F474591
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 677 | 204 | 1354 | 267 |
Family's Representative Sequence
| Representative Sequence | 3300031241|Ga0265325_10103886|Ga0265325_101038861 |
| Length | 276 |
| Sequence | MPTDFHIVVCAGIVPDPLQTLEPTTGPNGPGIKNEMVLPAVLDPWAASALYEAANLAAKQQGSKVWLVSLGPKAKLQQVMMSVAQKVSFELVPVDGPIGGFPDAQATAAVLADAIAVIPGLDRERLLVFGGWESATRGAGVTLQLVGERLGIADQFQGVDAIDIRPDGPNAGSFEVLERVEGGRHQVSVCAGAPAVLGWATGNLAEPRNNPQVGMANMRTIMPALQKAKTVALEANGLHYVSVSLPKQQRTTRVEKNMSADEIASELVAWIGQDSQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 2 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 22 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 27 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 28 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 29 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 30 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 31 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 32 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 33 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 34 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 35 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 36 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 40 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 41 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 43 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 113 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 114 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 115 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 116 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 117 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 118 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 119 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 120 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 121 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 122 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 123 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 124 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 125 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 126 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 127 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 128 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 129 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 130 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 131 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 132 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 133 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 134 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 135 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 136 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 137 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 138 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 139 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 140 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 141 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 142 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 143 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 144 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 145 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 146 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 147 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 148 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 149 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 150 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 151 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 152 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 153 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 154 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 155 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 156 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 157 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 158 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 159 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 160 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 161 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 192 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 193 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 194 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 195 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 196 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 198 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 199 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 200 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.95 |
| Rhizosphere | 96.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265325_10103886 | 3300031241 | Bacteria | 1388 |
| 2 | rootH1_10300435 | 3300003323 | Bacteria | 1222 |
| 3 | Ga0070658_10070224 | 3300005327 | Bacteria | 2867 |
| 4 | Ga0070658_10247563 | 3300005327 | Bacteria | 1512 |
| 5 | Ga0070683_100000026 | 3300005329 | Bacteria | 172308 |
| 6 | Ga0070683_100000282 | 3300005329 | Bacteria | 34970 |
| 7 | Ga0070683_100143624 | 3300005329 | Bacteria | 2261 |
| 8 | Ga0070670_100110957 | 3300005331 | Bacteria | 2363 |
| 9 | Ga0068869_100013385 | 3300005334 | Bacteria | 5456 |
| 10 | Ga0070680_100009538 | 3300005336 | Bacteria | 7456 |
| 11 | Ga0068868_100080216 | 3300005338 | Bacteria | 2615 |
| 12 | Ga0070660_100010134 | 3300005339 | Bacteria | 6651 |
| 13 | Ga0070661_100008281 | 3300005344 | Bacteria | 7177 |
| 14 | Ga0070661_100019455 | 3300005344 | Bacteria | 4839 |
| 15 | Ga0070661_100055414 | 3300005344 | Unclassified | 2903 |
| 16 | Ga0070661_100274250 | 3300005344 | Bacteria | 1307 |
| 17 | Ga0070671_100044626 | 3300005355 | Bacteria | 3684 |
| 18 | Ga0070671_100054642 | 3300005355 | Bacteria | 3320 |
| 19 | Ga0070671_100117457 | 3300005355 | Bacteria | 2237 |
| 20 | Ga0070673_100124177 | 3300005364 | Bacteria | 2158 |
| 21 | Ga0070667_100003517 | 3300005367 | Bacteria | 13342 |
| 22 | Ga0070667_100299946 | 3300005367 | Bacteria | 1446 |
| 23 | Ga0070714_100001263 | 3300005435 | Bacteria | 18267 |
| 24 | Ga0070714_100224754 | 3300005435 | Bacteria | 1727 |
| 25 | Ga0070714_100333092 | 3300005435 | Unclassified | 1422 |
| 26 | Ga0070713_100003077 | 3300005436 | Bacteria | 10965 |
| 27 | Ga0070713_100004121 | 3300005436 | Bacteria | 9691 |
| 28 | Ga0070713_100014155 | 3300005436 | Bacteria | 5911 |
| 29 | Ga0070713_100124300 | 3300005436 | Bacteria | 2267 |
| 30 | Ga0070713_100552905 | 3300005436 | Bacteria | 1090 |
| 31 | Ga0070711_100004372 | 3300005439 | Bacteria | 8326 |
| 32 | Ga0070662_100052314 | 3300005457 | Bacteria | 2951 |
| 33 | Ga0070681_10001126 | 3300005458 | Bacteria | 22953 |
| 34 | Ga0070681_10134513 | 3300005458 | Unclassified | 2403 |
| 35 | Ga0070679_100043017 | 3300005530 | Bacteria | 4499 |
| 36 | Ga0070684_100000012 | 3300005535 | Bacteria | 167850 |
| 37 | Ga0070684_100001159 | 3300005535 | Bacteria | 18932 |
| 38 | Ga0070684_100035397 | 3300005535 | Bacteria | 4274 |
| 39 | Ga0070684_100043481 | 3300005535 | Bacteria | 3880 |
| 40 | Ga0070684_100129547 | 3300005535 | Unclassified | 2275 |
| 41 | Ga0070684_100190297 | 3300005535 | Bacteria | 1867 |
| 42 | Ga0070684_100589636 | 3300005535 | Bacteria | 1033 |
| 43 | Ga0068853_100000333 | 3300005539 | Bacteria | 33063 |
| 44 | Ga0070693_100032934 | 3300005547 | Bacteria | 2855 |
| 45 | Ga0070665_100230401 | 3300005548 | Bacteria | 1852 |
| 46 | Ga0070665_100423398 | 3300005548 | Bacteria | 1340 |
| 47 | Ga0068855_100003357 | 3300005563 | Bacteria | 19600 |
| 48 | Ga0068855_100008795 | 3300005563 | Bacteria | 12205 |
| 49 | Ga0068855_100044214 | 3300005563 | Bacteria | 5272 |
| 50 | Ga0068855_100058817 | 3300005563 | Bacteria | 4499 |
| 51 | Ga0068855_100121476 | 3300005563 | Bacteria | 2989 |
| 52 | Ga0068855_100162780 | 3300005563 | Bacteria | 2531 |
| 53 | Ga0068855_100543661 | 3300005563 | Bacteria | 1258 |
| 54 | Ga0070664_100086357 | 3300005564 | Bacteria | 2711 |
| 55 | Ga0070664_100243088 | 3300005564 | Bacteria | 1616 |
| 56 | Ga0068857_100009334 | 3300005577 | Bacteria | 8516 |
| 57 | Ga0068857_100017542 | 3300005577 | Bacteria | 6276 |
| 58 | Ga0068857_100104551 | 3300005577 | Bacteria | 2542 |
| 59 | Ga0068857_100305271 | 3300005577 | Bacteria | 1468 |
| 60 | Ga0068854_100070484 | 3300005578 | Unclassified | 2555 |
| 61 | Ga0068854_100113105 | 3300005578 | Unclassified | 2050 |
| 62 | Ga0068856_100002161 | 3300005614 | Bacteria | 20367 |
| 63 | Ga0068856_100008946 | 3300005614 | Bacteria | 9741 |
| 64 | Ga0068856_100036509 | 3300005614 | Unclassified | 4818 |
| 65 | Ga0068856_100048288 | 3300005614 | Bacteria | 4193 |
| 66 | Ga0068856_100048644 | 3300005614 | Unclassified | 4179 |
| 67 | Ga0068856_100085783 | 3300005614 | Bacteria | 3128 |
| 68 | Ga0068856_100099309 | 3300005614 | Bacteria | 2902 |
| 69 | Ga0068856_100317802 | 3300005614 | Bacteria | 1574 |
| 70 | Ga0068852_100000017 | 3300005616 | Bacteria | 132313 |
| 71 | Ga0068852_100000676 | 3300005616 | Bacteria | 22371 |
| 72 | Ga0068852_100027078 | 3300005616 | Bacteria | 4668 |
| 73 | Ga0068852_100055695 | 3300005616 | Bacteria | 3414 |
| 74 | Ga0068852_100191176 | 3300005616 | Bacteria | 1932 |
| 75 | Ga0068852_100273533 | 3300005616 | Bacteria | 1626 |
| 76 | Ga0068852_100618775 | 3300005616 | Bacteria | 1088 |
| 77 | Ga0068859_100002738 | 3300005617 | Bacteria | 17886 |
| 78 | Ga0068859_100088276 | 3300005617 | Bacteria | 3150 |
| 79 | Ga0068864_100015071 | 3300005618 | Bacteria | 6425 |
| 80 | Ga0068864_100272506 | 3300005618 | Bacteria | 1577 |
| 81 | Ga0068851_10004801 | 3300005834 | Bacteria | 6117 |
| 82 | Ga0068851_10010464 | 3300005834 | Bacteria | 4333 |
| 83 | Ga0068851_10010677 | 3300005834 | Bacteria | 4290 |
| 84 | Ga0068851_10154891 | 3300005834 | Bacteria | 1255 |
| 85 | Ga0068863_100003424 | 3300005841 | Bacteria | 15637 |
| 86 | Ga0068863_100068396 | 3300005841 | Bacteria | 3360 |
| 87 | Ga0068863_100082246 | 3300005841 | Bacteria | 3051 |
| 88 | Ga0068858_100022417 | 3300005842 | Bacteria | 5894 |
| 89 | Ga0068858_100053026 | 3300005842 | Bacteria | 3753 |
| 90 | Ga0068860_100013582 | 3300005843 | Bacteria | 7984 |
| 91 | Ga0068860_100061644 | 3300005843 | Bacteria | 3563 |
| 92 | Ga0070717_10025158 | 3300006028 | Bacteria | 4730 |
| 93 | Ga0070717_10044393 | 3300006028 | Unclassified | 3629 |
| 94 | Ga0070717_10364564 | 3300006028 | Bacteria | 1294 |
| 95 | Ga0070712_100226454 | 3300006175 | Bacteria | 1483 |
| 96 | Ga0097621_100011678 | 3300006237 | Bacteria | 6481 |
| 97 | Ga0097621_100042117 | 3300006237 | Bacteria | 3677 |
| 98 | Ga0068871_100001265 | 3300006358 | Bacteria | 16909 |
| 99 | Ga0068871_100005801 | 3300006358 | Bacteria | 8676 |
| 100 | Ga0068871_100084969 | 3300006358 | Bacteria | 2626 |
| 101 | Ga0068871_100194692 | 3300006358 | Bacteria | 1747 |
| 102 | Ga0068865_100108440 | 3300006881 | Bacteria | 2044 |
| 103 | Ga0097620_100002738 | 3300006931 | Bacteria | 17886 |
| 104 | Ga0097620_100088276 | 3300006931 | Bacteria | 3150 |
| 105 | Ga0075435_100540917 | 3300007076 | Bacteria | 1008 |
| 106 | Ga0105240_10000110 | 3300009093 | Bacteria | 171018 |
| 107 | Ga0105240_10000480 | 3300009093 | Bacteria | 73703 |
| 108 | Ga0105240_10001244 | 3300009093 | Bacteria | 44183 |
| 109 | Ga0105240_10002039 | 3300009093 | Bacteria | 33267 |
| 110 | Ga0105240_10012029 | 3300009093 | Bacteria | 11997 |
| 111 | Ga0105240_10040023 | 3300009093 | Bacteria | 6000 |
| 112 | Ga0105240_10045967 | 3300009093 | Bacteria | 5535 |
| 113 | Ga0105240_10199660 | 3300009093 | Bacteria | 2345 |
| 114 | Ga0105240_10661669 | 3300009093 | Unclassified | 1144 |
| 115 | Ga0105240_10662789 | 3300009093 | Bacteria | 1142 |
| 116 | Ga0105245_10070406 | 3300009098 | Bacteria | 3174 |
| 117 | Ga0105245_10097181 | 3300009098 | Bacteria | 2719 |
| 118 | Ga0105245_10525834 | 3300009098 | Bacteria | 1202 |
| 119 | Ga0105247_10006855 | 3300009101 | Bacteria | 7021 |
| 120 | Ga0105247_10081049 | 3300009101 | Bacteria | 2045 |
| 121 | Ga0105243_10624078 | 3300009148 | Bacteria | 1041 |
| 122 | Ga0105241_10000029 | 3300009174 | Bacteria | 125929 |
| 123 | Ga0105241_10002831 | 3300009174 | Bacteria | 12960 |
| 124 | Ga0105241_10022106 | 3300009174 | Bacteria | 4709 |
| 125 | Ga0105241_10134819 | 3300009174 | Bacteria | 2003 |
| 126 | Ga0105248_10000795 | 3300009177 | Bacteria | 35418 |
| 127 | Ga0105248_10012989 | 3300009177 | Bacteria | 9180 |
| 128 | Ga0105248_10032082 | 3300009177 | Bacteria | 5870 |
| 129 | Ga0105237_10055987 | 3300009545 | Bacteria | 3949 |
| 130 | Ga0105237_10181772 | 3300009545 | Unclassified | 2103 |
| 131 | Ga0105237_10498497 | 3300009545 | Bacteria | 1224 |
| 132 | Ga0105237_10935165 | 3300009545 | Bacteria | 874 |
| 133 | Ga0105238_10001519 | 3300009551 | Bacteria | 23247 |
| 134 | Ga0105238_10001766 | 3300009551 | Bacteria | 21684 |
| 135 | Ga0105238_10002101 | 3300009551 | Bacteria | 20125 |
| 136 | Ga0105238_10004609 | 3300009551 | Bacteria | 13639 |
| 137 | Ga0105238_10017870 | 3300009551 | Bacteria | 7210 |
| 138 | Ga0105238_10041491 | 3300009551 | Bacteria | 4660 |
| 139 | Ga0105238_10061243 | 3300009551 | Bacteria | 3766 |
| 140 | Ga0105238_10083687 | 3300009551 | Bacteria | 3180 |
| 141 | Ga0105238_10094726 | 3300009551 | Bacteria | 2974 |
| 142 | Ga0105238_10362012 | 3300009551 | Bacteria | 1440 |
| 143 | Ga0105249_10097785 | 3300009553 | Bacteria | 2756 |
| 144 | Ga0105239_10003049 | 3300010375 | Bacteria | 20822 |
| 145 | Ga0105239_10045617 | 3300010375 | Bacteria | 4804 |
| 146 | Ga0105239_10165532 | 3300010375 | Bacteria | 2472 |
| 147 | Ga0105246_10025249 | 3300011119 | Bacteria | 3872 |
| 148 | Ga0105246_10235091 | 3300011119 | Bacteria | 1445 |
| 149 | Ga0157373_10284507 | 3300013100 | Bacteria | 1172 |
| 150 | Ga0157371_10027189 | 3300013102 | Bacteria | 4151 |
| 151 | Ga0157370_10000001 | 3300013104 | Bacteria | 529517 |
| 152 | Ga0157370_10037285 | 3300013104 | Bacteria | 4713 |
| 153 | Ga0157370_10397729 | 3300013104 | Bacteria | 1268 |
| 154 | Ga0157369_10000017 | 3300013105 | Bacteria | 246520 |
| 155 | Ga0157369_10004443 | 3300013105 | Bacteria | 16534 |
| 156 | Ga0157369_10016885 | 3300013105 | Bacteria | 8203 |
| 157 | Ga0157369_10022931 | 3300013105 | Bacteria | 6961 |
| 158 | Ga0157369_10044167 | 3300013105 | Bacteria | 4851 |
| 159 | Ga0157369_10046360 | 3300013105 | Bacteria | 4724 |
| 160 | Ga0157369_10048827 | 3300013105 | Bacteria | 4591 |
| 161 | Ga0157369_10117357 | 3300013105 | Bacteria | 2825 |
| 162 | Ga0157369_10129399 | 3300013105 | Bacteria | 2676 |
| 163 | Ga0157369_10173038 | 3300013105 | Bacteria | 2274 |
| 164 | Ga0157369_10214732 | 3300013105 | Bacteria | 2015 |
| 165 | Ga0157369_10284798 | 3300013105 | Unclassified | 1721 |
| 166 | Ga0157369_10295934 | 3300013105 | Bacteria | 1684 |
| 167 | Ga0157374_10004278 | 3300013296 | Bacteria | 12009 |
| 168 | Ga0157374_10071725 | 3300013296 | Bacteria | 3267 |
| 169 | Ga0157374_10180701 | 3300013296 | Bacteria | 2060 |
| 170 | Ga0157374_10370701 | 3300013296 | Unclassified | 1425 |
| 171 | Ga0157374_10404351 | 3300013296 | Bacteria | 1362 |
| 172 | Ga0157374_10495840 | 3300013296 | Unclassified | 1225 |
| 173 | Ga0157378_10003524 | 3300013297 | Bacteria | 13877 |
| 174 | Ga0157378_10145171 | 3300013297 | Bacteria | 2207 |
| 175 | Ga0157378_10283379 | 3300013297 | Bacteria | 1598 |
| 176 | Ga0163162_10014850 | 3300013306 | Bacteria | 7605 |
| 177 | Ga0163162_10405498 | 3300013306 | Unclassified | 1496 |
| 178 | Ga0157372_10000019 | 3300013307 | Bacteria | 209591 |
| 179 | Ga0157372_10000581 | 3300013307 | Bacteria | 39954 |
| 180 | Ga0157372_10005466 | 3300013307 | Bacteria | 13499 |
| 181 | Ga0157372_10009465 | 3300013307 | Bacteria | 10361 |
| 182 | Ga0157372_10034116 | 3300013307 | Bacteria | 5593 |
| 183 | Ga0157372_10062821 | 3300013307 | Unclassified | 4162 |
| 184 | Ga0157372_10142348 | 3300013307 | Unclassified | 2764 |
| 185 | Ga0157372_10556255 | 3300013307 | Bacteria | 1337 |
| 186 | Ga0157375_10006666 | 3300013308 | Bacteria | 10055 |
| 187 | Ga0157375_10399610 | 3300013308 | Bacteria | 1541 |
| 188 | Ga0157375_10469888 | 3300013308 | Bacteria | 1423 |
| 189 | Ga0163163_10001460 | 3300014325 | Bacteria | 19976 |
| 190 | Ga0163163_10028986 | 3300014325 | Bacteria | 5322 |
| 191 | Ga0163163_10111040 | 3300014325 | Bacteria | 2771 |
| 192 | Ga0157377_10294552 | 3300014745 | Bacteria | 1069 |
| 193 | Ga0157379_10000374 | 3300014968 | Bacteria | 36109 |
| 194 | Ga0157379_10293998 | 3300014968 | Bacteria | 1480 |
| 195 | Ga0157376_10018547 | 3300014969 | Bacteria | 5338 |
| 196 | Ga0157376_10044688 | 3300014969 | Bacteria | 3642 |
| 197 | Ga0157376_10391400 | 3300014969 | Unclassified | 1341 |
| 198 | Ga0163161_10025447 | 3300017792 | Bacteria | 4188 |
| 199 | Ga0207656_10018482 | 3300025321 | Unclassified | 2746 |
| 200 | Ga0207656_10113338 | 3300025321 | Unclassified | 1255 |
| 201 | Ga0207692_10335605 | 3300025898 | Bacteria | 928 |
| 202 | Ga0207710_10118473 | 3300025900 | Bacteria | 1262 |
| 203 | Ga0207680_10340012 | 3300025903 | Bacteria | 1053 |
| 204 | Ga0207647_10014446 | 3300025904 | Bacteria | 5442 |
| 205 | Ga0207645_10101381 | 3300025907 | Bacteria | 1858 |
| 206 | Ga0207705_10058262 | 3300025909 | Bacteria | 2787 |
| 207 | Ga0207705_10092803 | 3300025909 | Bacteria | 2212 |
| 208 | Ga0207654_10000039 | 3300025911 | Bacteria | 105913 |
| 209 | Ga0207654_10000268 | 3300025911 | Bacteria | 31847 |
| 210 | Ga0207654_10021293 | 3300025911 | Bacteria | 3446 |
| 211 | Ga0207654_10059899 | 3300025911 | Bacteria | 2223 |
| 212 | Ga0207707_10004693 | 3300025912 | Bacteria | 11999 |
| 213 | Ga0207707_10211157 | 3300025912 | Unclassified | 1691 |
| 214 | Ga0207695_10000026 | 3300025913 | Bacteria | 624558 |
| 215 | Ga0207695_10000161 | 3300025913 | Bacteria | 199839 |
| 216 | Ga0207695_10000252 | 3300025913 | Bacteria | 139109 |
| 217 | Ga0207695_10001781 | 3300025913 | Bacteria | 33978 |
| 218 | Ga0207695_10002510 | 3300025913 | Bacteria | 26966 |
| 219 | Ga0207695_10008556 | 3300025913 | Bacteria | 12788 |
| 220 | Ga0207695_10048591 | 3300025913 | Bacteria | 4480 |
| 221 | Ga0207695_10071828 | 3300025913 | Bacteria | 3534 |
| 222 | Ga0207695_10116151 | 3300025913 | Bacteria | 2650 |
| 223 | Ga0207695_10159389 | 3300025913 | Bacteria | 2189 |
| 224 | Ga0207695_10189703 | 3300025913 | Bacteria | 1973 |
| 225 | Ga0207671_10000082 | 3300025914 | Bacteria | 146424 |
| 226 | Ga0207671_10000512 | 3300025914 | Bacteria | 52517 |
| 227 | Ga0207671_10273204 | 3300025914 | Bacteria | 1332 |
| 228 | Ga0207663_10000900 | 3300025916 | Bacteria | 13557 |
| 229 | Ga0207663_10003963 | 3300025916 | Bacteria | 7326 |
| 230 | Ga0207660_10007894 | 3300025917 | Bacteria | 6888 |
| 231 | Ga0207657_10010018 | 3300025919 | Bacteria | 9481 |
| 232 | Ga0207649_10145098 | 3300025920 | Bacteria | 1628 |
| 233 | Ga0207649_10347752 | 3300025920 | Bacteria | 1096 |
| 234 | Ga0207652_10013526 | 3300025921 | Bacteria | 6601 |
| 235 | Ga0207694_10000246 | 3300025924 | Bacteria | 51904 |
| 236 | Ga0207694_10001021 | 3300025924 | Bacteria | 24393 |
| 237 | Ga0207694_10001303 | 3300025924 | Bacteria | 21502 |
| 238 | Ga0207694_10045135 | 3300025924 | Bacteria | 3404 |
| 239 | Ga0207694_10059504 | 3300025924 | Bacteria | 2971 |
| 240 | Ga0207694_10067515 | 3300025924 | Bacteria | 2791 |
| 241 | Ga0207694_10325143 | 3300025924 | Bacteria | 1270 |
| 242 | Ga0207650_10025708 | 3300025925 | Bacteria | 4196 |
| 243 | Ga0207687_10005794 | 3300025927 | Bacteria | 8174 |
| 244 | Ga0207700_10004998 | 3300025928 | Bacteria | 7884 |
| 245 | Ga0207700_10061834 | 3300025928 | Unclassified | 2841 |
| 246 | Ga0207664_10178872 | 3300025929 | Bacteria | 1820 |
| 247 | Ga0207664_10505747 | 3300025929 | Unclassified | 1082 |
| 248 | Ga0207690_10542099 | 3300025932 | Unclassified | 945 |
| 249 | Ga0207706_10003046 | 3300025933 | Bacteria | 16157 |
| 250 | Ga0207704_10160849 | 3300025938 | Bacteria | 1597 |
| 251 | Ga0207691_10100702 | 3300025940 | Bacteria | 2579 |
| 252 | Ga0207711_10001763 | 3300025941 | Bacteria | 19822 |
| 253 | Ga0207711_10043637 | 3300025941 | Bacteria | 3826 |
| 254 | Ga0207711_10093524 | 3300025941 | Bacteria | 2648 |
| 255 | Ga0207689_10001661 | 3300025942 | Bacteria | 21097 |
| 256 | Ga0207661_10000003 | 3300025944 | Bacteria | 611941 |
| 257 | Ga0207661_10000513 | 3300025944 | Bacteria | 25043 |
| 258 | Ga0207661_10207101 | 3300025944 | Bacteria | 1727 |
| 259 | Ga0207679_10069769 | 3300025945 | Bacteria | 2646 |
| 260 | Ga0207679_10557697 | 3300025945 | Bacteria | 1028 |
| 261 | Ga0207667_10000059 | 3300025949 | Bacteria | 192543 |
| 262 | Ga0207667_10002596 | 3300025949 | Bacteria | 22424 |
| 263 | Ga0207667_10023670 | 3300025949 | Bacteria | 6761 |
| 264 | Ga0207667_10078235 | 3300025949 | Bacteria | 3428 |
| 265 | Ga0207667_10181686 | 3300025949 | Bacteria | 2160 |
| 266 | Ga0207667_10193833 | 3300025949 | Unclassified | 2085 |
| 267 | Ga0207667_10253239 | 3300025949 | Bacteria | 1801 |
| 268 | Ga0207667_10376192 | 3300025949 | Bacteria | 1447 |
| 269 | Ga0207667_10398389 | 3300025949 | Unclassified | 1402 |
| 270 | Ga0207667_10433352 | 3300025949 | Bacteria | 1337 |
| 271 | Ga0207667_10448394 | 3300025949 | Bacteria | 1311 |
| 272 | Ga0207651_10537030 | 3300025960 | Bacteria | 1015 |
| 273 | Ga0207640_10054940 | 3300025981 | Unclassified | 2606 |
| 274 | Ga0207640_10151157 | 3300025981 | Unclassified | 1706 |
| 275 | Ga0207658_10032306 | 3300025986 | Bacteria | 3724 |
| 276 | Ga0207658_10402335 | 3300025986 | Bacteria | 1204 |
| 277 | Ga0207658_10496630 | 3300025986 | Bacteria | 1086 |
| 278 | Ga0207677_10001213 | 3300026023 | Bacteria | 13936 |
| 279 | Ga0207703_10181264 | 3300026035 | Bacteria | 1859 |
| 280 | Ga0207703_10717731 | 3300026035 | Bacteria | 951 |
| 281 | Ga0207639_10000152 | 3300026041 | Bacteria | 52289 |
| 282 | Ga0207639_10066440 | 3300026041 | Bacteria | 2803 |
| 283 | Ga0207639_10333189 | 3300026041 | Unclassified | 1351 |
| 284 | Ga0207639_10555483 | 3300026041 | Bacteria | 1054 |
| 285 | Ga0207702_10006929 | 3300026078 | Bacteria | 9707 |
| 286 | Ga0207702_10018638 | 3300026078 | Bacteria | 5742 |
| 287 | Ga0207702_10300887 | 3300026078 | Bacteria | 1522 |
| 288 | Ga0207702_10386633 | 3300026078 | Archaea | 1346 |
| 289 | Ga0207702_10548004 | 3300026078 | Bacteria | 1131 |
| 290 | Ga0207702_10589631 | 3300026078 | Bacteria | 1090 |
| 291 | Ga0207641_10012272 | 3300026088 | Bacteria | 7030 |
| 292 | Ga0207641_10116645 | 3300026088 | Bacteria | 2376 |
| 293 | Ga0207641_10253580 | 3300026088 | Bacteria | 1644 |
| 294 | Ga0207641_10510616 | 3300026088 | Bacteria | 1168 |
| 295 | Ga0207676_10156323 | 3300026095 | Unclassified | 1970 |
| 296 | Ga0207676_10360497 | 3300026095 | Bacteria | 1347 |
| 297 | Ga0207674_10002375 | 3300026116 | Bacteria | 23799 |
| 298 | Ga0207674_10012549 | 3300026116 | Bacteria | 9466 |
| 299 | Ga0207674_10109412 | 3300026116 | Bacteria | 2739 |
| 300 | Ga0207683_10023334 | 3300026121 | Bacteria | 5321 |
| 301 | Ga0207698_10000050 | 3300026142 | Bacteria | 88275 |
| 302 | Ga0207698_10002490 | 3300026142 | Bacteria | 10925 |
| 303 | Ga0207698_10012576 | 3300026142 | Bacteria | 5545 |
| 304 | Ga0207698_10041243 | 3300026142 | Bacteria | 3437 |
| 305 | Ga0207698_10404723 | 3300026142 | Bacteria | 1305 |
| 306 | Ga0207698_10538299 | 3300026142 | Bacteria | 1142 |
| 307 | Ga0268266_10118314 | 3300028379 | Unclassified | 2355 |
| 308 | Ga0268266_10133988 | 3300028379 | Bacteria | 2218 |
| 309 | Ga0268266_10158418 | 3300028379 | Unclassified | 2047 |
| 310 | Ga0268266_10872374 | 3300028379 | Bacteria | 870 |
| 311 | Ga0268264_10050359 | 3300028381 | Bacteria | 3468 |
| 312 | Ga0265337_1000188 | 3300028556 | Bacteria | 32521 |
| 313 | Ga0265337_1000324 | 3300028556 | Bacteria | 25503 |
| 314 | Ga0265337_1002557 | 3300028556 | Bacteria | 8282 |
| 315 | Ga0265337_1006670 | 3300028556 | Bacteria | 4411 |
| 316 | Ga0265337_1011931 | 3300028556 | Bacteria | 2975 |
| 317 | Ga0265337_1027583 | 3300028556 | Bacteria | 1711 |
| 318 | Ga0265326_10044194 | 3300028558 | Bacteria | 1264 |
| 319 | Ga0265326_10064467 | 3300028558 | Bacteria | 1036 |
| 320 | Ga0265326_10070864 | 3300028558 | Bacteria | 985 |
| 321 | Ga0265319_1012804 | 3300028563 | Bacteria | 3370 |
| 322 | Ga0265334_10001402 | 3300028573 | Bacteria | 11601 |
| 323 | Ga0265334_10041293 | 3300028573 | Bacteria | 1804 |
| 324 | Ga0265334_10119091 | 3300028573 | Unclassified | 944 |
| 325 | Ga0265318_10007337 | 3300028577 | Bacteria | 4992 |
| 326 | Ga0265318_10008245 | 3300028577 | Bacteria | 4652 |
| 327 | Ga0265323_10000084 | 3300028653 | Bacteria | 53536 |
| 328 | Ga0265323_10000536 | 3300028653 | Bacteria | 21048 |
| 329 | Ga0265323_10000688 | 3300028653 | Bacteria | 18398 |
| 330 | Ga0265323_10003780 | 3300028653 | Bacteria | 6601 |
| 331 | Ga0265323_10018891 | 3300028653 | Bacteria | 2663 |
| 332 | Ga0265323_10022245 | 3300028653 | Bacteria | 2424 |
| 333 | Ga0265323_10024054 | 3300028653 | Bacteria | 2318 |
| 334 | Ga0265323_10025382 | 3300028653 | Bacteria | 2244 |
| 335 | Ga0265323_10037987 | 3300028653 | Unclassified | 1762 |
| 336 | Ga0265322_10028989 | 3300028654 | Unclassified | 1581 |
| 337 | Ga0265336_10000240 | 3300028666 | Bacteria | 39084 |
| 338 | Ga0265336_10002723 | 3300028666 | Bacteria | 7151 |
| 339 | Ga0265336_10006394 | 3300028666 | Bacteria | 4247 |
| 340 | Ga0265336_10010484 | 3300028666 | Bacteria | 3173 |
| 341 | Ga0265338_10000237 | 3300028800 | Bacteria | 101850 |
| 342 | Ga0265338_10000556 | 3300028800 | Bacteria | 65347 |
| 343 | Ga0265338_10000789 | 3300028800 | Bacteria | 53624 |
| 344 | Ga0265338_10000810 | 3300028800 | Bacteria | 52720 |
| 345 | Ga0265338_10001431 | 3300028800 | Bacteria | 38817 |
| 346 | Ga0265338_10004391 | 3300028800 | Bacteria | 19076 |
| 347 | Ga0265338_10004396 | 3300028800 | Bacteria | 19066 |
| 348 | Ga0265338_10004961 | 3300028800 | Bacteria | 17629 |
| 349 | Ga0265338_10006143 | 3300028800 | Bacteria | 15415 |
| 350 | Ga0265338_10008146 | 3300028800 | Bacteria | 12788 |
| 351 | Ga0265338_10010139 | 3300028800 | Bacteria | 11113 |
| 352 | Ga0265338_10010928 | 3300028800 | Bacteria | 10553 |
| 353 | Ga0265338_10018070 | 3300028800 | Bacteria | 7566 |
| 354 | Ga0265338_10023748 | 3300028800 | Bacteria | 6289 |
| 355 | Ga0265338_10024129 | 3300028800 | Bacteria | 6224 |
| 356 | Ga0265338_10026625 | 3300028800 | Bacteria | 5825 |
| 357 | Ga0265338_10035847 | 3300028800 | Bacteria | 4758 |
| 358 | Ga0265338_10058183 | 3300028800 | Bacteria | 3414 |
| 359 | Ga0265338_10062938 | 3300028800 | Bacteria | 3239 |
| 360 | Ga0265338_10101226 | 3300028800 | Bacteria | 2346 |
| 361 | Ga0265338_10113204 | 3300028800 | Bacteria | 2180 |
| 362 | Ga0265338_10144490 | 3300028800 | Bacteria | 1858 |
| 363 | Ga0265338_10188873 | 3300028800 | Viruses | 1563 |
| 364 | Ga0265338_10346820 | 3300028800 | Unclassified | 1069 |
| 365 | Ga0265324_10000475 | 3300029957 | Bacteria | 28206 |
| 366 | Ga0265324_10000734 | 3300029957 | Bacteria | 21854 |
| 367 | Ga0265324_10008241 | 3300029957 | Bacteria | 4154 |
| 368 | Ga0265324_10063746 | 3300029957 | Bacteria | 1258 |
| 369 | Ga0265324_10111901 | 3300029957 | Unclassified | 927 |
| 370 | Ga0265330_10000180 | 3300031235 | Bacteria | 48901 |
| 371 | Ga0265330_10002956 | 3300031235 | Bacteria | 9051 |
| 372 | Ga0265330_10005425 | 3300031235 | Bacteria | 6358 |
| 373 | Ga0265330_10022078 | 3300031235 | Bacteria | 2900 |
| 374 | Ga0265330_10038742 | 3300031235 | Bacteria | 2119 |
| 375 | Ga0265330_10042738 | 3300031235 | Bacteria | 2007 |
| 376 | Ga0265330_10044042 | 3300031235 | Bacteria | 1972 |
| 377 | Ga0265330_10089065 | 3300031235 | Bacteria | 1326 |
| 378 | Ga0265332_10023040 | 3300031238 | Bacteria | 2746 |
| 379 | Ga0265332_10111877 | 3300031238 | Bacteria | 1150 |
| 380 | Ga0265328_10009260 | 3300031239 | Unclassified | 4017 |
| 381 | Ga0265328_10011808 | 3300031239 | Unclassified | 3484 |
| 382 | Ga0265328_10032569 | 3300031239 | Bacteria | 1935 |
| 383 | Ga0265328_10045590 | 3300031239 | Bacteria | 1612 |
| 384 | Ga0265328_10074849 | 3300031239 | Bacteria | 1246 |
| 385 | Ga0265320_10000188 | 3300031240 | Bacteria | 51229 |
| 386 | Ga0265320_10000816 | 3300031240 | Bacteria | 23497 |
| 387 | Ga0265320_10009797 | 3300031240 | Bacteria | 5746 |
| 388 | Ga0265320_10042500 | 3300031240 | Bacteria | 2254 |
| 389 | Ga0265320_10051024 | 3300031240 | Bacteria | 2009 |
| 390 | Ga0265320_10148377 | 3300031240 | Bacteria | 1060 |
| 391 | Ga0265320_10154666 | 3300031240 | Unclassified | 1035 |
| 392 | Ga0265325_10000086 | 3300031241 | Bacteria | 64912 |
| 393 | Ga0265325_10003105 | 3300031241 | Bacteria | 10966 |
| 394 | Ga0265325_10011002 | 3300031241 | Bacteria | 5210 |
| 395 | Ga0265325_10012548 | 3300031241 | Bacteria | 4842 |
| 396 | Ga0265325_10028281 | 3300031241 | Bacteria | 3024 |
| 397 | Ga0265325_10059284 | 3300031241 | Unclassified | 1946 |
| 398 | Ga0265325_10077361 | 3300031241 | Bacteria | 1658 |
| 399 | Ga0265325_10078477 | 3300031241 | Bacteria | 1644 |
| 400 | Ga0265325_10101905 | 3300031241 | Bacteria | 1404 |
| 401 | Ga0265329_10001542 | 3300031242 | Bacteria | 11029 |
| 402 | Ga0265340_10004974 | 3300031247 | Bacteria | 7389 |
| 403 | Ga0265340_10010689 | 3300031247 | Bacteria | 4904 |
| 404 | Ga0265340_10012229 | 3300031247 | Bacteria | 4536 |
| 405 | Ga0265340_10015868 | 3300031247 | Bacteria | 3907 |
| 406 | Ga0265340_10041705 | 3300031247 | Bacteria | 2255 |
| 407 | Ga0265340_10050942 | 3300031247 | Bacteria | 2006 |
| 408 | Ga0265340_10068903 | 3300031247 | Bacteria | 1679 |
| 409 | Ga0265340_10073130 | 3300031247 | Bacteria | 1623 |
| 410 | Ga0265340_10092428 | 3300031247 | Bacteria | 1413 |
| 411 | Ga0265339_10000003 | 3300031249 | Bacteria | 305994 |
| 412 | Ga0265339_10000870 | 3300031249 | Bacteria | 23232 |
| 413 | Ga0265339_10007801 | 3300031249 | Bacteria | 6875 |
| 414 | Ga0265339_10012119 | 3300031249 | Bacteria | 5278 |
| 415 | Ga0265339_10027013 | 3300031249 | Bacteria | 3283 |
| 416 | Ga0265339_10028998 | 3300031249 | Bacteria | 3143 |
| 417 | Ga0265339_10047867 | 3300031249 | Bacteria | 2347 |
| 418 | Ga0265339_10068233 | 3300031249 | Bacteria | 1901 |
| 419 | Ga0265339_10106817 | 3300031249 | Archaea | 1452 |
| 420 | Ga0265339_10165086 | 3300031249 | Bacteria | 1112 |
| 421 | Ga0265331_10015387 | 3300031250 | Unclassified | 4040 |
| 422 | Ga0265331_10034859 | 3300031250 | Bacteria | 2480 |
| 423 | Ga0265331_10037776 | 3300031250 | Unclassified | 2363 |
| 424 | Ga0265331_10104103 | 3300031250 | Bacteria | 1305 |
| 425 | Ga0265327_10014147 | 3300031251 | Bacteria | 5238 |
| 426 | Ga0265327_10020540 | 3300031251 | Bacteria | 4019 |
| 427 | Ga0265327_10061992 | 3300031251 | Bacteria | 1905 |
| 428 | Ga0265316_10003058 | 3300031344 | Bacteria | 17083 |
| 429 | Ga0265316_10003587 | 3300031344 | Bacteria | 15644 |
| 430 | Ga0265316_10004340 | 3300031344 | Bacteria | 14132 |
| 431 | Ga0265316_10006710 | 3300031344 | Bacteria | 10968 |
| 432 | Ga0265316_10012932 | 3300031344 | Bacteria | 7448 |
| 433 | Ga0265316_10014044 | 3300031344 | Bacteria | 7072 |
| 434 | Ga0265316_10018447 | 3300031344 | Bacteria | 5995 |
| 435 | Ga0265316_10020951 | 3300031344 | Bacteria | 5550 |
| 436 | Ga0265316_10023806 | 3300031344 | Bacteria | 5142 |
| 437 | Ga0265316_10030079 | 3300031344 | Bacteria | 4457 |
| 438 | Ga0265316_10030617 | 3300031344 | Bacteria | 4408 |
| 439 | Ga0265316_10033205 | 3300031344 | Unclassified | 4205 |
| 440 | Ga0265316_10055430 | 3300031344 | Bacteria | 3100 |
| 441 | Ga0265316_10071883 | 3300031344 | Bacteria | 2666 |
| 442 | Ga0265316_10076303 | 3300031344 | Bacteria | 2575 |
| 443 | Ga0265316_10084284 | 3300031344 | Bacteria | 2434 |
| 444 | Ga0265316_10093140 | 3300031344 | Bacteria | 2296 |
| 445 | Ga0265316_10098617 | 3300031344 | Bacteria | 2223 |
| 446 | Ga0265316_10108586 | 3300031344 | Bacteria | 2103 |
| 447 | Ga0265316_10149681 | 3300031344 | Bacteria | 1749 |
| 448 | Ga0265316_10185464 | 3300031344 | Bacteria | 1548 |
| 449 | Ga0265316_10195811 | 3300031344 | Bacteria | 1500 |
| 450 | Ga0265316_10288995 | 3300031344 | Bacteria | 1196 |
| 451 | Ga0265313_10003145 | 3300031595 | Bacteria | 13623 |
| 452 | Ga0265313_10006106 | 3300031595 | Bacteria | 8667 |
| 453 | Ga0265313_10009943 | 3300031595 | Bacteria | 6105 |
| 454 | Ga0265313_10012004 | 3300031595 | Bacteria | 5338 |
| 455 | Ga0265313_10014760 | 3300031595 | Bacteria | 4595 |
| 456 | Ga0265313_10022667 | 3300031595 | Bacteria | 3400 |
| 457 | Ga0265313_10037336 | 3300031595 | Bacteria | 2430 |
| 458 | Ga0316575_10000074 | 3300031665 | Bacteria | 24489 |
| 459 | Ga0265314_10000047 | 3300031711 | Bacteria | 194061 |
| 460 | Ga0265314_10000148 | 3300031711 | Bacteria | 105207 |
| 461 | Ga0265314_10000509 | 3300031711 | Bacteria | 50279 |
| 462 | Ga0265314_10001672 | 3300031711 | Bacteria | 24160 |
| 463 | Ga0265314_10026386 | 3300031711 | Bacteria | 4365 |
| 464 | Ga0265314_10040681 | 3300031711 | Bacteria | 3334 |
| 465 | Ga0265314_10112883 | 3300031711 | Unclassified | 1724 |
| 466 | Ga0265314_10216913 | 3300031711 | Bacteria | 1119 |
| 467 | Ga0265314_10238984 | 3300031711 | Bacteria | 1049 |
| 468 | Ga0265342_10000208 | 3300031712 | Bacteria | 66250 |
| 469 | Ga0265342_10000451 | 3300031712 | Bacteria | 44943 |
| 470 | Ga0265342_10003573 | 3300031712 | Bacteria | 12704 |
| 471 | Ga0265342_10005582 | 3300031712 | Bacteria | 9538 |
| 472 | Ga0265342_10006053 | 3300031712 | Bacteria | 9080 |
| 473 | Ga0265342_10037262 | 3300031712 | Bacteria | 2966 |
| 474 | Ga0265342_10045795 | 3300031712 | Bacteria | 2631 |
| 475 | Ga0265342_10067191 | 3300031712 | Bacteria | 2098 |
| 476 | Ga0265342_10071188 | 3300031712 | Bacteria | 2027 |
| 477 | Ga0265342_10088660 | 3300031712 | Bacteria | 1776 |
| 478 | Ga0265342_10110768 | 3300031712 | Unclassified | 1554 |
| 479 | Ga0316576_10130968 | 3300031727 | Bacteria | 1887 |
| 480 | Ga0316576_10132643 | 3300031727 | Bacteria | 1874 |
| 481 | Ga0307416_100093022 | 3300032002 | Bacteria | 2596 |
| 482 | Ga0373934_0011219 | 3300035086 | Bacteria | 3372 |
| 483 | Ga0373934_0028820 | 3300035086 | Unclassified | 2166 |
| 484 | Ga0373951_0007969 | 3300035091 | Bacteria | 2401 |
| 485 | Ga0373936_0016469 | 3300035113 | Unclassified | 2844 |
| 486 | Ga0373945_0019674 | 3300035116 | Bacteria | 2307 |
| 487 | Ga0373953_0010066 | 3300035117 | Bacteria | 3278 |
| 488 | Ga0373954_0025316 | 3300035118 | Bacteria | 2712 |
| 489 | Ga0373954_0061639 | 3300035118 | Unclassified | 1770 |
| 490 | Ga0373956_0062388 | 3300035119 | Bacteria | 1689 |
| 491 | Ga0373956_0143864 | 3300035119 | Bacteria | 1120 |
| 492 | Ga0373956_0239729 | 3300035119 | Unclassified | 862 |
| 493 | Ga0373943_0147917 | 3300035170 | Bacteria | 1271 |
| 494 | Ga0373935_0037860 | 3300035692 | Bacteria | 3019 |
| 495 | Ga0373927_0297629 | 3300035695 | Unclassified | 1062 |
| 496 | Ga0373933_0062085 | 3300035724 | Bacteria | 2256 |
| 497 | Ga0373947_0041759 | 3300035725 | Unclassified | 2736 |
| 498 | Ga0373947_0366302 | 3300035725 | Unclassified | 969 |
| 499 | Ga0373937_0013533 | 3300036401 | Bacteria | 7185 |
| 500 | Ga0373937_0155753 | 3300036401 | Bacteria | 2141 |
| 501 | Ga0373937_0296849 | 3300036401 | Bacteria | 1527 |
| 502 | Ga0373937_0667596 | 3300036401 | Bacteria | 985 |
| 503 | Ga0373925_0006624 | 3300037068 | Bacteria | 8512 |
| 504 | Ga0373925_0448723 | 3300037068 | Bacteria | 1056 |
| 505 | Ga0451577_0000063 | 3300042876 | Bacteria | 264379 |
| 506 | Ga0451577_0001897 | 3300042876 | Bacteria | 26518 |
| 507 | Ga0451577_0004611 | 3300042876 | Bacteria | 14477 |
| 508 | Ga0451577_0009052 | 3300042876 | Bacteria | 9610 |
| 509 | Ga0451577_0021043 | 3300042876 | Bacteria | 5976 |
| 510 | Ga0451577_0025593 | 3300042876 | Bacteria | 5352 |
| 511 | Ga0451577_0054561 | 3300042876 | Bacteria | 3567 |
| 512 | Ga0451577_0060929 | 3300042876 | Bacteria | 3364 |
| 513 | Ga0451577_0063111 | 3300042876 | Bacteria | 3304 |
| 514 | Ga0451577_0091297 | 3300042876 | Bacteria | 2718 |
| 515 | Ga0451577_0196676 | 3300042876 | Bacteria | 1820 |
| 516 | Ga0451577_0201185 | 3300042876 | Bacteria | 1798 |
| 517 | Ga0451577_0310086 | 3300042876 | Bacteria | 1430 |
| 518 | Ga0451577_0328553 | 3300042876 | Bacteria | 1387 |
| 519 | Ga0451577_0346855 | 3300042876 | Bacteria | 1347 |
| 520 | Ga0451577_0354827 | 3300042876 | Bacteria | 1330 |
| 521 | Ga0451577_0403618 | 3300042876 | Bacteria | 1241 |
| 522 | Ga0451577_0435997 | 3300042876 | Bacteria | 1190 |
| 523 | Ga0451577_0440833 | 3300042876 | Bacteria | 1182 |
| 524 | Ga0451577_0537353 | 3300042876 | Bacteria | 1061 |
| 525 | Ga0451577_0586208 | 3300042876 | Bacteria | 1012 |
| 526 | Ga0451577_0668536 | 3300042876 | Bacteria | 941 |
| 527 | Ga0451577_0887828 | 3300042876 | Bacteria | 803 |
| 528 | Ga0451577_0890353 | 3300042876 | Bacteria | 802 |
| 529 | Ga0453683_0000114 | 3300044673 | Bacteria | 119864 |
| 530 | Ga0453683_0000390 | 3300044673 | Bacteria | 52382 |
| 531 | Ga0453683_0001084 | 3300044673 | Bacteria | 25080 |
| 532 | Ga0453683_0196619 | 3300044673 | Bacteria | 1280 |
| 533 | Ga0453683_0237104 | 3300044673 | Bacteria | 1161 |
| 534 | Ga0453683_0285883 | 3300044673 | Bacteria | 1054 |
| 535 | Ga0453683_0319890 | 3300044673 | Bacteria | 994 |
| 536 | Ga0453683_0523685 | 3300044673 | Bacteria | 770 |
| 537 | Ga0466961_0067036 | 3300044693 | Unclassified | 2280 |
| 538 | Ga0466963_0020464 | 3300044694 | Unclassified | 4161 |
| 539 | Ga0453684_0000198 | 3300044712 | Bacteria | 264379 |
| 540 | Ga0453684_0000266 | 3300044712 | Bacteria | 225447 |
| 541 | Ga0453684_0000417 | 3300044712 | Bacteria | 173793 |
| 542 | Ga0453684_0000455 | 3300044712 | Bacteria | 165080 |
| 543 | Ga0453684_0000725 | 3300044712 | Bacteria | 116265 |
| 544 | Ga0453684_0001063 | 3300044712 | Bacteria | 87449 |
| 545 | Ga0453684_0001817 | 3300044712 | Bacteria | 56194 |
| 546 | Ga0453684_0002936 | 3300044712 | Bacteria | 39991 |
| 547 | Ga0453684_0003575 | 3300044712 | Bacteria | 34707 |
| 548 | Ga0453684_0007772 | 3300044712 | Bacteria | 19566 |
| 549 | Ga0453684_0011217 | 3300044712 | Bacteria | 15085 |
| 550 | Ga0453684_0011768 | 3300044712 | Bacteria | 14584 |
| 551 | Ga0453684_0013310 | 3300044712 | Bacteria | 13386 |
| 552 | Ga0453684_0016077 | 3300044712 | Bacteria | 11743 |
| 553 | Ga0453684_0018573 | 3300044712 | Bacteria | 10658 |
| 554 | Ga0453684_0022113 | 3300044712 | Bacteria | 9457 |
| 555 | Ga0453684_0025700 | 3300044712 | Bacteria | 8538 |
| 556 | Ga0453684_0030196 | 3300044712 | Bacteria | 7664 |
| 557 | Ga0453684_0059446 | 3300044712 | Bacteria | 4927 |
| 558 | Ga0453684_0110608 | 3300044712 | Bacteria | 3339 |
| 559 | Ga0453684_0114896 | 3300044712 | Bacteria | 3262 |
| 560 | Ga0453684_0166078 | 3300044712 | Bacteria | 2605 |
| 561 | Ga0453684_0290292 | 3300044712 | Bacteria | 1863 |
| 562 | Ga0453684_0298544 | 3300044712 | Bacteria | 1832 |
| 563 | Ga0453684_0318226 | 3300044712 | Bacteria | 1763 |
| 564 | Ga0453684_0370341 | 3300044712 | Bacteria | 1610 |
| 565 | Ga0453684_0472854 | 3300044712 | Bacteria | 1392 |
| 566 | Ga0453684_0585638 | 3300044712 | Bacteria | 1225 |
| 567 | Ga0466957_0123211 | 3300044842 | Bacteria | 1654 |
| 568 | Ga0451576_0000087 | 3300045051 | Bacteria | 234554 |
| 569 | Ga0451576_0000151 | 3300045051 | Bacteria | 176466 |
| 570 | Ga0451576_0001262 | 3300045051 | Bacteria | 44382 |
| 571 | Ga0451576_0003642 | 3300045051 | Bacteria | 20916 |
| 572 | Ga0451576_0073186 | 3300045051 | Bacteria | 3566 |
| 573 | Ga0451576_0073276 | 3300045051 | Bacteria | 3564 |
| 574 | Ga0451576_0099338 | 3300045051 | Bacteria | 3028 |
| 575 | Ga0451576_0107790 | 3300045051 | Bacteria | 2899 |
| 576 | Ga0451576_0262133 | 3300045051 | Bacteria | 1807 |
| 577 | Ga0451576_0281139 | 3300045051 | Bacteria | 1740 |
| 578 | Ga0451576_0313191 | 3300045051 | Bacteria | 1642 |
| 579 | Ga0451576_0410296 | 3300045051 | Bacteria | 1421 |
| 580 | Ga0451576_0459790 | 3300045051 | Bacteria | 1336 |
| 581 | Ga0451576_0487861 | 3300045051 | Bacteria | 1294 |
| 582 | Ga0451576_0683469 | 3300045051 | Bacteria | 1078 |
| 583 | Ga0451576_0692848 | 3300045051 | Bacteria | 1070 |
| 584 | Ga0466958_0060973 | 3300045836 | Unclassified | 2297 |
| 585 | Ga0466967_0025698 | 3300045976 | Bacteria | 4859 |
| 586 | Ga0466967_0411688 | 3300045976 | Bacteria | 1317 |
| 587 | Ga0495629_0116578 | 3300046459 | Bacteria | 1861 |
| 588 | Ga0495629_0194881 | 3300046459 | Bacteria | 1401 |
| 589 | Ga0495651_0006747 | 3300046462 | Bacteria | 8777 |
| 590 | Ga0495651_0051643 | 3300046462 | Bacteria | 3169 |
| 591 | Ga0495651_0186831 | 3300046462 | Unclassified | 1462 |
| 592 | Ga0495651_0366282 | 3300046462 | Bacteria | 948 |
| 593 | Ga0495580_0000624 | 3300046472 | Bacteria | 29941 |
| 594 | Ga0495580_0011318 | 3300046472 | Bacteria | 6903 |
| 595 | Ga0495580_0021108 | 3300046472 | Bacteria | 4808 |
| 596 | Ga0495580_0075353 | 3300046472 | Bacteria | 2354 |
| 597 | Ga0495580_0156013 | 3300046472 | Bacteria | 1580 |
| 598 | Ga0495580_0343006 | 3300046472 | Bacteria | 1013 |
| 599 | Ga0495580_0376003 | 3300046472 | Unclassified | 960 |
| 600 | Ga0495582_0007954 | 3300046473 | Bacteria | 5860 |
| 601 | Ga0495582_0154353 | 3300046473 | Unclassified | 1304 |
| 602 | Ga0495618_0083184 | 3300046514 | Bacteria | 2045 |
| 603 | Ga0495628_0145083 | 3300046516 | Unclassified | 1810 |
| 604 | Ga0495628_0246515 | 3300046516 | Bacteria | 1335 |
| 605 | Ga0495630_0054947 | 3300046517 | Bacteria | 2984 |
| 606 | Ga0495630_0125806 | 3300046517 | Unclassified | 1945 |
| 607 | Ga0495630_0253070 | 3300046517 | Bacteria | 1346 |
| 608 | Ga0495642_0188990 | 3300046528 | Bacteria | 897 |
| 609 | Ga0495652_0023598 | 3300046529 | Bacteria | 5453 |
| 610 | Ga0495652_0262875 | 3300046529 | Unclassified | 1273 |
| 611 | Ga0495665_0016275 | 3300046531 | Bacteria | 4007 |
| 612 | Ga0495665_0106767 | 3300046531 | Bacteria | 1469 |
| 613 | Ga0495640_0234070 | 3300046533 | Unclassified | 1154 |
| 614 | Ga0495586_0003876 | 3300046535 | Bacteria | 8011 |
| 615 | Ga0495587_0053392 | 3300046536 | Bacteria | 2383 |
| 616 | Ga0495587_0205205 | 3300046536 | Bacteria | 1114 |
| 617 | Ga0495645_0050462 | 3300046543 | Bacteria | 3029 |
| 618 | Ga0495645_0090050 | 3300046543 | Bacteria | 2193 |
| 619 | Ga0495645_0183812 | 3300046543 | Bacteria | 1430 |
| 620 | Ga0495667_0016297 | 3300046559 | Bacteria | 5021 |
| 621 | Ga0495667_0017693 | 3300046559 | Bacteria | 4815 |
| 622 | Ga0495634_0035927 | 3300046642 | Unclassified | 3391 |
| 623 | Ga0495657_0076654 | 3300046675 | Bacteria | 2171 |
| 624 | Ga0495657_0322963 | 3300046675 | Bacteria | 917 |
| 625 | Ga0495623_0147305 | 3300046679 | Bacteria | 1395 |
| 626 | Ga0495647_0183277 | 3300046681 | Bacteria | 912 |
| 627 | Ga0495669_0053409 | 3300046684 | Unclassified | 1817 |
| 628 | Ga0495669_0104850 | 3300046684 | Bacteria | 1316 |
| 629 | Ga0495613_0025877 | 3300046689 | Bacteria | 4372 |
| 630 | Ga0495613_0065729 | 3300046689 | Bacteria | 2650 |
| 631 | Ga0495613_0211805 | 3300046689 | Unclassified | 1363 |
| 632 | Ga0495600_0134536 | 3300046809 | Unclassified | 1606 |
| 633 | Ga0495581_0085102 | 3300047315 | Bacteria | 1833 |
| 634 | Ga0495581_0160006 | 3300047315 | Unclassified | 1316 |
| 635 | Ga0495604_0319311 | 3300047317 | Bacteria | 1038 |
| 636 | Ga0495674_0035796 | 3300047319 | Bacteria | 4475 |
| 637 | Ga0495674_0066071 | 3300047319 | Bacteria | 3140 |
| 638 | Ga0495674_0275718 | 3300047319 | Bacteria | 1379 |
| 639 | Ga0495674_0286892 | 3300047319 | Bacteria | 1347 |
| 640 | Ga0495674_0627400 | 3300047319 | Bacteria | 849 |
| 641 | Ga0495680_0023240 | 3300047322 | Bacteria | 5156 |
| 642 | Ga0495675_0010946 | 3300047444 | Bacteria | 5684 |
| 643 | Ga0495675_0138329 | 3300047444 | Unclassified | 1511 |
| 644 | Ga0495675_0360224 | 3300047444 | Bacteria | 854 |
| 645 | Ga0495684_0165504 | 3300047471 | Bacteria | 1647 |
| 646 | Ga0495602_0046772 | 3300048088 | Bacteria | 3905 |
| 647 | Ga0495602_0078419 | 3300048088 | Bacteria | 2790 |
| 648 | Ga0495602_0107464 | 3300048088 | Bacteria | 2274 |
| 649 | Ga0495602_0125706 | 3300048088 | Bacteria | 2055 |
| 650 | Ga0495602_0146540 | 3300048088 | Bacteria | 1862 |
| 651 | Ga0495614_0173953 | 3300048089 | Bacteria | 967 |
| 652 | Ga0496100_0028985 | 3300048903 | Unclassified | 3419 |
| 653 | Ga0496104_0172187 | 3300048907 | Bacteria | 2076 |
| 654 | Ga0496104_0272315 | 3300048907 | Bacteria | 1606 |
| 655 | Ga0496104_0441407 | 3300048907 | Bacteria | 1213 |
| 656 | Ga0496105_0045159 | 3300048908 | Unclassified | 3635 |
| 657 | Ga0496105_0267989 | 3300048908 | Bacteria | 1380 |
| 658 | Ga0496107_0054612 | 3300048910 | Unclassified | 2883 |
| 659 | Ga0496108_0093259 | 3300048911 | Bacteria | 2561 |
| 660 | Ga0496108_0202009 | 3300048911 | Bacteria | 1725 |
| 661 | Ga0496109_0804792 | 3300048912 | Bacteria | 878 |
| 662 | Ga0496113_0454009 | 3300048916 | Bacteria | 1030 |
| 663 | Ga0496114_0735236 | 3300048917 | Unclassified | 863 |
| 664 | Ga0496115_0034397 | 3300048918 | Unclassified | 4004 |
| 665 | Ga0496115_0103056 | 3300048918 | Unclassified | 2340 |
| 666 | Ga0496115_0110819 | 3300048918 | Bacteria | 2255 |
| 667 | Ga0496115_0209876 | 3300048918 | Unclassified | 1608 |
| 668 | Ga0496115_0243301 | 3300048918 | Unclassified | 1483 |
| 669 | Ga0496115_0324386 | 3300048918 | Unclassified | 1259 |
| 670 | Ga0496115_0419938 | 3300048918 | Bacteria | 1083 |
| 671 | Ga0496115_0477501 | 3300048918 | Unclassified | 1004 |
| 672 | Ga0501031_0220501 | 3300049568 | Unclassified | 1235 |
| 673 | Ga0501076_0410362 | 3300049592 | Bacteria | 1114 |
| 674 | Ga0495601_0020011 | 3300053077 | Bacteria | 4085 |
| 675 | Ga0495619_0181031 | 3300053085 | Unclassified | 1458 |
| 676 | Ga0501082_0000989 | 3300060353 | Bacteria | 25116 |
| 677 | Ga0501082_0017125 | 3300060353 | Bacteria | 6244 |
| 678 | Ga0265325_10103886 | |||
| 679 | rootH1_10300435 | |||
| 680 | Ga0070658_10070224 | |||
| 681 | Ga0070658_10247563 | |||
| 682 | Ga0070683_100000026 | |||
| 683 | Ga0070683_100000282 | |||
| 684 | Ga0070683_100143624 | |||
| 685 | Ga0070670_100110957 | |||
| 686 | Ga0068869_100013385 | |||
| 687 | Ga0070680_100009538 | |||
| 688 | Ga0068868_100080216 | |||
| 689 | Ga0070660_100010134 | |||
| 690 | Ga0070661_100008281 | |||
| 691 | Ga0070661_100019455 | |||
| 692 | Ga0070661_100055414 | |||
| 693 | Ga0070661_100274250 | |||
| 694 | Ga0070671_100044626 | |||
| 695 | Ga0070671_100054642 | |||
| 696 | Ga0070671_100117457 | |||
| 697 | Ga0070673_100124177 | |||
| 698 | Ga0070667_100003517 | |||
| 699 | Ga0070667_100299946 | |||
| 700 | Ga0070714_100001263 | |||
| 701 | Ga0070714_100224754 | |||
| 702 | Ga0070714_100333092 | |||
| 703 | Ga0070713_100003077 | |||
| 704 | Ga0070713_100004121 | |||
| 705 | Ga0070713_100014155 | |||
| 706 | Ga0070713_100124300 | |||
| 707 | Ga0070713_100552905 | |||
| 708 | Ga0070711_100004372 | |||
| 709 | Ga0070662_100052314 | |||
| 710 | Ga0070681_10001126 | |||
| 711 | Ga0070681_10134513 | |||
| 712 | Ga0070679_100043017 | |||
| 713 | Ga0070684_100000012 | |||
| 714 | Ga0070684_100001159 | |||
| 715 | Ga0070684_100035397 | |||
| 716 | Ga0070684_100043481 | |||
| 717 | Ga0070684_100129547 | |||
| 718 | Ga0070684_100190297 | |||
| 719 | Ga0070684_100589636 | |||
| 720 | Ga0068853_100000333 | |||
| 721 | Ga0070693_100032934 | |||
| 722 | Ga0070665_100230401 | |||
| 723 | Ga0070665_100423398 | |||
| 724 | Ga0068855_100003357 | |||
| 725 | Ga0068855_100008795 | |||
| 726 | Ga0068855_100044214 | |||
| 727 | Ga0068855_100058817 | |||
| 728 | Ga0068855_100121476 | |||
| 729 | Ga0068855_100162780 | |||
| 730 | Ga0068855_100543661 | |||
| 731 | Ga0070664_100086357 | |||
| 732 | Ga0070664_100243088 | |||
| 733 | Ga0068857_100009334 | |||
| 734 | Ga0068857_100017542 | |||
| 735 | Ga0068857_100104551 | |||
| 736 | Ga0068857_100305271 | |||
| 737 | Ga0068854_100070484 | |||
| 738 | Ga0068854_100113105 | |||
| 739 | Ga0068856_100002161 | |||
| 740 | Ga0068856_100008946 | |||
| 741 | Ga0068856_100036509 | |||
| 742 | Ga0068856_100048288 | |||
| 743 | Ga0068856_100048644 | |||
| 744 | Ga0068856_100085783 | |||
| 745 | Ga0068856_100099309 | |||
| 746 | Ga0068856_100317802 | |||
| 747 | Ga0068852_100000017 | |||
| 748 | Ga0068852_100000676 | |||
| 749 | Ga0068852_100027078 | |||
| 750 | Ga0068852_100055695 | |||
| 751 | Ga0068852_100191176 | |||
| 752 | Ga0068852_100273533 | |||
| 753 | Ga0068852_100618775 | |||
| 754 | Ga0068859_100002738 | |||
| 755 | Ga0068859_100088276 | |||
| 756 | Ga0068864_100015071 | |||
| 757 | Ga0068864_100272506 | |||
| 758 | Ga0068851_10004801 | |||
| 759 | Ga0068851_10010464 | |||
| 760 | Ga0068851_10010677 | |||
| 761 | Ga0068851_10154891 | |||
| 762 | Ga0068863_100003424 | |||
| 763 | Ga0068863_100068396 | |||
| 764 | Ga0068863_100082246 | |||
| 765 | Ga0068858_100022417 | |||
| 766 | Ga0068858_100053026 | |||
| 767 | Ga0068860_100013582 | |||
| 768 | Ga0068860_100061644 | |||
| 769 | Ga0070717_10025158 | |||
| 770 | Ga0070717_10044393 | |||
| 771 | Ga0070717_10364564 | |||
| 772 | Ga0070712_100226454 | |||
| 773 | Ga0097621_100011678 | |||
| 774 | Ga0097621_100042117 | |||
| 775 | Ga0068871_100001265 | |||
| 776 | Ga0068871_100005801 | |||
| 777 | Ga0068871_100084969 | |||
| 778 | Ga0068871_100194692 | |||
| 779 | Ga0068865_100108440 | |||
| 780 | Ga0097620_100002738 | |||
| 781 | Ga0097620_100088276 | |||
| 782 | Ga0075435_100540917 | |||
| 783 | Ga0105240_10000110 | |||
| 784 | Ga0105240_10000480 | |||
| 785 | Ga0105240_10001244 | |||
| 786 | Ga0105240_10002039 | |||
| 787 | Ga0105240_10012029 | |||
| 788 | Ga0105240_10040023 | |||
| 789 | Ga0105240_10045967 | |||
| 790 | Ga0105240_10199660 | |||
| 791 | Ga0105240_10661669 | |||
| 792 | Ga0105240_10662789 | |||
| 793 | Ga0105245_10070406 | |||
| 794 | Ga0105245_10097181 | |||
| 795 | Ga0105245_10525834 | |||
| 796 | Ga0105247_10006855 | |||
| 797 | Ga0105247_10081049 | |||
| 798 | Ga0105243_10624078 | |||
| 799 | Ga0105241_10000029 | |||
| 800 | Ga0105241_10002831 | |||
| 801 | Ga0105241_10022106 | |||
| 802 | Ga0105241_10134819 | |||
| 803 | Ga0105248_10000795 | |||
| 804 | Ga0105248_10012989 | |||
| 805 | Ga0105248_10032082 | |||
| 806 | Ga0105237_10055987 | |||
| 807 | Ga0105237_10181772 | |||
| 808 | Ga0105237_10498497 | |||
| 809 | Ga0105237_10935165 | |||
| 810 | Ga0105238_10001519 | |||
| 811 | Ga0105238_10001766 | |||
| 812 | Ga0105238_10002101 | |||
| 813 | Ga0105238_10004609 | |||
| 814 | Ga0105238_10017870 | |||
| 815 | Ga0105238_10041491 | |||
| 816 | Ga0105238_10061243 | |||
| 817 | Ga0105238_10083687 | |||
| 818 | Ga0105238_10094726 | |||
| 819 | Ga0105238_10362012 | |||
| 820 | Ga0105249_10097785 | |||
| 821 | Ga0105239_10003049 | |||
| 822 | Ga0105239_10045617 | |||
| 823 | Ga0105239_10165532 | |||
| 824 | Ga0105246_10025249 | |||
| 825 | Ga0105246_10235091 | |||
| 826 | Ga0157373_10284507 | |||
| 827 | Ga0157371_10027189 | |||
| 828 | Ga0157370_10000001 | |||
| 829 | Ga0157370_10037285 | |||
| 830 | Ga0157370_10397729 | |||
| 831 | Ga0157369_10000017 | |||
| 832 | Ga0157369_10004443 | |||
| 833 | Ga0157369_10016885 | |||
| 834 | Ga0157369_10022931 | |||
| 835 | Ga0157369_10044167 | |||
| 836 | Ga0157369_10046360 | |||
| 837 | Ga0157369_10048827 | |||
| 838 | Ga0157369_10117357 | |||
| 839 | Ga0157369_10129399 | |||
| 840 | Ga0157369_10173038 | |||
| 841 | Ga0157369_10214732 | |||
| 842 | Ga0157369_10284798 | |||
| 843 | Ga0157369_10295934 | |||
| 844 | Ga0157374_10004278 | |||
| 845 | Ga0157374_10071725 | |||
| 846 | Ga0157374_10180701 | |||
| 847 | Ga0157374_10370701 | |||
| 848 | Ga0157374_10404351 | |||
| 849 | Ga0157374_10495840 | |||
| 850 | Ga0157378_10003524 | |||
| 851 | Ga0157378_10145171 | |||
| 852 | Ga0157378_10283379 | |||
| 853 | Ga0163162_10014850 | |||
| 854 | Ga0163162_10405498 | |||
| 855 | Ga0157372_10000019 | |||
| 856 | Ga0157372_10000581 | |||
| 857 | Ga0157372_10005466 | |||
| 858 | Ga0157372_10009465 | |||
| 859 | Ga0157372_10034116 | |||
| 860 | Ga0157372_10062821 | |||
| 861 | Ga0157372_10142348 | |||
| 862 | Ga0157372_10556255 | |||
| 863 | Ga0157375_10006666 | |||
| 864 | Ga0157375_10399610 | |||
| 865 | Ga0157375_10469888 | |||
| 866 | Ga0163163_10001460 | |||
| 867 | Ga0163163_10028986 | |||
| 868 | Ga0163163_10111040 | |||
| 869 | Ga0157377_10294552 | |||
| 870 | Ga0157379_10000374 | |||
| 871 | Ga0157379_10293998 | |||
| 872 | Ga0157376_10018547 | |||
| 873 | Ga0157376_10044688 | |||
| 874 | Ga0157376_10391400 | |||
| 875 | Ga0163161_10025447 | |||
| 876 | Ga0207656_10018482 | |||
| 877 | Ga0207656_10113338 | |||
| 878 | Ga0207692_10335605 | |||
| 879 | Ga0207710_10118473 | |||
| 880 | Ga0207680_10340012 | |||
| 881 | Ga0207647_10014446 | |||
| 882 | Ga0207645_10101381 | |||
| 883 | Ga0207705_10058262 | |||
| 884 | Ga0207705_10092803 | |||
| 885 | Ga0207654_10000039 | |||
| 886 | Ga0207654_10000268 | |||
| 887 | Ga0207654_10021293 | |||
| 888 | Ga0207654_10059899 | |||
| 889 | Ga0207707_10004693 | |||
| 890 | Ga0207707_10211157 | |||
| 891 | Ga0207695_10000026 | |||
| 892 | Ga0207695_10000161 | |||
| 893 | Ga0207695_10000252 | |||
| 894 | Ga0207695_10001781 | |||
| 895 | Ga0207695_10002510 | |||
| 896 | Ga0207695_10008556 | |||
| 897 | Ga0207695_10048591 | |||
| 898 | Ga0207695_10071828 | |||
| 899 | Ga0207695_10116151 | |||
| 900 | Ga0207695_10159389 | |||
| 901 | Ga0207695_10189703 | |||
| 902 | Ga0207671_10000082 | |||
| 903 | Ga0207671_10000512 | |||
| 904 | Ga0207671_10273204 | |||
| 905 | Ga0207663_10000900 | |||
| 906 | Ga0207663_10003963 | |||
| 907 | Ga0207660_10007894 | |||
| 908 | Ga0207657_10010018 | |||
| 909 | Ga0207649_10145098 | |||
| 910 | Ga0207649_10347752 | |||
| 911 | Ga0207652_10013526 | |||
| 912 | Ga0207694_10000246 | |||
| 913 | Ga0207694_10001021 | |||
| 914 | Ga0207694_10001303 | |||
| 915 | Ga0207694_10045135 | |||
| 916 | Ga0207694_10059504 | |||
| 917 | Ga0207694_10067515 | |||
| 918 | Ga0207694_10325143 | |||
| 919 | Ga0207650_10025708 | |||
| 920 | Ga0207687_10005794 | |||
| 921 | Ga0207700_10004998 | |||
| 922 | Ga0207700_10061834 | |||
| 923 | Ga0207664_10178872 | |||
| 924 | Ga0207664_10505747 | |||
| 925 | Ga0207690_10542099 | |||
| 926 | Ga0207706_10003046 | |||
| 927 | Ga0207704_10160849 | |||
| 928 | Ga0207691_10100702 | |||
| 929 | Ga0207711_10001763 | |||
| 930 | Ga0207711_10043637 | |||
| 931 | Ga0207711_10093524 | |||
| 932 | Ga0207689_10001661 | |||
| 933 | Ga0207661_10000003 | |||
| 934 | Ga0207661_10000513 | |||
| 935 | Ga0207661_10207101 | |||
| 936 | Ga0207679_10069769 | |||
| 937 | Ga0207679_10557697 | |||
| 938 | Ga0207667_10000059 | |||
| 939 | Ga0207667_10002596 | |||
| 940 | Ga0207667_10023670 | |||
| 941 | Ga0207667_10078235 | |||
| 942 | Ga0207667_10181686 | |||
| 943 | Ga0207667_10193833 | |||
| 944 | Ga0207667_10253239 | |||
| 945 | Ga0207667_10376192 | |||
| 946 | Ga0207667_10398389 | |||
| 947 | Ga0207667_10433352 | |||
| 948 | Ga0207667_10448394 | |||
| 949 | Ga0207651_10537030 | |||
| 950 | Ga0207640_10054940 | |||
| 951 | Ga0207640_10151157 | |||
| 952 | Ga0207658_10032306 | |||
| 953 | Ga0207658_10402335 | |||
| 954 | Ga0207658_10496630 | |||
| 955 | Ga0207677_10001213 | |||
| 956 | Ga0207703_10181264 | |||
| 957 | Ga0207703_10717731 | |||
| 958 | Ga0207639_10000152 | |||
| 959 | Ga0207639_10066440 | |||
| 960 | Ga0207639_10333189 | |||
| 961 | Ga0207639_10555483 | |||
| 962 | Ga0207702_10006929 | |||
| 963 | Ga0207702_10018638 | |||
| 964 | Ga0207702_10300887 | |||
| 965 | Ga0207702_10386633 | |||
| 966 | Ga0207702_10548004 | |||
| 967 | Ga0207702_10589631 | |||
| 968 | Ga0207641_10012272 | |||
| 969 | Ga0207641_10116645 | |||
| 970 | Ga0207641_10253580 | |||
| 971 | Ga0207641_10510616 | |||
| 972 | Ga0207676_10156323 | |||
| 973 | Ga0207676_10360497 | |||
| 974 | Ga0207674_10002375 | |||
| 975 | Ga0207674_10012549 | |||
| 976 | Ga0207674_10109412 | |||
| 977 | Ga0207683_10023334 | |||
| 978 | Ga0207698_10000050 | |||
| 979 | Ga0207698_10002490 | |||
| 980 | Ga0207698_10012576 | |||
| 981 | Ga0207698_10041243 | |||
| 982 | Ga0207698_10404723 | |||
| 983 | Ga0207698_10538299 | |||
| 984 | Ga0268266_10118314 | |||
| 985 | Ga0268266_10133988 | |||
| 986 | Ga0268266_10158418 | |||
| 987 | Ga0268266_10872374 | |||
| 988 | Ga0268264_10050359 | |||
| 989 | Ga0265337_1000188 | |||
| 990 | Ga0265337_1000324 | |||
| 991 | Ga0265337_1002557 | |||
| 992 | Ga0265337_1006670 | |||
| 993 | Ga0265337_1011931 | |||
| 994 | Ga0265337_1027583 | |||
| 995 | Ga0265326_10044194 | |||
| 996 | Ga0265326_10064467 | |||
| 997 | Ga0265326_10070864 | |||
| 998 | Ga0265319_1012804 | |||
| 999 | Ga0265334_10001402 | |||
| 1000 | Ga0265334_10041293 | |||
| 1001 | Ga0265334_10119091 | |||
| 1002 | Ga0265318_10007337 | |||
| 1003 | Ga0265318_10008245 | |||
| 1004 | Ga0265323_10000084 | |||
| 1005 | Ga0265323_10000536 | |||
| 1006 | Ga0265323_10000688 | |||
| 1007 | Ga0265323_10003780 | |||
| 1008 | Ga0265323_10018891 | |||
| 1009 | Ga0265323_10022245 | |||
| 1010 | Ga0265323_10024054 | |||
| 1011 | Ga0265323_10025382 | |||
| 1012 | Ga0265323_10037987 | |||
| 1013 | Ga0265322_10028989 | |||
| 1014 | Ga0265336_10000240 | |||
| 1015 | Ga0265336_10002723 | |||
| 1016 | Ga0265336_10006394 | |||
| 1017 | Ga0265336_10010484 | |||
| 1018 | Ga0265338_10000237 | |||
| 1019 | Ga0265338_10000556 | |||
| 1020 | Ga0265338_10000789 | |||
| 1021 | Ga0265338_10000810 | |||
| 1022 | Ga0265338_10001431 | |||
| 1023 | Ga0265338_10004391 | |||
| 1024 | Ga0265338_10004396 | |||
| 1025 | Ga0265338_10004961 | |||
| 1026 | Ga0265338_10006143 | |||
| 1027 | Ga0265338_10008146 | |||
| 1028 | Ga0265338_10010139 | |||
| 1029 | Ga0265338_10010928 | |||
| 1030 | Ga0265338_10018070 | |||
| 1031 | Ga0265338_10023748 | |||
| 1032 | Ga0265338_10024129 | |||
| 1033 | Ga0265338_10026625 | |||
| 1034 | Ga0265338_10035847 | |||
| 1035 | Ga0265338_10058183 | |||
| 1036 | Ga0265338_10062938 | |||
| 1037 | Ga0265338_10101226 | |||
| 1038 | Ga0265338_10113204 | |||
| 1039 | Ga0265338_10144490 | |||
| 1040 | Ga0265338_10188873 | |||
| 1041 | Ga0265338_10346820 | |||
| 1042 | Ga0265324_10000475 | |||
| 1043 | Ga0265324_10000734 | |||
| 1044 | Ga0265324_10008241 | |||
| 1045 | Ga0265324_10063746 | |||
| 1046 | Ga0265324_10111901 | |||
| 1047 | Ga0265330_10000180 | |||
| 1048 | Ga0265330_10002956 | |||
| 1049 | Ga0265330_10005425 | |||
| 1050 | Ga0265330_10022078 | |||
| 1051 | Ga0265330_10038742 | |||
| 1052 | Ga0265330_10042738 | |||
| 1053 | Ga0265330_10044042 | |||
| 1054 | Ga0265330_10089065 | |||
| 1055 | Ga0265332_10023040 | |||
| 1056 | Ga0265332_10111877 | |||
| 1057 | Ga0265328_10009260 | |||
| 1058 | Ga0265328_10011808 | |||
| 1059 | Ga0265328_10032569 | |||
| 1060 | Ga0265328_10045590 | |||
| 1061 | Ga0265328_10074849 | |||
| 1062 | Ga0265320_10000188 | |||
| 1063 | Ga0265320_10000816 | |||
| 1064 | Ga0265320_10009797 | |||
| 1065 | Ga0265320_10042500 | |||
| 1066 | Ga0265320_10051024 | |||
| 1067 | Ga0265320_10148377 | |||
| 1068 | Ga0265320_10154666 | |||
| 1069 | Ga0265325_10000086 | |||
| 1070 | Ga0265325_10003105 | |||
| 1071 | Ga0265325_10011002 | |||
| 1072 | Ga0265325_10012548 | |||
| 1073 | Ga0265325_10028281 | |||
| 1074 | Ga0265325_10059284 | |||
| 1075 | Ga0265325_10077361 | |||
| 1076 | Ga0265325_10078477 | |||
| 1077 | Ga0265325_10101905 | |||
| 1078 | Ga0265329_10001542 | |||
| 1079 | Ga0265340_10004974 | |||
| 1080 | Ga0265340_10010689 | |||
| 1081 | Ga0265340_10012229 | |||
| 1082 | Ga0265340_10015868 | |||
| 1083 | Ga0265340_10041705 | |||
| 1084 | Ga0265340_10050942 | |||
| 1085 | Ga0265340_10068903 | |||
| 1086 | Ga0265340_10073130 | |||
| 1087 | Ga0265340_10092428 | |||
| 1088 | Ga0265339_10000003 | |||
| 1089 | Ga0265339_10000870 | |||
| 1090 | Ga0265339_10007801 | |||
| 1091 | Ga0265339_10012119 | |||
| 1092 | Ga0265339_10027013 | |||
| 1093 | Ga0265339_10028998 | |||
| 1094 | Ga0265339_10047867 | |||
| 1095 | Ga0265339_10068233 | |||
| 1096 | Ga0265339_10106817 | |||
| 1097 | Ga0265339_10165086 | |||
| 1098 | Ga0265331_10015387 | |||
| 1099 | Ga0265331_10034859 | |||
| 1100 | Ga0265331_10037776 | |||
| 1101 | Ga0265331_10104103 | |||
| 1102 | Ga0265327_10014147 | |||
| 1103 | Ga0265327_10020540 | |||
| 1104 | Ga0265327_10061992 | |||
| 1105 | Ga0265316_10003058 | |||
| 1106 | Ga0265316_10003587 | |||
| 1107 | Ga0265316_10004340 | |||
| 1108 | Ga0265316_10006710 | |||
| 1109 | Ga0265316_10012932 | |||
| 1110 | Ga0265316_10014044 | |||
| 1111 | Ga0265316_10018447 | |||
| 1112 | Ga0265316_10020951 | |||
| 1113 | Ga0265316_10023806 | |||
| 1114 | Ga0265316_10030079 | |||
| 1115 | Ga0265316_10030617 | |||
| 1116 | Ga0265316_10033205 | |||
| 1117 | Ga0265316_10055430 | |||
| 1118 | Ga0265316_10071883 | |||
| 1119 | Ga0265316_10076303 | |||
| 1120 | Ga0265316_10084284 | |||
| 1121 | Ga0265316_10093140 | |||
| 1122 | Ga0265316_10098617 | |||
| 1123 | Ga0265316_10108586 | |||
| 1124 | Ga0265316_10149681 | |||
| 1125 | Ga0265316_10185464 | |||
| 1126 | Ga0265316_10195811 | |||
| 1127 | Ga0265316_10288995 | |||
| 1128 | Ga0265313_10003145 | |||
| 1129 | Ga0265313_10006106 | |||
| 1130 | Ga0265313_10009943 | |||
| 1131 | Ga0265313_10012004 | |||
| 1132 | Ga0265313_10014760 | |||
| 1133 | Ga0265313_10022667 | |||
| 1134 | Ga0265313_10037336 | |||
| 1135 | Ga0316575_10000074 | |||
| 1136 | Ga0265314_10000047 | |||
| 1137 | Ga0265314_10000148 | |||
| 1138 | Ga0265314_10000509 | |||
| 1139 | Ga0265314_10001672 | |||
| 1140 | Ga0265314_10026386 | |||
| 1141 | Ga0265314_10040681 | |||
| 1142 | Ga0265314_10112883 | |||
| 1143 | Ga0265314_10216913 | |||
| 1144 | Ga0265314_10238984 | |||
| 1145 | Ga0265342_10000208 | |||
| 1146 | Ga0265342_10000451 | |||
| 1147 | Ga0265342_10003573 | |||
| 1148 | Ga0265342_10005582 | |||
| 1149 | Ga0265342_10006053 | |||
| 1150 | Ga0265342_10037262 | |||
| 1151 | Ga0265342_10045795 | |||
| 1152 | Ga0265342_10067191 | |||
| 1153 | Ga0265342_10071188 | |||
| 1154 | Ga0265342_10088660 | |||
| 1155 | Ga0265342_10110768 | |||
| 1156 | Ga0316576_10130968 | |||
| 1157 | Ga0316576_10132643 | |||
| 1158 | Ga0307416_100093022 | |||
| 1159 | Ga0373934_0011219 | |||
| 1160 | Ga0373934_0028820 | |||
| 1161 | Ga0373951_0007969 | |||
| 1162 | Ga0373936_0016469 | |||
| 1163 | Ga0373945_0019674 | |||
| 1164 | Ga0373953_0010066 | |||
| 1165 | Ga0373954_0025316 | |||
| 1166 | Ga0373954_0061639 | |||
| 1167 | Ga0373956_0062388 | |||
| 1168 | Ga0373956_0143864 | |||
| 1169 | Ga0373956_0239729 | |||
| 1170 | Ga0373943_0147917 | |||
| 1171 | Ga0373935_0037860 | |||
| 1172 | Ga0373927_0297629 | |||
| 1173 | Ga0373933_0062085 | |||
| 1174 | Ga0373947_0041759 | |||
| 1175 | Ga0373947_0366302 | |||
| 1176 | Ga0373937_0013533 | |||
| 1177 | Ga0373937_0155753 | |||
| 1178 | Ga0373937_0296849 | |||
| 1179 | Ga0373937_0667596 | |||
| 1180 | Ga0373925_0006624 | |||
| 1181 | Ga0373925_0448723 | |||
| 1182 | Ga0451577_0000063 | |||
| 1183 | Ga0451577_0001897 | |||
| 1184 | Ga0451577_0004611 | |||
| 1185 | Ga0451577_0009052 | |||
| 1186 | Ga0451577_0021043 | |||
| 1187 | Ga0451577_0025593 | |||
| 1188 | Ga0451577_0054561 | |||
| 1189 | Ga0451577_0060929 | |||
| 1190 | Ga0451577_0063111 | |||
| 1191 | Ga0451577_0091297 | |||
| 1192 | Ga0451577_0196676 | |||
| 1193 | Ga0451577_0201185 | |||
| 1194 | Ga0451577_0310086 | |||
| 1195 | Ga0451577_0328553 | |||
| 1196 | Ga0451577_0346855 | |||
| 1197 | Ga0451577_0354827 | |||
| 1198 | Ga0451577_0403618 | |||
| 1199 | Ga0451577_0435997 | |||
| 1200 | Ga0451577_0440833 | |||
| 1201 | Ga0451577_0537353 | |||
| 1202 | Ga0451577_0586208 | |||
| 1203 | Ga0451577_0668536 | |||
| 1204 | Ga0451577_0887828 | |||
| 1205 | Ga0451577_0890353 | |||
| 1206 | Ga0453683_0000114 | |||
| 1207 | Ga0453683_0000390 | |||
| 1208 | Ga0453683_0001084 | |||
| 1209 | Ga0453683_0196619 | |||
| 1210 | Ga0453683_0237104 | |||
| 1211 | Ga0453683_0285883 | |||
| 1212 | Ga0453683_0319890 | |||
| 1213 | Ga0453683_0523685 | |||
| 1214 | Ga0466961_0067036 | |||
| 1215 | Ga0466963_0020464 | |||
| 1216 | Ga0453684_0000198 | |||
| 1217 | Ga0453684_0000266 | |||
| 1218 | Ga0453684_0000417 | |||
| 1219 | Ga0453684_0000455 | |||
| 1220 | Ga0453684_0000725 | |||
| 1221 | Ga0453684_0001063 | |||
| 1222 | Ga0453684_0001817 | |||
| 1223 | Ga0453684_0002936 | |||
| 1224 | Ga0453684_0003575 | |||
| 1225 | Ga0453684_0007772 | |||
| 1226 | Ga0453684_0011217 | |||
| 1227 | Ga0453684_0011768 | |||
| 1228 | Ga0453684_0013310 | |||
| 1229 | Ga0453684_0016077 | |||
| 1230 | Ga0453684_0018573 | |||
| 1231 | Ga0453684_0022113 | |||
| 1232 | Ga0453684_0025700 | |||
| 1233 | Ga0453684_0030196 | |||
| 1234 | Ga0453684_0059446 | |||
| 1235 | Ga0453684_0110608 | |||
| 1236 | Ga0453684_0114896 | |||
| 1237 | Ga0453684_0166078 | |||
| 1238 | Ga0453684_0290292 | |||
| 1239 | Ga0453684_0298544 | |||
| 1240 | Ga0453684_0318226 | |||
| 1241 | Ga0453684_0370341 | |||
| 1242 | Ga0453684_0472854 | |||
| 1243 | Ga0453684_0585638 | |||
| 1244 | Ga0466957_0123211 | |||
| 1245 | Ga0451576_0000087 | |||
| 1246 | Ga0451576_0000151 | |||
| 1247 | Ga0451576_0001262 | |||
| 1248 | Ga0451576_0003642 | |||
| 1249 | Ga0451576_0073186 | |||
| 1250 | Ga0451576_0073276 | |||
| 1251 | Ga0451576_0099338 | |||
| 1252 | Ga0451576_0107790 | |||
| 1253 | Ga0451576_0262133 | |||
| 1254 | Ga0451576_0281139 | |||
| 1255 | Ga0451576_0313191 | |||
| 1256 | Ga0451576_0410296 | |||
| 1257 | Ga0451576_0459790 | |||
| 1258 | Ga0451576_0487861 | |||
| 1259 | Ga0451576_0683469 | |||
| 1260 | Ga0451576_0692848 | |||
| 1261 | Ga0466958_0060973 | |||
| 1262 | Ga0466967_0025698 | |||
| 1263 | Ga0466967_0411688 | |||
| 1264 | Ga0495629_0116578 | |||
| 1265 | Ga0495629_0194881 | |||
| 1266 | Ga0495651_0006747 | |||
| 1267 | Ga0495651_0051643 | |||
| 1268 | Ga0495651_0186831 | |||
| 1269 | Ga0495651_0366282 | |||
| 1270 | Ga0495580_0000624 | |||
| 1271 | Ga0495580_0011318 | |||
| 1272 | Ga0495580_0021108 | |||
| 1273 | Ga0495580_0075353 | |||
| 1274 | Ga0495580_0156013 | |||
| 1275 | Ga0495580_0343006 | |||
| 1276 | Ga0495580_0376003 | |||
| 1277 | Ga0495582_0007954 | |||
| 1278 | Ga0495582_0154353 | |||
| 1279 | Ga0495618_0083184 | |||
| 1280 | Ga0495628_0145083 | |||
| 1281 | Ga0495628_0246515 | |||
| 1282 | Ga0495630_0054947 | |||
| 1283 | Ga0495630_0125806 | |||
| 1284 | Ga0495630_0253070 | |||
| 1285 | Ga0495642_0188990 | |||
| 1286 | Ga0495652_0023598 | |||
| 1287 | Ga0495652_0262875 | |||
| 1288 | Ga0495665_0016275 | |||
| 1289 | Ga0495665_0106767 | |||
| 1290 | Ga0495640_0234070 | |||
| 1291 | Ga0495586_0003876 | |||
| 1292 | Ga0495587_0053392 | |||
| 1293 | Ga0495587_0205205 | |||
| 1294 | Ga0495645_0050462 | |||
| 1295 | Ga0495645_0090050 | |||
| 1296 | Ga0495645_0183812 | |||
| 1297 | Ga0495667_0016297 | |||
| 1298 | Ga0495667_0017693 | |||
| 1299 | Ga0495634_0035927 | |||
| 1300 | Ga0495657_0076654 | |||
| 1301 | Ga0495657_0322963 | |||
| 1302 | Ga0495623_0147305 | |||
| 1303 | Ga0495647_0183277 | |||
| 1304 | Ga0495669_0053409 | |||
| 1305 | Ga0495669_0104850 | |||
| 1306 | Ga0495613_0025877 | |||
| 1307 | Ga0495613_0065729 | |||
| 1308 | Ga0495613_0211805 | |||
| 1309 | Ga0495600_0134536 | |||
| 1310 | Ga0495581_0085102 | |||
| 1311 | Ga0495581_0160006 | |||
| 1312 | Ga0495604_0319311 | |||
| 1313 | Ga0495674_0035796 | |||
| 1314 | Ga0495674_0066071 | |||
| 1315 | Ga0495674_0275718 | |||
| 1316 | Ga0495674_0286892 | |||
| 1317 | Ga0495674_0627400 | |||
| 1318 | Ga0495680_0023240 | |||
| 1319 | Ga0495675_0010946 | |||
| 1320 | Ga0495675_0138329 | |||
| 1321 | Ga0495675_0360224 | |||
| 1322 | Ga0495684_0165504 | |||
| 1323 | Ga0495602_0046772 | |||
| 1324 | Ga0495602_0078419 | |||
| 1325 | Ga0495602_0107464 | |||
| 1326 | Ga0495602_0125706 | |||
| 1327 | Ga0495602_0146540 | |||
| 1328 | Ga0495614_0173953 | |||
| 1329 | Ga0496100_0028985 | |||
| 1330 | Ga0496104_0172187 | |||
| 1331 | Ga0496104_0272315 | |||
| 1332 | Ga0496104_0441407 | |||
| 1333 | Ga0496105_0045159 | |||
| 1334 | Ga0496105_0267989 | |||
| 1335 | Ga0496107_0054612 | |||
| 1336 | Ga0496108_0093259 | |||
| 1337 | Ga0496108_0202009 | |||
| 1338 | Ga0496109_0804792 | |||
| 1339 | Ga0496113_0454009 | |||
| 1340 | Ga0496114_0735236 | |||
| 1341 | Ga0496115_0034397 | |||
| 1342 | Ga0496115_0103056 | |||
| 1343 | Ga0496115_0110819 | |||
| 1344 | Ga0496115_0209876 | |||
| 1345 | Ga0496115_0243301 | |||
| 1346 | Ga0496115_0324386 | |||
| 1347 | Ga0496115_0419938 | |||
| 1348 | Ga0496115_0477501 | |||
| 1349 | Ga0501031_0220501 | |||
| 1350 | Ga0501076_0410362 | |||
| 1351 | Ga0495601_0020011 | |||
| 1352 | Ga0495619_0181031 | |||
| 1353 | Ga0501082_0000989 | |||
| 1354 | Ga0501082_0017125 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1bf4-assembly1.cif.gz_A | chromosomal dna-binding protein sso7d/d(gcgaacgc) complex | 0.8134 | 157 | 184 |
| 1c8c-assembly1.cif.gz_A | crystal structures of the chromosomal proteins sso7d/sac7d bound to dna containing t-g mismatched base pairs | 0.8102 | 157 | 184 |
| 1h9m-assembly1.cif.gz_A | two crystal structures of the cytoplasmic molybdate-binding protein modg suggest a novel cooperative binding mechanism and provide insights into ligand-binding specificity. peg-grown form with molybdate bound | 0.7906 | 157 | 185 |
| 1gus-assembly1.cif.gz_B | mopii from clostridium pasteurianum (apo1) | 0.7899 | 157 | 185 |
| 1t9g-assembly1.cif.gz_S | structure of the human mcad:etf complex | 0.764 | 5 | 241 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q99698_3481_3690_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.8437 | 158 | 185 | 2.130.10.10 |
| 1gunB00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8363 | 157 | 185 | 2.40.50.100 |
| af_Q6IGM3_136_223_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8133 | 157 | 184 | 2.40.50.140 |
| 1h9sA01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8043 | 158 | 185 | 2.40.50.100 |
| af_Q92673_86_292_2.115.10.20 | Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 | 0.7955 | 157 | 182 | 2.115.10.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C5CYM7-F1-model_v4 | Electron transfer flavoprotein subunit beta | 0.9664 | 1 | 231 |
|
| AF-A0A7Y5LFG5-F1-model_v4 | Electron transfer flavoprotein subunit beta | 0.9602 | 4 | 185 |
|
| AF-A0A7Y5LFG5-F1-model_v4 | Electron transfer flavoprotein subunit beta | 0.945 | 4 | 185 |
|
| AF-A0A7C5CYM7-F1-model_v4 | Electron transfer flavoprotein subunit beta | 0.9425 | 1 | 231 |
|
| AF-A0A0S8G056-F1-model_v4 | Electron transfer flavoprotein subunit beta | 0.9372 | 4 | 104 |
|