ga0097621_100011678 3300006237 Bacteria 6481
97 Ga0097621_100042117 3300006237 Bacteria 3677
98 Ga0068871_100001265 3300006358 Bacteria 16909
99 Ga0068871_100005801 3300006358 Bacteria 8676
100 Ga0068871_100084969 3300006358 Bacteria 2626
101 Ga0068871_100194692 3300006358 Bacteria 1747
102 Ga0068865_100108440 3300006881 Bacteria 2044
103 Ga0097620_100002738 3300006931 Bacteria 17886
104 Ga0097620_100088276 3300006931 Bacteria 3150
105 Ga0075435_100540917 3300007076 Bacteria 1008
106 Ga0105240_10000110 3300009093 Bacteria 171018
107 Ga0105240_10000480 3300009093 Bacteria 73703
108 Ga0105240_10001244 3300009093 Bacteria 44183
109 Ga0105240_10002039 3300009093 Bacteria 33267
110 Ga0105240_10012029 3300009093 Bacteria 11997
111 Ga0105240_10040023 3300009093 Bacteria 6000
112 Ga0105240_10045967 3300009093 Bacteria 5535
113 Ga0105240_10199660 3300009093 Bacteria 2345
114 Ga0105240_10661669 3300009093 Unclassified 1144
115 Ga0105240_10662789 3300009093 Bacteria 1142
116 Ga0105245_10070406 3300009098 Bacteria 3174
117 Ga0105245_10097181 3300009098 Bacteria 2719
118 Ga0105245_10525834 3300009098 Bacteria 1202
119 Ga0105247_10006855 3300009101 Bacteria 7021
120 Ga0105247_10081049 3300009101 Bacteria 2045
121 Ga0105243_10624078 3300009148 Bacteria 1041
122 Ga0105241_10000029 3300009174 Bacteria 125929
123 Ga0105241_10002831 3300009174 Bacteria 12960
124 Ga0105241_10022106 3300009174 Bacteria 4709
125 Ga0105241_10134819 3300009174 Bacteria 2003
126 Ga0105248_10000795 3300009177 Bacteria 35418
127 Ga0105248_10012989 3300009177 Bacteria 9180
128 Ga0105248_10032082 3300009177 Bacteria 5870
129 Ga0105237_10055987 3300009545 Bacteria 3949
130 Ga0105237_10181772 3300009545 Unclassified 2103
131 Ga0105237_10498497 3300009545 Bacteria 1224
132 Ga0105237_10935165 3300009545 Bacteria 874
133 Ga0105238_10001519 3300009551 Bacteria 23247
134 Ga0105238_10001766 3300009551 Bacteria 21684
135 Ga0105238_10002101 3300009551 Bacteria 20125
136 Ga0105238_10004609 3300009551 Bacteria 13639
137 Ga0105238_10017870 3300009551 Bacteria 7210
138 Ga0105238_10041491 3300009551 Bacteria 4660
139 Ga0105238_10061243 3300009551 Bacteria 3766
140 Ga0105238_10083687 3300009551 Bacteria 3180
141 Ga0105238_10094726 3300009551 Bacteria 2974
142 Ga0105238_10362012 3300009551 Bacteria 1440
143 Ga0105249_10097785 3300009553 Bacteria 2756
144 Ga0105239_10003049 3300010375 Bacteria 20822
145 Ga0105239_10045617 3300010375 Bacteria 4804
146 Ga0105239_10165532 3300010375 Bacteria 2472
147 Ga0105246_10025249 3300011119 Bacteria 3872
148 Ga0105246_10235091 3300011119 Bacteria 1445
149 Ga0157373_10284507 3300013100 Bacteria 1172
150 Ga0157371_10027189 3300013102 Bacteria 4151
151 Ga0157370_10000001 3300013104 Bacteria 529517
152 Ga0157370_10037285 3300013104 Bacteria 4713
153 Ga0157370_10397729 3300013104 Bacteria 1268
154 Ga0157369_10000017 3300013105 Bacteria 246520
155 Ga0157369_10004443 3300013105 Bacteria 16534
156 Ga0157369_10016885 3300013105 Bacteria 8203
157 Ga0157369_10022931 3300013105 Bacteria 6961
158 Ga0157369_10044167 3300013105 Bacteria 4851
159 Ga0157369_10046360 3300013105 Bacteria 4724
160 Ga0157369_10048827 3300013105 Bacteria 4591
161 Ga0157369_10117357 3300013105 Bacteria 2825
162 Ga0157369_10129399 3300013105 Bacteria 2676
163 Ga0157369_10173038 3300013105 Bacteria 2274
164 Ga0157369_10214732 3300013105 Bacteria 2015
165 Ga0157369_10284798 3300013105 Unclassified 1721
166 Ga0157369_10295934 3300013105 Bacteria 1684
167 Ga0157374_10004278 3300013296 Bacteria 12009
168 Ga0157374_10071725 3300013296 Bacteria 3267
169 Ga0157374_10180701 3300013296 Bacteria 2060
170 Ga0157374_10370701 3300013296 Unclassified 1425
171 Ga0157374_10404351 3300013296 Bacteria 1362
172 Ga0157374_10495840 3300013296 Unclassified 1225
173 Ga0157378_10003524 3300013297 Bacteria 13877
174 Ga0157378_10145171 3300013297 Bacteria 2207
175 Ga0157378_10283379 3300013297 Bacteria 1598
176 Ga0163162_10014850 3300013306 Bacteria 7605
177 Ga0163162_10405498 3300013306 Unclassified 1496
178 Ga0157372_10000019 3300013307 Bacteria 209591
179 Ga0157372_10000581 3300013307 Bacteria 39954
180 Ga0157372_10005466 3300013307 Bacteria 13499
181 Ga0157372_10009465 3300013307 Bacteria 10361
182 Ga0157372_10034116 3300013307 Bacteria 5593
183 Ga0157372_10062821 3300013307 Unclassified 4162
184 Ga0157372_10142348 3300013307 Unclassified 2764
185 Ga0157372_10556255 3300013307 Bacteria 1337
186 Ga0157375_10006666 3300013308 Bacteria 10055
187 Ga0157375_10399610 3300013308 Bacteria 1541
188 Ga0157375_10469888 3300013308 Bacteria 1423
189 Ga0163163_10001460 3300014325 Bacteria 19976
190 Ga0163163_10028986 3300014325 Bacteria 5322
191 Ga0163163_10111040 3300014325 Bacteria 2771
192 Ga0157377_10294552 3300014745 Bacteria 1069
193 Ga0157379_10000374 3300014968 Bacteria 36109
194 Ga0157379_10293998 3300014968 Bacteria 1480
195 Ga0157376_10018547 3300014969 Bacteria 5338
196 Ga0157376_10044688 3300014969 Bacteria 3642
197 Ga0157376_10391400 3300014969 Unclassified 1341
198 Ga0163161_10025447 3300017792 Bacteria 4188
199 Ga0207656_10018482 3300025321 Unclassified 2746
200 Ga0207656_10113338 3300025321 Unclassified 1255
201 Ga0207692_10335605 3300025898 Bacteria 928
202 Ga0207710_10118473 3300025900 Bacteria 1262
203 Ga0207680_10340012 3300025903 Bacteria 1053
204 Ga0207647_10014446 3300025904 Bacteria 5442
205 Ga0207645_10101381 3300025907 Bacteria 1858
206 Ga0207705_10058262 3300025909 Bacteria 2787
207 Ga0207705_10092803 3300025909 Bacteria 2212
208 Ga0207654_10000039 3300025911 Bacteria 105913
209 Ga0207654_10000268 3300025911 Bacteria 31847
210 Ga0207654_10021293 3300025911 Bacteria 3446
211 Ga0207654_10059899 3300025911 Bacteria 2223
212 Ga0207707_10004693 3300025912 Bacteria 11999
213 Ga0207707_10211157 3300025912 Unclassified 1691
214 Ga0207695_10000026 3300025913 Bacteria 624558
215 Ga0207695_10000161 3300025913 Bacteria 199839
216 Ga0207695_10000252 3300025913 Bacteria 139109
217 Ga0207695_10001781 3300025913 Bacteria 33978
218 Ga0207695_10002510 3300025913 Bacteria 26966
219 Ga0207695_10008556 3300025913 Bacteria 12788
220 Ga0207695_10048591 3300025913 Bacteria 4480
221 Ga0207695_10071828 3300025913 Bacteria 3534
222 Ga0207695_10116151 3300025913 Bacteria 2650
223 Ga0207695_10159389 3300025913 Bacteria 2189
224 Ga0207695_10189703 3300025913 Bacteria 1973
225 Ga0207671_10000082 3300025914 Bacteria 146424
226 Ga0207671_10000512 3300025914 Bacteria 52517
227 Ga0207671_10273204 3300025914 Bacteria 1332
228 Ga0207663_10000900 3300025916 Bacteria 13557
229 Ga0207663_10003963 3300025916 Bacteria 7326
230 Ga0207660_10007894 3300025917 Bacteria 6888
231 Ga0207657_10010018 3300025919 Bacteria 9481
232 Ga0207649_10145098 3300025920 Bacteria 1628
233 Ga0207649_10347752 3300025920 Bacteria 1096
234 Ga0207652_10013526 3300025921 Bacteria 6601
235 Ga0207694_10000246 3300025924 Bacteria 51904
236 Ga0207694_10001021 3300025924 Bacteria 24393
237 Ga0207694_10001303 3300025924 Bacteria 21502
238 Ga0207694_10045135 3300025924 Bacteria 3404
239 Ga0207694_10059504 3300025924 Bacteria 2971
240 Ga0207694_10067515 3300025924 Bacteria 2791
241 Ga0207694_10325143 3300025924 Bacteria 1270
242 Ga0207650_10025708 3300025925 Bacteria 4196
243 Ga0207687_10005794 3300025927 Bacteria 8174
244 Ga0207700_10004998 3300025928 Bacteria 7884
245 Ga0207700_10061834 3300025928 Unclassified 2841
246 Ga0207664_10178872 3300025929 Bacteria 1820
247 Ga0207664_10505747 3300025929 Unclassified 1082
248 Ga0207690_10542099 3300025932 Unclassified 945
249 Ga0207706_10003046 3300025933 Bacteria 16157
250 Ga0207704_10160849 3300025938 Bacteria 1597
251 Ga0207691_10100702 3300025940 Bacteria 2579
252 Ga0207711_10001763 3300025941 Bacteria 19822
253 Ga0207711_10043637 3300025941 Bacteria 3826
254 Ga0207711_10093524 3300025941 Bacteria 2648
255 Ga0207689_10001661 3300025942 Bacteria 21097
256 Ga0207661_10000003 3300025944 Bacteria 611941
257 Ga0207661_10000513 3300025944 Bacteria 25043
258 Ga0207661_10207101 3300025944 Bacteria 1727
259 Ga0207679_10069769 3300025945 Bacteria 2646
260 Ga0207679_10557697 3300025945 Bacteria 1028
261 Ga0207667_10000059 3300025949 Bacteria 192543
262 Ga0207667_10002596 3300025949 Bacteria 22424
263 Ga0207667_10023670 3300025949 Bacteria 6761
264 Ga0207667_10078235 3300025949 Bacteria 3428
265 Ga0207667_10181686 3300025949 Bacteria 2160
266 Ga0207667_10193833 3300025949 Unclassified 2085
267 Ga0207667_10253239 3300025949 Bacteria 1801
268 Ga0207667_10376192 3300025949 Bacteria 1447
269 Ga0207667_10398389 3300025949 Unclassified 1402
270 Ga0207667_10433352 3300025949 Bacteria 1337
271 Ga0207667_10448394 3300025949 Bacteria 1311
272 Ga0207651_10537030 3300025960 Bacteria 1015
273 Ga0207640_10054940 3300025981 Unclassified 2606
274 Ga0207640_10151157 3300025981 Unclassified 1706
275 Ga0207658_10032306 3300025986 Bacteria 3724
276 Ga0207658_10402335 3300025986 Bacteria 1204
277 Ga0207658_10496630 3300025986 Bacteria 1086
278 Ga0207677_10001213 3300026023 Bacteria 13936
279 Ga0207703_10181264 3300026035 Bacteria 1859
280 Ga0207703_10717731 3300026035 Bacteria 951
281 Ga0207639_10000152 3300026041 Bacteria 52289
282 Ga0207639_10066440 3300026041 Bacteria 2803
283 Ga0207639_10333189 3300026041 Unclassified 1351
284 Ga0207639_10555483 3300026041 Bacteria 1054
285 Ga0207702_10006929 3300026078 Bacteria 9707
286 Ga0207702_10018638 3300026078 Bacteria 5742
287 Ga0207702_10300887 3300026078 Bacteria 1522
288 Ga0207702_10386633 3300026078 Archaea 1346
289 Ga0207702_10548004 3300026078 Bacteria 1131
290 Ga0207702_10589631 3300026078 Bacteria 1090
291 Ga0207641_10012272 3300026088 Bacteria 7030
292 Ga0207641_10116645 3300026088 Bacteria 2376
293 Ga0207641_10253580 3300026088 Bacteria 1644
294 Ga0207641_10510616 3300026088 Bacteria 1168
295 Ga0207676_10156323 3300026095 Unclassified 1970
296 Ga0207676_10360497 3300026095 Bacteria 1347
297 Ga0207674_10002375 3300026116 Bacteria 23799
298 Ga0207674_10012549 3300026116 Bacteria 9466
299 Ga0207674_10109412 3300026116 Bacteria 2739
300 Ga0207683_10023334 3300026121 Bacteria 5321
301 Ga0207698_10000050 3300026142 Bacteria 88275
302 Ga0207698_10002490 3300026142 Bacteria 10925
303 Ga0207698_10012576 3300026142 Bacteria 5545
304 Ga0207698_10041243 3300026142 Bacteria 3437
305 Ga0207698_10404723 3300026142 Bacteria 1305
306 Ga0207698_10538299 3300026142 Bacteria 1142
307 Ga0268266_10118314 3300028379 Unclassified 2355
308 Ga0268266_10133988 3300028379 Bacteria 2218
309 Ga0268266_10158418 3300028379 Unclassified 2047
310 Ga0268266_10872374 3300028379 Bacteria 870
311 Ga0268264_10050359 3300028381 Bacteria 3468
312 Ga0265337_1000188 3300028556 Bacteria 32521
313 Ga0265337_1000324 3300028556 Bacteria 25503
314 Ga0265337_1002557 3300028556 Bacteria 8282
315 Ga0265337_1006670 3300028556 Bacteria 4411
316 Ga0265337_1011931 3300028556 Bacteria 2975
317 Ga0265337_1027583 3300028556 Bacteria 1711
318 Ga0265326_10044194 3300028558 Bacteria 1264
319 Ga0265326_10064467 3300028558 Bacteria 1036
320 Ga0265326_10070864 3300028558 Bacteria 985
321 Ga0265319_1012804 3300028563 Bacteria 3370
322 Ga0265334_10001402 3300028573 Bacteria 11601
323 Ga0265334_10041293 3300028573 Bacteria 1804
324 Ga0265334_10119091 3300028573 Unclassified 944
325 Ga0265318_10007337 3300028577 Bacteria 4992
326 Ga0265318_10008245 3300028577 Bacteria 4652
327 Ga0265323_10000084 3300028653 Bacteria 53536
328 Ga0265323_10000536 3300028653 Bacteria 21048
329 Ga0265323_10000688 3300028653 Bacteria 18398
330 Ga0265323_10003780 3300028653 Bacteria 6601
331 Ga0265323_10018891 3300028653 Bacteria 2663
332 Ga0265323_10022245 3300028653 Bacteria 2424
333 Ga0265323_10024054 3300028653 Bacteria 2318
334 Ga0265323_10025382 3300028653 Bacteria 2244
335 Ga0265323_10037987 3300028653 Unclassified 1762
336 Ga0265322_10028989 3300028654 Unclassified 1581
337 Ga0265336_10000240 3300028666 Bacteria 39084
338 Ga0265336_10002723 3300028666 Bacteria 7151
339 Ga0265336_10006394 3300028666 Bacteria 4247
340 Ga0265336_10010484 3300028666 Bacteria 3173
341 Ga0265338_10000237 3300028800 Bacteria 101850
342 Ga0265338_10000556 3300028800 Bacteria 65347
343 Ga0265338_10000789 3300028800 Bacteria 53624
344 Ga0265338_10000810 3300028800 Bacteria 52720
345 Ga0265338_10001431 3300028800 Bacteria 38817
346 Ga0265338_10004391 3300028800 Bacteria 19076
347 Ga0265338_10004396 3300028800 Bacteria 19066
348 Ga0265338_10004961 3300028800 Bacteria 17629
349 Ga0265338_10006143 3300028800 Bacteria 15415
350 Ga0265338_10008146 3300028800 Bacteria 12788
351 Ga0265338_10010139 3300028800 Bacteria 11113
352 Ga0265338_10010928 3300028800 Bacteria 10553
353 Ga0265338_10018070 3300028800 Bacteria 7566
354 Ga0265338_10023748 3300028800 Bacteria 6289
355 Ga0265338_10024129 3300028800 Bacteria 6224
356 Ga0265338_10026625 3300028800 Bacteria 5825
357 Ga0265338_10035847 3300028800 Bacteria 4758
358 Ga0265338_10058183 3300028800 Bacteria 3414
359 Ga0265338_10062938 3300028800 Bacteria 3239
360 Ga0265338_10101226 3300028800 Bacteria 2346
361 Ga0265338_10113204 3300028800 Bacteria 2180
362 Ga0265338_10144490 3300028800 Bacteria 1858
363 Ga0265338_10188873 3300028800 Viruses 1563
364 Ga0265338_10346820 3300028800 Unclassified 1069
365 Ga0265324_10000475 3300029957 Bacteria 28206
366 Ga0265324_10000734 3300029957 Bacteria 21854
367 Ga0265324_10008241 3300029957 Bacteria 4154
368 Ga0265324_10063746 3300029957 Bacteria 1258
369 Ga0265324_10111901 3300029957 Unclassified 927
370 Ga0265330_10000180 3300031235 Bacteria 48901
371 Ga0265330_10002956 3300031235 Bacteria 9051
372 Ga0265330_10005425 3300031235 Bacteria 6358
373 Ga0265330_10022078 3300031235 Bacteria 2900
374 Ga0265330_10038742 3300031235 Bacteria 2119
375 Ga0265330_10042738 3300031235 Bacteria 2007
376 Ga0265330_10044042 3300031235 Bacteria 1972
377 Ga0265330_10089065 3300031235 Bacteria 1326
378 Ga0265332_10023040 3300031238 Bacteria 2746
379 Ga0265332_10111877 3300031238 Bacteria 1150
380 Ga0265328_10009260 3300031239 Unclassified 4017
381 Ga0265328_10011808 3300031239 Unclassified 3484
382 Ga0265328_10032569 3300031239 Bacteria 1935
383 Ga0265328_10045590 3300031239 Bacteria 1612
384 Ga0265328_10074849 3300031239 Bacteria 1246
385 Ga0265320_10000188 3300031240 Bacteria 51229
386 Ga0265320_10000816 3300031240 Bacteria 23497
387 Ga0265320_10009797 3300031240 Bacteria 5746
388 Ga0265320_10042500 3300031240 Bacteria 2254
389 Ga0265320_10051024 3300031240 Bacteria 2009
390 Ga0265320_10148377 3300031240 Bacteria 1060
391 Ga0265320_10154666 3300031240 Unclassified 1035
392 Ga0265325_10000086 3300031241 Bacteria 64912
393 Ga0265325_10003105 3300031241 Bacteria 10966
394 Ga0265325_10011002 3300031241 Bacteria 5210
395 Ga0265325_10012548 3300031241 Bacteria 4842
396 Ga0265325_10028281 3300031241 Bacteria 3024
397 Ga0265325_10059284 3300031241 Unclassified 1946
398 Ga0265325_10077361 3300031241 Bacteria 1658
399 Ga0265325_10078477 3300031241 Bacteria 1644
400 Ga0265325_10101905 3300031241 Bacteria 1404
401 Ga0265329_10001542 3300031242 Bacteria 11029
402 Ga0265340_10004974 3300031247 Bacteria 7389
403 Ga0265340_10010689 3300031247 Bacteria 4904
404 Ga0265340_10012229 3300031247 Bacteria 4536
405 Ga0265340_10015868 3300031247 Bacteria 3907
406 Ga0265340_10041705 3300031247 Bacteria 2255
407 Ga0265340_10050942 3300031247 Bacteria 2006
408 Ga0265340_10068903 3300031247 Bacteria 1679
409 Ga0265340_10073130 3300031247 Bacteria 1623
410 Ga0265340_10092428 3300031247 Bacteria 1413
411 Ga0265339_10000003 3300031249 Bacteria 305994
412 Ga0265339_10000870 3300031249 Bacteria 23232
413 Ga0265339_10007801 3300031249 Bacteria 6875
414 Ga0265339_10012119 3300031249 Bacteria 5278
415 Ga0265339_10027013 3300031249 Bacteria 3283
416 Ga0265339_10028998 3300031249 Bacteria 3143
417 Ga0265339_10047867 3300031249 Bacteria 2347
418 Ga0265339_10068233 3300031249 Bacteria 1901
419 Ga0265339_10106817 3300031249 Archaea 1452
420 Ga0265339_10165086 3300031249 Bacteria 1112
421 Ga0265331_10015387 3300031250 Unclassified 4040
422 Ga0265331_10034859 3300031250 Bacteria 2480
423 Ga0265331_10037776 3300031250 Unclassified 2363
424 Ga0265331_10104103 3300031250 Bacteria 1305
425 Ga0265327_10014147 3300031251 Bacteria 5238
426 Ga0265327_10020540 3300031251 Bacteria 4019
427 Ga0265327_10061992 3300031251 Bacteria 1905
428 Ga0265316_10003058 3300031344 Bacteria 17083
429 Ga0265316_10003587 3300031344 Bacteria 15644
430 Ga0265316_10004340 3300031344 Bacteria 14132
431 Ga0265316_10006710 3300031344 Bacteria 10968
432 Ga0265316_10012932 3300031344 Bacteria 7448
433 Ga0265316_10014044 3300031344 Bacteria 7072
434 Ga0265316_10018447 3300031344 Bacteria 5995
435 Ga0265316_10020951 3300031344 Bacteria 5550
436 Ga0265316_10023806 3300031344 Bacteria 5142
437 Ga0265316_10030079 3300031344 Bacteria 4457
438 Ga0265316_10030617 3300031344 Bacteria 4408
439 Ga0265316_10033205 3300031344 Unclassified 4205
440 Ga0265316_10055430 3300031344 Bacteria 3100
441 Ga0265316_10071883 3300031344 Bacteria 2666
442 Ga0265316_10076303 3300031344 Bacteria 2575
443 Ga0265316_10084284 3300031344 Bacteria 2434
444 Ga0265316_10093140 3300031344 Bacteria 2296
445 Ga0265316_10098617 3300031344 Bacteria 2223
446 Ga0265316_10108586 3300031344 Bacteria 2103
447 Ga0265316_10149681 3300031344 Bacteria 1749
448 Ga0265316_10185464 3300031344 Bacteria 1548
449 Ga0265316_10195811 3300031344 Bacteria 1500
450 Ga0265316_10288995 3300031344 Bacteria 1196
451 Ga0265313_10003145 3300031595 Bacteria 13623
452 Ga0265313_10006106 3300031595 Bacteria 8667
453 Ga0265313_10009943 3300031595 Bacteria 6105
454 Ga0265313_10012004 3300031595 Bacteria 5338
455 Ga0265313_10014760 3300031595 Bacteria 4595
456 Ga0265313_10022667 3300031595 Bacteria 3400
457 Ga0265313_10037336 3300031595 Bacteria 2430
458 Ga0316575_10000074 3300031665 Bacteria 24489
459 Ga0265314_10000047 3300031711 Bacteria 194061
460 Ga0265314_10000148 3300031711 Bacteria 105207
461 Ga0265314_10000509 3300031711 Bacteria 50279
462 Ga0265314_10001672 3300031711 Bacteria 24160
463 Ga0265314_10026386 3300031711 Bacteria 4365
464 Ga0265314_10040681 3300031711 Bacteria 3334
465 Ga0265314_10112883 3300031711 Unclassified 1724
466 Ga0265314_10216913 3300031711 Bacteria 1119
467 Ga0265314_10238984 3300031711 Bacteria 1049
468 Ga0265342_10000208 3300031712 Bacteria 66250
469 Ga0265342_10000451 3300031712 Bacteria 44943
470 Ga0265342_10003573 3300031712 Bacteria 12704
471 Ga0265342_10005582 3300031712 Bacteria 9538
472 Ga0265342_10006053 3300031712 Bacteria 9080
473 Ga0265342_10037262 3300031712 Bacteria 2966
474 Ga0265342_10045795 3300031712 Bacteria 2631
475 Ga0265342_10067191 3300031712 Bacteria 2098
476 Ga0265342_10071188 3300031712 Bacteria 2027
477 Ga0265342_10088660 3300031712 Bacteria 1776
478 Ga0265342_10110768 3300031712 Unclassified 1554
479 Ga0316576_10130968 3300031727 Bacteria 1887
480 Ga0316576_10132643 3300031727 Bacteria 1874
481 Ga0307416_100093022 3300032002 Bacteria 2596
482 Ga0373934_0011219 3300035086 Bacteria 3372
483 Ga0373934_0028820 3300035086 Unclassified 2166
484 Ga0373951_0007969 3300035091 Bacteria 2401
485 Ga0373936_0016469 3300035113 Unclassified 2844
486 Ga0373945_0019674 3300035116 Bacteria 2307
487 Ga0373953_0010066 3300035117 Bacteria 3278
488 Ga0373954_0025316 3300035118 Bacteria 2712
489 Ga0373954_0061639 3300035118 Unclassified 1770
490 Ga0373956_0062388 3300035119 Bacteria 1689
491 Ga0373956_0143864 3300035119 Bacteria 1120
492 Ga0373956_0239729 3300035119 Unclassified 862
493 Ga0373943_0147917 3300035170 Bacteria 1271
494 Ga0373935_0037860 3300035692 Bacteria 3019
495 Ga0373927_0297629 3300035695 Unclassified 1062
496 Ga0373933_0062085 3300035724 Bacteria 2256
497 Ga0373947_0041759 3300035725 Unclassified 2736
498 Ga0373947_0366302 3300035725 Unclassified 969
499 Ga0373937_0013533 3300036401 Bacteria 7185
500 Ga0373937_0155753 3300036401 Bacteria 2141
501 Ga0373937_0296849 3300036401 Bacteria 1527
502 Ga0373937_0667596 3300036401 Bacteria 985
503 Ga0373925_0006624 3300037068 Bacteria 8512
504 Ga0373925_0448723 3300037068 Bacteria 1056
505 Ga0451577_0000063 3300042876 Bacteria 264379
506 Ga0451577_0001897 3300042876 Bacteria 26518
507 Ga0451577_0004611 3300042876 Bacteria 14477
508 Ga0451577_0009052 3300042876 Bacteria 9610
509 Ga0451577_0021043 3300042876 Bacteria 5976
510 Ga0451577_0025593 3300042876 Bacteria 5352
511 Ga0451577_0054561 3300042876 Bacteria 3567
512 Ga0451577_0060929 3300042876 Bacteria 3364
513 Ga0451577_0063111 3300042876 Bacteria 3304
514 Ga0451577_0091297 3300042876 Bacteria 2718
515 Ga0451577_0196676 3300042876 Bacteria 1820
516 Ga0451577_0201185 3300042876 Bacteria 1798
517 Ga0451577_0310086 3300042876 Bacteria 1430
518 Ga0451577_0328553 3300042876 Bacteria 1387
519 Ga0451577_0346855 3300042876 Bacteria 1347
520 Ga0451577_0354827 3300042876 Bacteria 1330
521 Ga0451577_0403618 3300042876 Bacteria 1241
522 Ga0451577_0435997 3300042876 Bacteria 1190
523 Ga0451577_0440833 3300042876 Bacteria 1182
524 Ga0451577_0537353 3300042876 Bacteria 1061
525 Ga0451577_0586208 3300042876 Bacteria 1012
526 Ga0451577_0668536 3300042876 Bacteria 941
527 Ga0451577_0887828 3300042876 Bacteria 803
528 Ga0451577_0890353 3300042876 Bacteria 802
529 Ga0453683_0000114 3300044673 Bacteria 119864
530 Ga0453683_0000390 3300044673 Bacteria 52382
531 Ga0453683_0001084 3300044673 Bacteria 25080
532 Ga0453683_0196619 3300044673 Bacteria 1280
533 Ga0453683_0237104 3300044673 Bacteria 1161
534 Ga0453683_0285883 3300044673 Bacteria 1054
535 Ga0453683_0319890 3300044673 Bacteria 994
536 Ga0453683_0523685 3300044673 Bacteria 770
537 Ga0466961_0067036 3300044693 Unclassified 2280
538 Ga0466963_0020464 3300044694 Unclassified 4161
539 Ga0453684_0000198 3300044712 Bacteria 264379
540 Ga0453684_0000266 3300044712 Bacteria 225447
541 Ga0453684_0000417 3300044712 Bacteria 173793
542 Ga0453684_0000455 3300044712 Bacteria 165080
543 Ga0453684_0000725 3300044712 Bacteria 116265
544 Ga0453684_0001063 3300044712 Bacteria 87449
545 Ga0453684_0001817 3300044712 Bacteria 56194
546 Ga0453684_0002936 3300044712 Bacteria 39991
547 Ga0453684_0003575 3300044712 Bacteria 34707
548 Ga0453684_0007772 3300044712 Bacteria 19566
549 Ga0453684_0011217 3300044712 Bacteria 15085
550 Ga0453684_0011768 3300044712 Bacteria 14584
551 Ga0453684_0013310 3300044712 Bacteria 13386
552 Ga0453684_0016077 3300044712 Bacteria 11743
553 Ga0453684_0018573 3300044712 Bacteria 10658
554 Ga0453684_0022113 3300044712 Bacteria 9457
555 Ga0453684_0025700 3300044712 Bacteria 8538
556 Ga0453684_0030196 3300044712 Bacteria 7664
557 Ga0453684_0059446 3300044712 Bacteria 4927
558 Ga0453684_0110608 3300044712 Bacteria 3339
559 Ga0453684_0114896 3300044712 Bacteria 3262
560 Ga0453684_0166078 3300044712 Bacteria 2605
561 Ga0453684_0290292 3300044712 Bacteria 1863
562 Ga0453684_0298544 3300044712 Bacteria 1832
563 Ga0453684_0318226 3300044712 Bacteria 1763
564 Ga0453684_0370341 3300044712 Bacteria 1610
565 Ga0453684_0472854 3300044712 Bacteria 1392
566 Ga0453684_0585638 3300044712 Bacteria 1225
567 Ga0466957_0123211 3300044842 Bacteria 1654
568 Ga0451576_0000087 3300045051 Bacteria 234554
569 Ga0451576_0000151 3300045051 Bacteria 176466
570 Ga0451576_0001262 3300045051 Bacteria 44382
571 Ga0451576_0003642 3300045051 Bacteria 20916
572 Ga0451576_0073186 3300045051 Bacteria 3566
573 Ga0451576_0073276 3300045051 Bacteria 3564
574 Ga0451576_0099338 3300045051 Bacteria 3028
575 Ga0451576_0107790 3300045051 Bacteria 2899
576 Ga0451576_0262133 3300045051 Bacteria 1807
577 Ga0451576_0281139 3300045051 Bacteria 1740
578 Ga0451576_0313191 3300045051 Bacteria 1642
579 Ga0451576_0410296 3300045051 Bacteria 1421
580 Ga0451576_0459790 3300045051 Bacteria 1336
581 Ga0451576_0487861 3300045051 Bacteria 1294
582 Ga0451576_0683469 3300045051 Bacteria 1078
583 Ga0451576_0692848 3300045051 Bacteria 1070
584 Ga0466958_0060973 3300045836 Unclassified 2297
585 Ga0466967_0025698 3300045976 Bacteria 4859
586 Ga0466967_0411688 3300045976 Bacteria 1317
587 Ga0495629_0116578 3300046459 Bacteria 1861
588 Ga0495629_0194881 3300046459 Bacteria 1401
589 Ga0495651_0006747 3300046462 Bacteria 8777
590 Ga0495651_0051643 3300046462 Bacteria 3169
591 Ga0495651_0186831 3300046462 Unclassified 1462
592 Ga0495651_0366282 3300046462 Bacteria 948
593 Ga0495580_0000624 3300046472 Bacteria 29941
594 Ga0495580_0011318 3300046472 Bacteria 6903
595 Ga0495580_0021108 3300046472 Bacteria 4808
596 Ga0495580_0075353 3300046472 Bacteria 2354
597 Ga0495580_0156013 3300046472 Bacteria 1580
598 Ga0495580_0343006 3300046472 Bacteria 1013
599 Ga0495580_0376003 3300046472 Unclassified 960
600 Ga0495582_0007954 3300046473 Bacteria 5860
601 Ga0495582_0154353 3300046473 Unclassified 1304
602 Ga0495618_0083184 3300046514 Bacteria 2045
603 Ga0495628_0145083 3300046516 Unclassified 1810
604 Ga0495628_0246515 3300046516 Bacteria 1335
605 Ga0495630_0054947 3300046517 Bacteria 2984
606 Ga0495630_0125806 3300046517 Unclassified 1945
607 Ga0495630_0253070 3300046517 Bacteria 1346
608 Ga0495642_0188990 3300046528 Bacteria 897
609 Ga0495652_0023598 3300046529 Bacteria 5453
610 Ga0495652_0262875 3300046529 Unclassified 1273
611 Ga0495665_0016275 3300046531 Bacteria 4007
612 Ga0495665_0106767 3300046531 Bacteria 1469
613 Ga0495640_0234070 3300046533 Unclassified 1154
614 Ga0495586_0003876 3300046535 Bacteria 8011
615 Ga0495587_0053392 3300046536 Bacteria 2383
616 Ga0495587_0205205 3300046536 Bacteria 1114
617 Ga0495645_0050462 3300046543 Bacteria 3029
618 Ga0495645_0090050 3300046543 Bacteria 2193
619 Ga0495645_0183812 3300046543 Bacteria 1430
620 Ga0495667_0016297 3300046559 Bacteria 5021
621 Ga0495667_0017693 3300046559 Bacteria 4815
622 Ga0495634_0035927 3300046642 Unclassified 3391
623 Ga0495657_0076654 3300046675 Bacteria 2171
624 Ga0495657_0322963 3300046675 Bacteria 917
625 Ga0495623_0147305 3300046679 Bacteria 1395
626 Ga0495647_0183277 3300046681 Bacteria 912
627 Ga0495669_0053409 3300046684 Unclassified 1817
628 Ga0495669_0104850 3300046684 Bacteria 1316
629 Ga0495613_0025877 3300046689 Bacteria 4372
630 Ga0495613_0065729 3300046689 Bacteria 2650
631 Ga0495613_0211805 3300046689 Unclassified 1363
632 Ga0495600_0134536 3300046809 Unclassified 1606
633 Ga0495581_0085102 3300047315 Bacteria 1833
634 Ga0495581_0160006 3300047315 Unclassified 1316
635 Ga0495604_0319311 3300047317 Bacteria 1038
636 Ga0495674_0035796 3300047319 Bacteria 4475
637 Ga0495674_0066071 3300047319 Bacteria 3140
638 Ga0495674_0275718 3300047319 Bacteria 1379
639 Ga0495674_0286892 3300047319 Bacteria 1347
640 Ga0495674_0627400 3300047319 Bacteria 849
641 Ga0495680_0023240 3300047322 Bacteria 5156
642 Ga0495675_0010946 3300047444 Bacteria 5684
643 Ga0495675_0138329 3300047444 Unclassified 1511
644 Ga0495675_0360224 3300047444 Bacteria 854
645 Ga0495684_0165504 3300047471 Bacteria 1647
646 Ga0495602_0046772 3300048088 Bacteria 3905
647 Ga0495602_0078419 3300048088 Bacteria 2790
648 Ga0495602_0107464 3300048088 Bacteria 2274
649 Ga0495602_0125706 3300048088 Bacteria 2055
650 Ga0495602_0146540 3300048088 Bacteria 1862
651 Ga0495614_0173953 3300048089 Bacteria 967
652 Ga0496100_0028985 3300048903 Unclassified 3419
653 Ga0496104_0172187 3300048907 Bacteria 2076
654 Ga0496104_0272315 3300048907 Bacteria 1606
655 Ga0496104_0441407 3300048907 Bacteria 1213
656 Ga0496105_0045159 3300048908 Unclassified 3635
657 Ga0496105_0267989 3300048908 Bacteria 1380
658 Ga0496107_0054612 3300048910 Unclassified 2883
659 Ga0496108_0093259 3300048911 Bacteria 2561
660 Ga0496108_0202009 3300048911 Bacteria 1725
661 Ga0496109_0804792 3300048912 Bacteria 878
662 Ga0496113_0454009 3300048916 Bacteria 1030
663 Ga0496114_0735236 3300048917 Unclassified 863
664 Ga0496115_0034397 3300048918 Unclassified 4004
665 Ga0496115_0103056 3300048918 Unclassified 2340
666 Ga0496115_0110819 3300048918 Bacteria 2255
667 Ga0496115_0209876 3300048918 Unclassified 1608
668 Ga0496115_0243301 3300048918 Unclassified 1483
669 Ga0496115_0324386 3300048918 Unclassified 1259
670 Ga0496115_0419938 3300048918 Bacteria 1083
671 Ga0496115_0477501 3300048918 Unclassified 1004
672 Ga0501031_0220501 3300049568 Unclassified 1235
673 Ga0501076_0410362 3300049592 Bacteria 1114
674 Ga0495601_0020011 3300053077 Bacteria 4085
675 Ga0495619_0181031 3300053085 Unclassified 1458
676 Ga0501082_0000989 3300060353 Bacteria 25116
677 Ga0501082_0017125 3300060353 Bacteria 6244
678 Ga0265325_10103886
679 rootH1_10300435
680 Ga0070658_10070224
681 Ga0070658_10247563
682 Ga0070683_100000026
683 Ga0070683_100000282
684 Ga0070683_100143624
685 Ga0070670_100110957
686 Ga0068869_100013385
687 Ga0070680_100009538
688 Ga0068868_100080216
689 Ga0070660_100010134
690 Ga0070661_100008281
691 Ga0070661_100019455
692 Ga0070661_100055414
693 Ga0070661_100274250
694 Ga0070671_100044626
695 Ga0070671_100054642
696 Ga0070671_100117457
697 Ga0070673_100124177
698 Ga0070667_100003517
699 Ga0070667_100299946
700 Ga0070714_100001263
701 Ga0070714_100224754
702 Ga0070714_100333092
703 Ga0070713_100003077
704 Ga0070713_100004121
705 Ga0070713_100014155
706 Ga0070713_100124300
707 Ga0070713_100552905
708 Ga0070711_100004372
709 Ga0070662_100052314
710 Ga0070681_10001126
711 Ga0070681_10134513
712 Ga0070679_100043017
713 Ga0070684_100000012
714 Ga0070684_100001159
715 Ga0070684_100035397
716 Ga0070684_100043481
717 Ga0070684_100129547
718 Ga0070684_100190297
719 Ga0070684_100589636
720 Ga0068853_100000333
721 Ga0070693_100032934
722 Ga0070665_100230401
723 Ga0070665_100423398
724 Ga0068855_100003357
725 Ga0068855_100008795
726 Ga0068855_100044214
727 Ga0068855_100058817
728 Ga0068855_100121476
729 Ga0068855_100162780
730 Ga0068855_100543661
731 Ga0070664_100086357
732 Ga0070664_100243088
733 Ga0068857_100009334
734 Ga0068857_100017542
735 Ga0068857_100104551
736 Ga0068857_100305271
737 Ga0068854_100070484
738 Ga0068854_100113105
739 Ga0068856_100002161
740 Ga0068856_100008946
741 Ga0068856_100036509
742 Ga0068856_100048288
743 Ga0068856_100048644
744 Ga0068856_100085783
745 Ga0068856_100099309
746 Ga0068856_100317802
747 Ga0068852_100000017
748 Ga0068852_100000676
749 Ga0068852_100027078
750 Ga0068852_100055695
751 Ga0068852_100191176
752 Ga0068852_100273533
753 Ga0068852_100618775
754 Ga0068859_100002738
755 Ga0068859_100088276
756 Ga0068864_100015071
757 Ga0068864_100272506
758 Ga0068851_10004801
759 Ga0068851_10010464
760 Ga0068851_10010677
761 Ga0068851_10154891
762 Ga0068863_100003424
763 Ga0068863_100068396
764 Ga0068863_100082246
765 Ga0068858_100022417
766 Ga0068858_100053026
767 Ga0068860_100013582
768 Ga0068860_100061644
769 Ga0070717_10025158
770 Ga0070717_10044393
771 Ga0070717_10364564
772 Ga0070712_100226454
773 Ga0097621_100011678
774 Ga0097621_100042117
775 Ga0068871_100001265
776 Ga0068871_100005801
777 Ga0068871_100084969
778 Ga0068871_100194692
779 Ga0068865_100108440
780 Ga0097620_100002738
781 Ga0097620_100088276
782 Ga0075435_100540917
783 Ga0105240_10000110
784 Ga0105240_10000480
785 Ga0105240_10001244
786 Ga0105240_10002039
787 Ga0105240_10012029
788 Ga0105240_10040023
789 Ga0105240_10045967
790 Ga0105240_10199660
791 Ga0105240_10661669
792 Ga0105240_10662789
793 Ga0105245_10070406
794 Ga0105245_10097181
795 Ga0105245_10525834
796 Ga0105247_10006855
797 Ga0105247_10081049
798 Ga0105243_10624078
799 Ga0105241_10000029
800 Ga0105241_10002831
801 Ga0105241_10022106
802 Ga0105241_10134819
803 Ga0105248_10000795
804 Ga0105248_10012989
805 Ga0105248_10032082
806 Ga0105237_10055987
807 Ga0105237_10181772
808 Ga0105237_10498497
809 Ga0105237_10935165
810 Ga0105238_10001519
811 Ga0105238_10001766
812 Ga0105238_10002101
813 Ga0105238_10004609
814 Ga0105238_10017870
815 Ga0105238_10041491
816 Ga0105238_10061243
817 Ga0105238_10083687
818 Ga0105238_10094726
819 Ga0105238_10362012
820 Ga0105249_10097785
821 Ga0105239_10003049
822 Ga0105239_10045617
823 Ga0105239_10165532
824 Ga0105246_10025249
825 Ga0105246_10235091
826 Ga0157373_10284507
827 Ga0157371_10027189
828 Ga0157370_10000001
829 Ga0157370_10037285
830 Ga0157370_10397729
831 Ga0157369_10000017
832 Ga0157369_10004443
833 Ga0157369_10016885
834 Ga0157369_10022931
835 Ga0157369_10044167
836 Ga0157369_10046360
837 Ga0157369_10048827
838 Ga0157369_10117357
839 Ga0157369_10129399
840 Ga0157369_10173038
841 Ga0157369_10214732
842 Ga0157369_10284798
843 Ga0157369_10295934
844 Ga0157374_10004278
845 Ga0157374_10071725
846 Ga0157374_10180701
847 Ga0157374_10370701
848 Ga0157374_10404351
849 Ga0157374_10495840
850 Ga0157378_10003524
851 Ga0157378_10145171
852 Ga0157378_10283379
853 Ga0163162_10014850
854 Ga0163162_10405498
855 Ga0157372_10000019
856 Ga0157372_10000581
857 Ga0157372_10005466
858 Ga0157372_10009465
859 Ga0157372_10034116
860 Ga0157372_10062821
861 Ga0157372_10142348
862 Ga0157372_10556255
863 Ga0157375_10006666
864 Ga0157375_10399610
865 Ga0157375_10469888
866 Ga0163163_10001460
867 Ga0163163_10028986
868 Ga0163163_10111040
869 Ga0157377_10294552
870 Ga0157379_10000374
871 Ga0157379_10293998
872 Ga0157376_10018547
873 Ga0157376_10044688
874 Ga0157376_10391400
875 Ga0163161_10025447
876 Ga0207656_10018482
877 Ga0207656_10113338
878 Ga0207692_10335605
879 Ga0207710_10118473
880 Ga0207680_10340012
881 Ga0207647_10014446
882 Ga0207645_10101381
883 Ga0207705_10058262
884 Ga0207705_10092803
885 Ga0207654_10000039
886 Ga0207654_10000268
887 Ga0207654_10021293
888 Ga0207654_10059899
889 Ga0207707_10004693
890 Ga0207707_10211157
891 Ga0207695_10000026
892 Ga0207695_10000161
893 Ga0207695_10000252
894 Ga0207695_10001781
895 Ga0207695_10002510
896 Ga0207695_10008556
897 Ga0207695_10048591
898 Ga0207695_10071828
899 Ga0207695_10116151
900 Ga0207695_10159389
901 Ga0207695_10189703
902 Ga0207671_10000082
903 Ga0207671_10000512
904 Ga0207671_10273204
905 Ga0207663_10000900
906 Ga0207663_10003963
907 Ga0207660_10007894
908 Ga0207657_10010018
909 Ga0207649_10145098
910 Ga0207649_10347752
911 Ga0207652_10013526
912 Ga0207694_10000246
913 Ga0207694_10001021
914 Ga0207694_10001303
915 Ga0207694_10045135
916 Ga0207694_10059504
917 Ga0207694_10067515
918 Ga0207694_10325143
919 Ga0207650_10025708
920 Ga0207687_10005794
921 Ga0207700_10004998
922 Ga0207700_10061834
923 Ga0207664_10178872
924 Ga0207664_10505747
925 Ga0207690_10542099
926 Ga0207706_10003046
927 Ga0207704_10160849
928 Ga0207691_10100702
929 Ga0207711_10001763
930 Ga0207711_10043637
931 Ga0207711_10093524
932 Ga0207689_10001661
933 Ga0207661_10000003
934 Ga0207661_10000513
935 Ga0207661_10207101
936 Ga0207679_10069769
937 Ga0207679_10557697
938 Ga0207667_10000059
939 Ga0207667_10002596
940 Ga0207667_10023670
941 Ga0207667_10078235
942 Ga0207667_10181686
943 Ga0207667_10193833
944 Ga0207667_10253239
945 Ga0207667_10376192
946 Ga0207667_10398389
947 Ga0207667_10433352
948 Ga0207667_10448394
949 Ga0207651_10537030
950 Ga0207640_10054940
951 Ga0207640_10151157
952 Ga0207658_10032306
953 Ga0207658_10402335
954 Ga0207658_10496630
955 Ga0207677_10001213
956 Ga0207703_10181264
957 Ga0207703_10717731
958 Ga0207639_10000152
959 Ga0207639_10066440
960 Ga0207639_10333189
961 Ga0207639_10555483
962 Ga0207702_10006929
963 Ga0207702_10018638
964 Ga0207702_10300887
965 Ga0207702_10386633
966 Ga0207702_10548004
967 Ga0207702_10589631
968 Ga0207641_10012272
969 Ga0207641_10116645
970 Ga0207641_10253580
971 Ga0207641_10510616
972 Ga0207676_10156323
973 Ga0207676_10360497
974 Ga0207674_10002375
975 Ga0207674_10012549
976 Ga0207674_10109412
977 Ga0207683_10023334
978 Ga0207698_10000050
979 Ga0207698_10002490
980 Ga0207698_10012576
981 Ga0207698_10041243
982 Ga0207698_10404723
983 Ga0207698_10538299
984 Ga0268266_10118314
985 Ga0268266_10133988
986 Ga0268266_10158418
987 Ga0268266_10872374
988 Ga0268264_10050359
989 Ga0265337_1000188
990 Ga0265337_1000324
991 Ga0265337_1002557
992 Ga0265337_1006670
993 Ga0265337_1011931
994 Ga0265337_1027583
995 Ga0265326_10044194
996 Ga0265326_10064467
997 Ga0265326_10070864
998 Ga0265319_1012804
999 Ga0265334_10001402
1000 Ga0265334_10041293
1001 Ga0265334_10119091
1002 Ga0265318_10007337
1003 Ga0265318_10008245
1004 Ga0265323_10000084
1005 Ga0265323_10000536
1006 Ga0265323_10000688
1007 Ga0265323_10003780
1008 Ga0265323_10018891
1009 Ga0265323_10022245
1010 Ga0265323_10024054
1011 Ga0265323_10025382
1012 Ga0265323_10037987
1013 Ga0265322_10028989
1014 Ga0265336_10000240
1015 Ga0265336_10002723
1016 Ga0265336_10006394
1017 Ga0265336_10010484
1018 Ga0265338_10000237
1019 Ga0265338_10000556
1020 Ga0265338_10000789
1021 Ga0265338_10000810
1022 Ga0265338_10001431
1023 Ga0265338_10004391
1024 Ga0265338_10004396
1025 Ga0265338_10004961
1026 Ga0265338_10006143
1027 Ga0265338_10008146
1028 Ga0265338_10010139
1029 Ga0265338_10010928
1030 Ga0265338_10018070
1031 Ga0265338_10023748
1032 Ga0265338_10024129
1033 Ga0265338_10026625
1034 Ga0265338_10035847
1035 Ga0265338_10058183
1036 Ga0265338_10062938
1037 Ga0265338_10101226
1038 Ga0265338_10113204
1039 Ga0265338_10144490
1040 Ga0265338_10188873
1041 Ga0265338_10346820
1042 Ga0265324_10000475
1043 Ga0265324_10000734
1044 Ga0265324_10008241
1045 Ga0265324_10063746
1046 Ga0265324_10111901
1047 Ga0265330_10000180
1048 Ga0265330_10002956
1049 Ga0265330_10005425
1050 Ga0265330_10022078
1051 Ga0265330_10038742
1052 Ga0265330_10042738
1053 Ga0265330_10044042
1054 Ga0265330_10089065
1055 Ga0265332_10023040
1056 Ga0265332_10111877
1057 Ga0265328_10009260
1058 Ga0265328_10011808
1059 Ga0265328_10032569
1060 Ga0265328_10045590
1061 Ga0265328_10074849
1062 Ga0265320_10000188
1063 Ga0265320_10000816
1064 Ga0265320_10009797
1065 Ga0265320_10042500
1066 Ga0265320_10051024
1067 Ga0265320_10148377
1068 Ga0265320_10154666
1069 Ga0265325_10000086
1070 Ga0265325_10003105
1071 Ga0265325_10011002
1072 Ga0265325_10012548
1073 Ga0265325_10028281
1074 Ga0265325_10059284
1075 Ga0265325_10077361
1076 Ga0265325_10078477
1077 Ga0265325_10101905
1078 Ga0265329_10001542
1079 Ga0265340_10004974
1080 Ga0265340_10010689
1081 Ga0265340_10012229
1082 Ga0265340_10015868
1083 Ga0265340_10041705
1084 Ga0265340_10050942
1085 Ga0265340_10068903
1086 Ga0265340_10073130
1087 Ga0265340_10092428
1088 Ga0265339_10000003
1089 Ga0265339_10000870
1090 Ga0265339_10007801
1091 Ga0265339_10012119
1092 Ga0265339_10027013
1093 Ga0265339_10028998
1094 Ga0265339_10047867
1095 Ga0265339_10068233
1096 Ga0265339_10106817
1097 Ga0265339_10165086
1098 Ga0265331_10015387
1099 Ga0265331_10034859
1100 Ga0265331_10037776
1101 Ga0265331_10104103
1102 Ga0265327_10014147
1103 Ga0265327_10020540
1104 Ga0265327_10061992
1105 Ga0265316_10003058
1106 Ga0265316_10003587
1107 Ga0265316_10004340
1108 Ga0265316_10006710
1109 Ga0265316_10012932
1110 Ga0265316_10014044
1111 Ga0265316_10018447
1112 Ga0265316_10020951
1113 Ga0265316_10023806
1114 Ga0265316_10030079
1115 Ga0265316_10030617
1116 Ga0265316_10033205
1117 Ga0265316_10055430
1118 Ga0265316_10071883
1119 Ga0265316_10076303
1120 Ga0265316_10084284
1121 Ga0265316_10093140
1122 Ga0265316_10098617
1123 Ga0265316_10108586
1124 Ga0265316_10149681
1125 Ga0265316_10185464
1126 Ga0265316_10195811
1127 Ga0265316_10288995
1128 Ga0265313_10003145
1129 Ga0265313_10006106
1130 Ga0265313_10009943
1131 Ga0265313_10012004
1132 Ga0265313_10014760
1133 Ga0265313_10022667
1134 Ga0265313_10037336
1135 Ga0316575_10000074
1136 Ga0265314_10000047
1137 Ga0265314_10000148
1138 Ga0265314_10000509
1139 Ga0265314_10001672
1140 Ga0265314_10026386
1141 Ga0265314_10040681
1142 Ga0265314_10112883
1143 Ga0265314_10216913
1144 Ga0265314_10238984
1145 Ga0265342_10000208
1146 Ga0265342_10000451
1147 Ga0265342_10003573
1148 Ga0265342_10005582
1149 Ga0265342_10006053
1150 Ga0265342_10037262
1151 Ga0265342_10045795
1152 Ga0265342_10067191
1153 Ga0265342_10071188
1154 Ga0265342_10088660
1155 Ga0265342_10110768
1156 Ga0316576_10130968
1157 Ga0316576_10132643
1158 Ga0307416_100093022
1159 Ga0373934_0011219
1160 Ga0373934_0028820
1161 Ga0373951_0007969
1162 Ga0373936_0016469
1163 Ga0373945_0019674
1164 Ga0373953_0010066
1165 Ga0373954_0025316
1166 Ga0373954_0061639
1167 Ga0373956_0062388
1168 Ga0373956_0143864
1169 Ga0373956_0239729
1170 Ga0373943_0147917
1171 Ga0373935_0037860
1172 Ga0373927_0297629
1173 Ga0373933_0062085
1174 Ga0373947_0041759
1175 Ga0373947_0366302
1176 Ga0373937_0013533
1177 Ga0373937_0155753
1178 Ga0373937_0296849
1179 Ga0373937_0667596
1180 Ga0373925_0006624
1181 Ga0373925_0448723
1182 Ga0451577_0000063
1183 Ga0451577_0001897
1184 Ga0451577_0004611
1185 Ga0451577_0009052
1186 Ga0451577_0021043
1187 Ga0451577_0025593
1188 Ga0451577_0054561
1189 Ga0451577_0060929
1190 Ga0451577_0063111
1191 Ga0451577_0091297
1192 Ga0451577_0196676
1193 Ga0451577_0201185
1194 Ga0451577_0310086
1195 Ga0451577_0328553
1196 Ga0451577_0346855
1197 Ga0451577_0354827
1198 Ga0451577_0403618
1199 Ga0451577_0435997
1200 Ga0451577_0440833
1201 Ga0451577_0537353
1202 Ga0451577_0586208
1203 Ga0451577_0668536
1204 Ga0451577_0887828
1205 Ga0451577_0890353
1206 Ga0453683_0000114
1207 Ga0453683_0000390
1208 Ga0453683_0001084
1209 Ga0453683_0196619
1210 Ga0453683_0237104
1211 Ga0453683_0285883
1212 Ga0453683_0319890
1213 Ga0453683_0523685
1214 Ga0466961_0067036
1215 Ga0466963_0020464
1216 Ga0453684_0000198
1217 Ga0453684_0000266
1218 Ga0453684_0000417
1219 Ga0453684_0000455
1220 Ga0453684_0000725
1221 Ga0453684_0001063
1222 Ga0453684_0001817
1223 Ga0453684_0002936
1224 Ga0453684_0003575
1225 Ga0453684_0007772
1226 Ga0453684_0011217
1227 Ga0453684_0011768
1228 Ga0453684_0013310
1229 Ga0453684_0016077
1230 Ga0453684_0018573
1231 Ga0453684_0022113
1232 Ga0453684_0025700
1233 Ga0453684_0030196
1234 Ga0453684_0059446
1235 Ga0453684_0110608
1236 Ga0453684_0114896
1237 Ga0453684_0166078
1238 Ga0453684_0290292
1239 Ga0453684_0298544
1240 Ga0453684_0318226
1241 Ga0453684_0370341
1242 Ga0453684_0472854
1243 Ga0453684_0585638
1244 Ga0466957_0123211
1245 Ga0451576_0000087
1246 Ga0451576_0000151
1247 Ga0451576_0001262
1248 Ga0451576_0003642
1249 Ga0451576_0073186
1250 Ga0451576_0073276
1251 Ga0451576_0099338
1252 Ga0451576_0107790
1253 Ga0451576_0262133
1254 Ga0451576_0281139
1255 Ga0451576_0313191
1256 Ga0451576_0410296
1257 Ga0451576_0459790
1258 Ga0451576_0487861
1259 Ga0451576_0683469
1260 Ga0451576_0692848
1261 Ga0466958_0060973
1262 Ga0466967_0025698
1263 Ga0466967_0411688
1264 Ga0495629_0116578
1265 Ga0495629_0194881
1266 Ga0495651_0006747
1267 Ga0495651_0051643
1268 Ga0495651_0186831
1269 Ga0495651_0366282
1270 Ga0495580_0000624
1271 Ga0495580_0011318
1272 Ga0495580_0021108
1273 Ga0495580_0075353
1274 Ga0495580_0156013
1275 Ga0495580_0343006
1276 Ga0495580_0376003
1277 Ga0495582_0007954
1278 Ga0495582_0154353
1279 Ga0495618_0083184
1280 Ga0495628_0145083
1281 Ga0495628_0246515
1282 Ga0495630_0054947
1283 Ga0495630_0125806
1284 Ga0495630_0253070
1285 Ga0495642_0188990
1286 Ga0495652_0023598
1287 Ga0495652_0262875
1288 Ga0495665_0016275
1289 Ga0495665_0106767
1290 Ga0495640_0234070
1291 Ga0495586_0003876
1292 Ga0495587_0053392
1293 Ga0495587_0205205
1294 Ga0495645_0050462
1295 Ga0495645_0090050
1296 Ga0495645_0183812
1297 Ga0495667_0016297
1298 Ga0495667_0017693
1299 Ga0495634_0035927
1300 Ga0495657_0076654
1301 Ga0495657_0322963
1302 Ga0495623_0147305
1303 Ga0495647_0183277
1304 Ga0495669_0053409
1305 Ga0495669_0104850
1306 Ga0495613_0025877
1307 Ga0495613_0065729
1308 Ga0495613_0211805
1309 Ga0495600_0134536
1310 Ga0495581_0085102
1311 Ga0495581_0160006
1312 Ga0495604_0319311
1313 Ga0495674_0035796
1314 Ga0495674_0066071
1315 Ga0495674_0275718
1316 Ga0495674_0286892
1317 Ga0495674_0627400
1318 Ga0495680_0023240
1319 Ga0495675_0010946
1320 Ga0495675_0138329
1321 Ga0495675_0360224
1322 Ga0495684_0165504
1323 Ga0495602_0046772
1324 Ga0495602_0078419
1325 Ga0495602_0107464
1326 Ga0495602_0125706
1327 Ga0495602_0146540
1328 Ga0495614_0173953
1329 Ga0496100_0028985
1330 Ga0496104_0172187
1331 Ga0496104_0272315
1332 Ga0496104_0441407
1333 Ga0496105_0045159
1334 Ga0496105_0267989
1335 Ga0496107_0054612
1336 Ga0496108_0093259
1337 Ga0496108_0202009
1338 Ga0496109_0804792
1339 Ga0496113_0454009
1340 Ga0496114_0735236
1341 Ga0496115_0034397
1342 Ga0496115_0103056
1343 Ga0496115_0110819
1344 Ga0496115_0209876
1345 Ga0496115_0243301
1346 Ga0496115_0324386
1347 Ga0496115_0419938
1348 Ga0496115_0477501
1349 Ga0501031_0220501
1350 Ga0501076_0410362
1351 Ga0495601_0020011
1352 Ga0495619_0181031
1353 Ga0501082_0000989
1354 Ga0501082_0017125

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01012

ETF

Electron transfer flavoprotein domain

34

236

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
1bf4-assembly1.cif.gz_A chromosomal dna-binding protein sso7d/d(gcgaacgc) complex 0.8134 157 184
1c8c-assembly1.cif.gz_A crystal structures of the chromosomal proteins sso7d/sac7d bound to dna containing t-g mismatched base pairs 0.8102 157 184
1h9m-assembly1.cif.gz_A two crystal structures of the cytoplasmic molybdate-binding protein modg suggest a novel cooperative binding mechanism and provide insights into ligand-binding specificity. peg-grown form with molybdate bound 0.7906 157 185
1gus-assembly1.cif.gz_B mopii from clostridium pasteurianum (apo1) 0.7899 157 185
1t9g-assembly1.cif.gz_S structure of the human mcad:etf complex 0.764 5 241
ID Description Score Start End Superfamily
af_Q99698_3481_3690_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8437 158 185 2.130.10.10
1gunB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8363 157 185 2.40.50.100
af_Q6IGM3_136_223_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8133 157 184 2.40.50.140
1h9sA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8043 158 185 2.40.50.100
af_Q92673_86_292_2.115.10.20 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.7955 157 182 2.115.10.20
ID Description Score Start End GO Terms
AF-A0A7C5CYM7-F1-model_v4 Electron transfer flavoprotein subunit beta 0.9664 1 231
AF-A0A7Y5LFG5-F1-model_v4 Electron transfer flavoprotein subunit beta 0.9602 4 185
AF-A0A7Y5LFG5-F1-model_v4 Electron transfer flavoprotein subunit beta 0.945 4 185
AF-A0A7C5CYM7-F1-model_v4 Electron transfer flavoprotein subunit beta 0.9425 1 231
AF-A0A0S8G056-F1-model_v4 Electron transfer flavoprotein subunit beta 0.9372 4 104

Map