F474387

General Info

Members Datasets Scaffolds Average Seq Length
674 224 633 237

Family's Representative Sequence

Representative Sequence 3300046492|Ga0495585_0002305|Ga0495585_0002305_5085_5867
Length 260
Sequence MPEVFNEAQSQNARAWSDAELTSAVQAYLGMLYAELAGKTYSKSEVNRQLRNGPLAGRTKGSIEFRMQNISAALYELRMPRIAGYLPARNVGSTVMDKLIELLRLCNIDELSAYVPTADRDSLAEKVSSLRRQHLGRIPNGTTHPQVVTSTTTAYVRDPAVKAWILKAANGMCEGCDRPAPFDGKDGLPYLEIHHIMPLSSHGSDTTTNAAALCPNCHRRCHFSLDRDEFKLALYQKIRRLILEVPEPPQSCTDEFVVIE

Samples

Sample ID Description Type Environment
1 2511231007 Pseudomonas sp. GM18 Isolate Nodule
2 2511231008 Pseudomonas sp. GM21 Isolate Nodule
3 2511231010 Pseudomonas sp. GM25 Isolate Nodule
4 2511231022 Pseudomonas sp. GM79 Isolate Nodule
5 2511231023 Pseudomonas sp. GM80 Isolate Nodule
6 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
7 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
8 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
9 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
10 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
11 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
12 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified
13 2773857670 Pseudomonas sp. 478 Isolate Unclassified
14 2784132063 Pseudomonas sp. 424 Isolate Unclassified
15 2784132072 Pseudomonas sp. 460 Isolate Unclassified
16 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
17 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
18 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
19 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
20 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
21 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
22 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
23 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
24 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
25 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
26 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
27 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
28 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
29 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
30 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
31 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
32 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
33 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
34 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
35 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
36 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
37 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
38 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
39 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
40 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
41 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
42 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
43 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
44 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
45 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
46 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
47 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
48 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
49 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
50 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
51 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
59 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
60 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
61 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
73 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
74 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
78 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
79 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
100 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
107 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
108 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
109 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
110 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
111 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
112 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
113 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
114 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
115 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
116 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
117 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
118 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
119 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
120 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
121 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
122 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
123 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
124 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
125 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
129 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
130 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
131 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
132 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
133 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
134 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
135 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
136 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
137 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
138 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
139 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
140 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
141 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
142 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
146 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
147 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
148 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
149 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
150 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
151 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
152 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
155 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
158 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
159 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
160 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
161 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
162 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
166 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
167 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
168 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
169 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
170 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
173 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
174 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
175 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
176 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
177 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
178 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
179 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
182 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
183 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
184 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
185 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
188 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
189 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
190 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
194 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
200 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
201 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
202 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
203 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
204 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
205 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
206 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
209 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
210 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
211 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
212 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
213 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
214 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
215 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
216 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
217 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
218 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
219 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
220 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
221 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
222 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
223 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
224 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.92
Metatranscriptomes 0
Isolates 6.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.08
Nodule 1.04
Rhizoplane 0.74
Rhizosphere 84.87
Stem 0
Stem Tuber 0
Unclassified 7.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000180 3300002773 Bacteria 42411
2 JGI25150J39212_1000148 3300002774 Bacteria 39765
3 JGI25153J46596_10007904 3300003215 Bacteria 5160
4 Ga0055526_1001548 3300003771 Bacteria 16268
5 Ga0055526_1013740 3300003771 Bacteria 3397
6 Ga0055537_1001549 3300003773 Bacteria 8783
7 Ga0055537_1010881 3300003773 Bacteria 1885
8 Ga0055524_1000671 3300003775 Bacteria 23984
9 Ga0055524_1035951 3300003775 Bacteria 1341
10 Ga0055536_1000348 3300003781 Bacteria 34272
11 Ga0055536_1000435 3300003781 Bacteria 29521
12 Ga0055528_1026615 3300003790 Bacteria 1654
13 Ga0055530_10001667 3300003791 Bacteria 15798
14 Ga0055530_10002671 3300003791 Bacteria 11129
15 Ga0055540_1000188 3300003792 Bacteria 59841
16 Ga0055531_10000157 3300003794 Bacteria 78209
17 Ga0065714_10003511 3300005288 Bacteria 6910
18 Ga0065714_10006535 3300005288 Bacteria 6339
19 Ga0065714_10078850 3300005288 Bacteria 2559
20 Ga0065714_10098822 3300005288 Bacteria 1698
21 Ga0065712_10011240 3300005290 Bacteria 1863
22 Ga0065715_10326632 3300005293 Bacteria 992
23 Ga0070665_100038777 3300005548 Bacteria 4789
24 Ga0070665_100302495 3300005548 Bacteria 1602
25 Ga0070665_100507333 3300005548 Bacteria 1217
26 Ga0070664_100309425 3300005564 Bacteria 1429
27 Ga0068851_10000011 3300005834 Bacteria 178585
28 Ga0075432_10002100 3300006058 Bacteria 6638
29 Ga0075432_10008938 3300006058 Bacteria 3416
30 Ga0075432_10022282 3300006058 Bacteria 2166
31 Ga0075432_10025828 3300006058 Bacteria 2015
32 Ga0075432_10039532 3300006058 Bacteria 1645
33 Ga0075432_10060510 3300006058 Bacteria 1347
34 Ga0075362_10098976 3300006177 Bacteria 1362
35 Ga0075436_100159833 3300006914 Bacteria 1588
36 Ga0075436_100576510 3300006914 Bacteria 827
37 Ga0079104_1040767 3300006946 Bacteria 1085
38 Ga0105251_10002904 3300009011 Bacteria 12876
39 Ga0105251_10018179 3300009011 Bacteria 3745
40 Ga0105251_10031428 3300009011 Bacteria 2657
41 Ga0105251_10062220 3300009011 Bacteria 1753
42 Ga0105244_10009890 3300009036 Bacteria 5820
43 Ga0105244_10019832 3300009036 Bacteria 3743
44 Ga0105244_10039662 3300009036 Bacteria 2450
45 Ga0105244_10040624 3300009036 Bacteria 2414
46 Ga0105244_10054379 3300009036 Bacteria 2031
47 Ga0105250_10000286 3300009092 Bacteria 40630
48 Ga0105250_10007741 3300009092 Bacteria 4604
49 Ga0105250_10021868 3300009092 Bacteria 2581
50 Ga0105250_10101526 3300009092 Bacteria 1174
51 Ga0105243_10000255 3300009148 Bacteria 61305
52 Ga0105246_10004752 3300011119 Bacteria 8272
53 Ga0105246_10060622 3300011119 Bacteria 2629
54 Ga0157373_10011890 3300013100 Bacteria 6394
55 Ga0157373_10059166 3300013100 Bacteria 2715
56 Ga0157373_10075366 3300013100 Bacteria 2380
57 Ga0157373_10101855 3300013100 Bacteria 2020
58 Ga0157373_10367773 3300013100 Bacteria 1027
59 Ga0157371_10001164 3300013102 Bacteria 28242
60 Ga0157371_10070833 3300013102 Bacteria 2468
61 Ga0157371_10137837 3300013102 Bacteria 1738
62 Ga0157371_10187887 3300013102 Bacteria 1479
63 Ga0157370_10033591 3300013104 Bacteria 5002
64 Ga0157370_10049873 3300013104 Bacteria 4003
65 Ga0157370_10108155 3300013104 Bacteria 2600
66 Ga0157370_10342593 3300013104 Bacteria 1378
67 Ga0157370_10388876 3300013104 Bacteria 1284
68 Ga0157370_10427568 3300013104 Bacteria 1218
69 Ga0157369_10039158 3300013105 Bacteria 5181
70 Ga0157369_10091190 3300013105 Bacteria 3253
71 Ga0157369_10162887 3300013105 Bacteria 2353
72 Ga0163162_10427564 3300013306 Bacteria 1456
73 Ga0163162_10545686 3300013306 Bacteria 1288
74 Ga0157372_10003380 3300013307 Bacteria 17218
75 Ga0157375_10049874 3300013308 Bacteria 4104
76 Ga0157375_10181456 3300013308 Bacteria 2256
77 Ga0182008_10000781 3300014497 Bacteria 22273
78 Ga0182008_10013732 3300014497 Bacteria 4255
79 Ga0182008_10049295 3300014497 Bacteria 2090
80 Ga0182008_10058774 3300014497 Bacteria 1897
81 Ga0182008_10129824 3300014497 Bacteria 1256
82 Ga0182006_1002434 3300015261 Bacteria 10171
83 Ga0182006_1003371 3300015261 Bacteria 8208
84 Ga0182006_1016534 3300015261 Bacteria 3146
85 Ga0182006_1055434 3300015261 Bacteria 1513
86 Ga0182007_10006082 3300015262 Bacteria 5219
87 Ga0182007_10023580 3300015262 Bacteria 2163
88 Ga0182007_10040098 3300015262 Bacteria 1564
89 Ga0182005_1001037 3300015265 Bacteria 11760
90 Ga0182005_1002856 3300015265 Bacteria 6009
91 Ga0182005_1003751 3300015265 Bacteria 5059
92 Ga0182005_1004635 3300015265 Bacteria 4403
93 Ga0182005_1021906 3300015265 Bacteria 1751
94 Ga0163161_10016048 3300017792 Bacteria 5228
95 Ga0163161_10022368 3300017792 Bacteria 4452
96 Ga0163161_10028232 3300017792 Bacteria 3983
97 Ga0163161_10072868 3300017792 Bacteria 2516
98 Ga0163161_10653394 3300017792 Bacteria 871
99 Ga0209563_100275 3300025230 Bacteria 21699
100 Ga0207425_1000241 3300025245 Bacteria 42565
101 Ga0209129_1000320 3300025258 Bacteria 42469
102 Ga0209565_1001752 3300025263 Bacteria 8850
103 Ga0209565_1002147 3300025263 Bacteria 7436
104 Ga0209673_1010911 3300025273 Bacteria 3792
105 Ga0209675_1003137 3300025291 Bacteria 8043
106 Ga0209676_1000010 3300025292 Bacteria 954025
107 Ga0209676_1000109 3300025292 Bacteria 217531
108 Ga0209564_1002250 3300025295 Bacteria 15831
109 Ga0209564_1012869 3300025295 Bacteria 3605
110 Ga0209758_1000848 3300025297 Bacteria 42565
111 Ga0209050_1000019 3300025298 Bacteria 608757
112 Ga0209050_1001237 3300025298 Bacteria 29567
113 Ga0209050_1034073 3300025298 Bacteria 1531
114 Ga0209256_1001155 3300025299 Bacteria 29900
115 Ga0209051_1000146 3300025303 Bacteria 134294
116 Ga0209257_1000040 3300025304 Bacteria 538759
117 Ga0207656_10000013 3300025321 Bacteria 160490
118 Ga0207696_1000157 3300025711 Bacteria 112332
119 Ga0207696_1002272 3300025711 Bacteria 9550
120 Ga0207696_1015503 3300025711 Bacteria 2582
121 Ga0207696_1048722 3300025711 Bacteria 1217
122 Ga0207655_1001107 3300025728 Bacteria 26315
123 Ga0207655_1010456 3300025728 Bacteria 5624
124 Ga0207655_1014315 3300025728 Bacteria 4491
125 Ga0207655_1018853 3300025728 Bacteria 3637
126 Ga0207655_1019429 3300025728 Bacteria 3550
127 Ga0207655_1020207 3300025728 Bacteria 3434
128 Ga0207655_1037824 3300025728 Bacteria 2119
129 Ga0207713_1000625 3300025735 Bacteria 34713
130 Ga0207713_1007555 3300025735 Bacteria 6387
131 Ga0207713_1009736 3300025735 Bacteria 5385
132 Ga0207713_1010944 3300025735 Bacteria 4980
133 Ga0207713_1014042 3300025735 Bacteria 4184
134 Ga0207713_1016362 3300025735 Bacteria 3766
135 Ga0207713_1019349 3300025735 Bacteria 3333
136 Ga0207713_1026426 3300025735 Bacteria 2660
137 Ga0207713_1046063 3300025735 Bacteria 1776
138 Ga0207649_10000623 3300025920 Bacteria 23839
139 Ga0207709_10000013 3300025935 Bacteria 531977
140 Ga0207679_10000609 3300025945 Bacteria 23839
141 Ga0209281_1008032 3300027111 Bacteria 2594
142 Ga0207428_10032615 3300027907 Bacteria 4282
143 Ga0207428_10046875 3300027907 Bacteria 3473
144 Ga0207428_10083804 3300027907 Bacteria 2485
145 Ga0207428_10085051 3300027907 Bacteria 2464
146 Ga0207428_10217206 3300027907 Bacteria 1434
147 Ga0268266_10052804 3300028379 Bacteria 3491
148 Ga0268266_10084025 3300028379 Bacteria 2779
149 Ga0316177_1184941 3300030731 Unclassified 1050
150 Ga0316178_1100242 3300030735 Bacteria 26958
151 Ga0307408_100000289 3300031548 Bacteria 49603
152 Ga0307408_100015451 3300031548 Bacteria 5081
153 Ga0307408_100029903 3300031548 Bacteria 3778
154 Ga0307408_100084856 3300031548 Bacteria 2376
155 Ga0307408_100197308 3300031548 Bacteria 1626
156 Ga0307405_10000131 3300031731 Bacteria 29755
157 Ga0307412_10122626 3300031911 Bacteria 1874
158 Ga0307412_10200947 3300031911 Bacteria 1513
159 Ga0307414_10490275 3300032004 Bacteria 1085
160 Ga0307414_10580574 3300032004 Bacteria 1003
161 Ga0307411_10349882 3300032005 Bacteria 1204
162 Ga0307510_10019620 3300033180 Bacteria 7923
163 Ga0439438_005529 3300041405 Bacteria 4629
164 Ga0439438_005893 3300041405 Bacteria 4432
165 Ga0439438_007350 3300041405 Bacteria 3772
166 Ga0439438_013187 3300041405 Bacteria 2503
167 Ga0439438_019722 3300041405 Bacteria 1902
168 Ga0439438_020393 3300041405 Bacteria 1860
169 Ga0439438_033473 3300041405 Bacteria 1357
170 Ga0439438_041270 3300041405 Bacteria 1197
171 Ga0439438_063351 3300041405 Bacteria 923
172 Ga0439447_003377 3300041407 Bacteria 5676
173 Ga0439447_003776 3300041407 Bacteria 5320
174 Ga0439447_004640 3300041407 Bacteria 4683
175 Ga0439447_010164 3300041407 Bacteria 2805
176 Ga0439447_015585 3300041407 Bacteria 2107
177 Ga0439447_017532 3300041407 Bacteria 1948
178 Ga0439447_021466 3300041407 Bacteria 1700
179 Ga0439466_0004537 3300041411 Bacteria 5332
180 Ga0439466_0005101 3300041411 Bacteria 5035
181 Ga0439466_0005835 3300041411 Bacteria 4690
182 Ga0439466_0007441 3300041411 Bacteria 4147
183 Ga0439466_0009539 3300041411 Bacteria 3626
184 Ga0439466_0022096 3300041411 Bacteria 2248
185 Ga0439466_0022975 3300041411 Bacteria 2196
186 Ga0439466_0033947 3300041411 Bacteria 1731
187 Ga0439466_0046276 3300041411 Bacteria 1437
188 Ga0439466_0058846 3300041411 Bacteria 1242
189 Ga0439432_002539 3300042006 Bacteria 6876
190 Ga0439432_003991 3300042006 Bacteria 5422
191 Ga0439432_006466 3300042006 Bacteria 4183
192 Ga0439432_013607 3300042006 Bacteria 2765
193 Ga0439432_052610 3300042006 Bacteria 1267
194 Ga0439451_000830 3300042009 Bacteria 5911
195 Ga0439451_018700 3300042009 Bacteria 1398
196 Ga0439452_000495 3300042010 Bacteria 21617
197 Ga0439452_000504 3300042010 Bacteria 21239
198 Ga0439452_001408 3300042010 Bacteria 9898
199 Ga0439452_003406 3300042010 Bacteria 5570
200 Ga0439452_004084 3300042010 Bacteria 4963
201 Ga0439452_022975 3300042010 Bacteria 1609
202 Ga0439456_001413 3300042013 Bacteria 4821
203 Ga0439456_004053 3300042013 Bacteria 2973
204 Ga0439456_008691 3300042013 Bacteria 2097
205 Ga0439456_024852 3300042013 Bacteria 1271
206 Ga0450911_000122 3300042115 Bacteria 30706
207 Ga0450911_002271 3300042115 Bacteria 3859
208 Ga0450911_011596 3300042115 Bacteria 1203
209 Ga0450903_006259 3300042138 Bacteria 1982
210 Ga0450904_000161 3300042139 Bacteria 14716
211 Ga0450907_002127 3300042146 Bacteria 3900
212 Ga0439460_0002811 3300042461 Bacteria 4191
213 Ga0450893_0002194 3300042532 Bacteria 3041
214 Ga0439440_0001069 3300042993 Bacteria 4884
215 Ga0495617_000566 3300046452 Bacteria 18974
216 Ga0495617_002006 3300046452 Bacteria 8470
217 Ga0495617_005408 3300046452 Bacteria 4530
218 Ga0495617_006243 3300046452 Bacteria 4189
219 Ga0495617_029733 3300046452 Bacteria 1837
220 Ga0495627_002616 3300046453 Bacteria 8481
221 Ga0495627_008705 3300046453 Bacteria 3784
222 Ga0495603_0039258 3300046455 Bacteria 2837
223 Ga0495603_0098249 3300046455 Bacteria 1710
224 Ga0495590_0003583 3300046457 Bacteria 6322
225 Ga0495590_0007371 3300046457 Bacteria 4246
226 Ga0495590_0050899 3300046457 Bacteria 1446
227 Ga0495590_0124271 3300046457 Bacteria 925
228 Ga0495591_001183 3300046458 Bacteria 17067
229 Ga0495591_008324 3300046458 Bacteria 4267
230 Ga0495591_017990 3300046458 Bacteria 2408
231 Ga0495591_023575 3300046458 Bacteria 1968
232 Ga0495591_028030 3300046458 Bacteria 1727
233 Ga0495591_044700 3300046458 Bacteria 1239
234 Ga0495591_059281 3300046458 Bacteria 1021
235 Ga0495629_0079496 3300046459 Bacteria 2290
236 Ga0495638_0004842 3300046460 Bacteria 10141
237 Ga0495638_0006469 3300046460 Bacteria 8521
238 Ga0495638_0006872 3300046460 Bacteria 8213
239 Ga0495638_0013273 3300046460 Bacteria 5617
240 Ga0495638_0034508 3300046460 Bacteria 3230
241 Ga0495638_0037175 3300046460 Bacteria 3098
242 Ga0495638_0047148 3300046460 Bacteria 2703
243 Ga0495638_0067731 3300046460 Bacteria 2191
244 Ga0495638_0072490 3300046460 Bacteria 2104
245 Ga0495638_0084095 3300046460 Bacteria 1926
246 Ga0495653_0002536 3300046463 Bacteria 14549
247 Ga0495653_0016789 3300046463 Bacteria 5956
248 Ga0495653_0033081 3300046463 Bacteria 4098
249 Ga0495653_0072646 3300046463 Bacteria 2568
250 Ga0495653_0078833 3300046463 Bacteria 2441
251 Ga0495653_0143230 3300046463 Bacteria 1678
252 Ga0495650_0004828 3300046471 Bacteria 9025
253 Ga0495650_0007807 3300046471 Bacteria 6362
254 Ga0495650_0014957 3300046471 Bacteria 4004
255 Ga0495650_0016172 3300046471 Bacteria 3790
256 Ga0495650_0017490 3300046471 Bacteria 3593
257 Ga0495650_0021406 3300046471 Bacteria 3126
258 Ga0495650_0048382 3300046471 Bacteria 1772
259 Ga0495605_0001541 3300046474 Bacteria 14964
260 Ga0495605_0001814 3300046474 Bacteria 13675
261 Ga0495605_0002155 3300046474 Bacteria 12305
262 Ga0495605_0003915 3300046474 Bacteria 8810
263 Ga0495605_0011699 3300046474 Bacteria 4883
264 Ga0495605_0018281 3300046474 Bacteria 3760
265 Ga0495605_0113214 3300046474 Bacteria 1236
266 Ga0495639_0150216 3300046475 Bacteria 1123
267 Ga0495664_0260168 3300046477 Bacteria 1049
268 Ga0495584_0002384 3300046491 Bacteria 10673
269 Ga0495584_0005917 3300046491 Bacteria 6443
270 Ga0495584_0037266 3300046491 Bacteria 2457
271 Ga0495584_0043427 3300046491 Bacteria 2268
272 Ga0495584_0044119 3300046491 Bacteria 2250
273 Ga0495584_0055602 3300046491 Bacteria 1991
274 Ga0495584_0066115 3300046491 Bacteria 1818
275 Ga0495585_0002305 3300046492 Bacteria 13751
276 Ga0495585_0009492 3300046492 Bacteria 5832
277 Ga0495585_0023912 3300046492 Bacteria 3505
278 Ga0495585_0051468 3300046492 Bacteria 2282
279 Ga0495585_0053015 3300046492 Bacteria 2245
280 Ga0495585_0077560 3300046492 Bacteria 1803
281 Ga0495585_0095317 3300046492 Bacteria 1598
282 Ga0495585_0293849 3300046492 Bacteria 800
283 Ga0495594_0031126 3300046499 Bacteria 2891
284 Ga0495596_0021798 3300046500 Bacteria 2611
285 Ga0495596_0035185 3300046500 Bacteria 1987
286 Ga0495607_0000570 3300046501 Bacteria 35986
287 Ga0495607_0005380 3300046501 Bacteria 9185
288 Ga0495607_0005445 3300046501 Bacteria 9110
289 Ga0495607_0011512 3300046501 Bacteria 5886
290 Ga0495607_0015319 3300046501 Bacteria 4972
291 Ga0495607_0031497 3300046501 Bacteria 3246
292 Ga0495607_0041070 3300046501 Bacteria 2749
293 Ga0495607_0048010 3300046501 Bacteria 2497
294 Ga0495607_0049188 3300046501 Bacteria 2460
295 Ga0495607_0057407 3300046501 Bacteria 2230
296 Ga0495607_0095202 3300046501 Bacteria 1605
297 Ga0495607_0122747 3300046501 Bacteria 1361
298 Ga0495607_0190715 3300046501 Bacteria 1021
299 Ga0495607_0232900 3300046501 Bacteria 895
300 Ga0495583_0002221 3300046506 Bacteria 17174
301 Ga0495583_0150435 3300046506 Bacteria 965
302 Ga0495606_0000678 3300046507 Bacteria 53260
303 Ga0495606_0002819 3300046507 Bacteria 19311
304 Ga0495606_0043183 3300046507 Bacteria 3008
305 Ga0495606_0044942 3300046507 Bacteria 2932
306 Ga0495606_0057591 3300046507 Bacteria 2502
307 Ga0495606_0178655 3300046507 Bacteria 1225
308 Ga0495610_0000721 3300046512 Bacteria 31432
309 Ga0495610_0001166 3300046512 Bacteria 23910
310 Ga0495610_0003912 3300046512 Bacteria 11296
311 Ga0495610_0004842 3300046512 Bacteria 9803
312 Ga0495610_0005463 3300046512 Bacteria 9025
313 Ga0495610_0031514 3300046512 Bacteria 2765
314 Ga0495616_0000181 3300046513 Bacteria 53529
315 Ga0495616_0001311 3300046513 Bacteria 17383
316 Ga0495616_0014246 3300046513 Bacteria 4459
317 Ga0495616_0026565 3300046513 Bacteria 3079
318 Ga0495616_0049488 3300046513 Bacteria 2106
319 Ga0495616_0050076 3300046513 Bacteria 2090
320 Ga0495616_0083560 3300046513 Bacteria 1523
321 Ga0495616_0108107 3300046513 Bacteria 1295
322 Ga0495616_0123626 3300046513 Bacteria 1192
323 Ga0495620_0010200 3300046515 Bacteria 4962
324 Ga0495620_0020739 3300046515 Bacteria 3204
325 Ga0495620_0034870 3300046515 Bacteria 2269
326 Ga0495620_0042779 3300046515 Bacteria 1976
327 Ga0495628_0086103 3300046516 Bacteria 2437
328 Ga0495628_0086182 3300046516 Bacteria 2436
329 Ga0495630_0005873 3300046517 Bacteria 8683
330 Ga0495630_0031307 3300046517 Bacteria 3961
331 Ga0495630_0035187 3300046517 Bacteria 3742
332 Ga0495630_0125370 3300046517 Bacteria 1949
333 Ga0495631_0001499 3300046518 Bacteria 14077
334 Ga0495631_0101950 3300046518 Bacteria 1235
335 Ga0495632_0006101 3300046519 Bacteria 7811
336 Ga0495632_0011513 3300046519 Bacteria 5157
337 Ga0495632_0012076 3300046519 Bacteria 4997
338 Ga0495632_0023814 3300046519 Bacteria 3263
339 Ga0495632_0036089 3300046519 Bacteria 2516
340 Ga0495632_0073644 3300046519 Bacteria 1637
341 Ga0495632_0187926 3300046519 Bacteria 944
342 Ga0495632_0318612 3300046519 Bacteria 687
343 Ga0495637_0000419 3300046520 Bacteria 31122
344 Ga0495637_0004488 3300046520 Bacteria 7219
345 Ga0495637_0004534 3300046520 Bacteria 7188
346 Ga0495637_0019033 3300046520 Bacteria 3179
347 Ga0495637_0019808 3300046520 Bacteria 3105
348 Ga0495637_0035721 3300046520 Bacteria 2168
349 Ga0495637_0056605 3300046520 Bacteria 1622
350 Ga0495637_0186176 3300046520 Bacteria 768
351 Ga0495643_0053946 3300046522 Bacteria 2154
352 Ga0495643_0055649 3300046522 Bacteria 2114
353 Ga0495643_0056532 3300046522 Bacteria 2094
354 Ga0495644_0010741 3300046523 Bacteria 3529
355 Ga0495644_0056591 3300046523 Bacteria 1473
356 Ga0495648_0000587 3300046524 Bacteria 38941
357 Ga0495648_0008381 3300046524 Bacteria 8142
358 Ga0495648_0010649 3300046524 Bacteria 6987
359 Ga0495648_0024316 3300046524 Bacteria 4128
360 Ga0495648_0027413 3300046524 Bacteria 3813
361 Ga0495648_0047001 3300046524 Bacteria 2671
362 Ga0495648_0064450 3300046524 Bacteria 2158
363 Ga0495648_0073498 3300046524 Bacteria 1973
364 Ga0495648_0101298 3300046524 Bacteria 1589
365 Ga0495648_0101445 3300046524 Bacteria 1587
366 Ga0495648_0107240 3300046524 Bacteria 1527
367 Ga0495666_0000676 3300046526 Bacteria 15445
368 Ga0495666_0006179 3300046526 Bacteria 6026
369 Ga0495666_0010885 3300046526 Bacteria 4535
370 Ga0495666_0051975 3300046526 Bacteria 1967
371 Ga0495666_0113134 3300046526 Bacteria 1274
372 Ga0495666_0140421 3300046526 Unclassified 1126
373 Ga0495654_0000980 3300046530 Bacteria 20998
374 Ga0495654_0000981 3300046530 Bacteria 20982
375 Ga0495654_0001548 3300046530 Bacteria 15606
376 Ga0495654_0003248 3300046530 Bacteria 10030
377 Ga0495654_0005643 3300046530 Bacteria 7236
378 Ga0495654_0010833 3300046530 Bacteria 4951
379 Ga0495654_0013421 3300046530 Bacteria 4385
380 Ga0495654_0024445 3300046530 Bacteria 3120
381 Ga0495654_0038342 3300046530 Bacteria 2397
382 Ga0495654_0052316 3300046530 Bacteria 1989
383 Ga0495654_0088886 3300046530 Bacteria 1436
384 Ga0495654_0096075 3300046530 Bacteria 1369
385 Ga0495654_0103075 3300046530 Bacteria 1311
386 Ga0495654_0161292 3300046530 Bacteria 984
387 Ga0495654_0189589 3300046530 Bacteria 886
388 Ga0495587_0012314 3300046536 Bacteria 5390
389 Ga0495587_0018414 3300046536 Bacteria 4330
390 Ga0495609_0000121 3300046538 Bacteria 88036
391 Ga0495609_0001802 3300046538 Bacteria 13761
392 Ga0495609_0005328 3300046538 Bacteria 6794
393 Ga0495609_0011795 3300046538 Bacteria 4154
394 Ga0495609_0014035 3300046538 Bacteria 3772
395 Ga0495609_0016436 3300046538 Bacteria 3448
396 Ga0495609_0016646 3300046538 Bacteria 3424
397 Ga0495609_0041115 3300046538 Bacteria 2079
398 Ga0495609_0045679 3300046538 Bacteria 1962
399 Ga0495609_0047874 3300046538 Bacteria 1912
400 Ga0495609_0055394 3300046538 Bacteria 1759
401 Ga0495609_0061330 3300046538 Bacteria 1661
402 Ga0495609_0076696 3300046538 Bacteria 1464
403 Ga0495609_0157790 3300046538 Bacteria 963
404 Ga0495597_0001594 3300046542 Bacteria 15928
405 Ga0495597_0007376 3300046542 Bacteria 5590
406 Ga0495597_0025709 3300046542 Bacteria 2709
407 Ga0495597_0035699 3300046542 Bacteria 2241
408 Ga0495597_0038410 3300046542 Bacteria 2145
409 Ga0495597_0061545 3300046542 Bacteria 1634
410 Ga0495597_0066756 3300046542 Bacteria 1558
411 Ga0495597_0105284 3300046542 Bacteria 1186
412 Ga0495645_0149876 3300046543 Bacteria 1621
413 Ga0495622_0003719 3300046557 Bacteria 7140
414 Ga0495622_0013947 3300046557 Bacteria 3729
415 Ga0495622_0021082 3300046557 Bacteria 3036
416 Ga0495633_0002836 3300046558 Bacteria 11935
417 Ga0495633_0004922 3300046558 Bacteria 8343
418 Ga0495656_0096184 3300046615 Bacteria 1362
419 Ga0495656_0115521 3300046615 Bacteria 1261
420 Ga0495668_0000046 3300046616 Bacteria 224203
421 Ga0495668_0004182 3300046616 Bacteria 10418
422 Ga0495668_0010354 3300046616 Bacteria 5646
423 Ga0495668_0198558 3300046616 Bacteria 1098
424 Ga0495634_0000547 3300046642 Bacteria 36842
425 Ga0495611_0048704 3300046648 Bacteria 1905
426 Ga0495625_0003173 3300046660 Bacteria 16729
427 Ga0495625_0007777 3300046660 Bacteria 9255
428 Ga0495625_0033401 3300046660 Bacteria 3805
429 Ga0495625_0108160 3300046660 Bacteria 1902
430 Ga0495625_0180798 3300046660 Bacteria 1402
431 Ga0495625_0249269 3300046660 Bacteria 1153
432 Ga0495635_0093206 3300046663 Bacteria 2059
433 Ga0495659_0006353 3300046664 Bacteria 3734
434 Ga0495661_0005238 3300046665 Bacteria 9227
435 Ga0495661_0008550 3300046665 Bacteria 7076
436 Ga0495661_0038544 3300046665 Bacteria 2976
437 Ga0495661_0054285 3300046665 Bacteria 2406
438 Ga0495661_0064790 3300046665 Bacteria 2155
439 Ga0495661_0067484 3300046665 Bacteria 2101
440 Ga0495661_0085534 3300046665 Bacteria 1807
441 Ga0495661_0094307 3300046665 Bacteria 1697
442 Ga0495661_0136236 3300046665 Bacteria 1340
443 Ga0495588_0020121 3300046674 Bacteria 3275
444 Ga0495588_0038129 3300046674 Bacteria 2444
445 Ga0495623_0012557 3300046679 Bacteria 5481
446 Ga0495646_0001334 3300046680 Bacteria 14574
447 Ga0495646_0011959 3300046680 Bacteria 5520
448 Ga0495646_0014008 3300046680 Bacteria 5097
449 Ga0495669_0021175 3300046684 Bacteria 2819
450 Ga0495613_0056195 3300046689 Bacteria 2890
451 Ga0495613_0216532 3300046689 Bacteria 1345
452 Ga0495624_0009124 3300046690 Bacteria 6879
453 Ga0495670_0000161 3300046691 Bacteria 29207
454 Ga0495670_0000555 3300046691 Bacteria 17788
455 Ga0495670_0000632 3300046691 Bacteria 16832
456 Ga0495670_0003051 3300046691 Bacteria 8260
457 Ga0495670_0230749 3300046691 Bacteria 984
458 Ga0495670_0263744 3300046691 Bacteria 919
459 Ga0495670_0341950 3300046691 Bacteria 805
460 Ga0495671_0001622 3300046692 Bacteria 14763
461 Ga0495671_0004229 3300046692 Bacteria 8643
462 Ga0495671_0005007 3300046692 Bacteria 7806
463 Ga0495671_0015316 3300046692 Bacteria 4111
464 Ga0495671_0016515 3300046692 Bacteria 3939
465 Ga0495671_0023271 3300046692 Bacteria 3237
466 Ga0495671_0024161 3300046692 Bacteria 3169
467 Ga0495671_0053964 3300046692 Bacteria 1993
468 Ga0495671_0168399 3300046692 Bacteria 1065
469 Ga0495671_0220989 3300046692 Bacteria 917
470 Ga0495671_0292108 3300046692 Bacteria 784
471 Ga0495649_0004123 3300046694 Bacteria 9543
472 Ga0495649_0005532 3300046694 Bacteria 8000
473 Ga0495649_0015451 3300046694 Bacteria 4345
474 Ga0495649_0015521 3300046694 Bacteria 4334
475 Ga0495649_0034378 3300046694 Bacteria 2788
476 Ga0495649_0037847 3300046694 Bacteria 2647
477 Ga0495649_0098780 3300046694 Bacteria 1553
478 Ga0495649_0273774 3300046694 Bacteria 863
479 Ga0495589_0000068 3300046794 Bacteria 98844
480 Ga0495589_0004587 3300046794 Bacteria 7347
481 Ga0495589_0015458 3300046794 Bacteria 3927
482 Ga0495589_0028131 3300046794 Bacteria 2839
483 Ga0495589_0034965 3300046794 Bacteria 2520
484 Ga0495589_0047015 3300046794 Bacteria 2139
485 Ga0495589_0182288 3300046794 Bacteria 995
486 Ga0495600_0011606 3300046809 Bacteria 5493
487 Ga0495600_0051722 3300046809 Bacteria 2681
488 Ga0495660_0013324 3300046810 Bacteria 4765
489 Ga0495660_0013503 3300046810 Bacteria 4731
490 Ga0495660_0025907 3300046810 Bacteria 3327
491 Ga0495660_0030212 3300046810 Bacteria 3053
492 Ga0495660_0032055 3300046810 Bacteria 2952
493 Ga0495660_0042840 3300046810 Bacteria 2499
494 Ga0495660_0045227 3300046810 Bacteria 2417
495 Ga0495660_0045871 3300046810 Bacteria 2398
496 Ga0495660_0050143 3300046810 Bacteria 2275
497 Ga0495660_0054320 3300046810 Bacteria 2170
498 Ga0495660_0097748 3300046810 Bacteria 1515
499 Ga0495581_0044665 3300047315 Bacteria 2562
500 Ga0495581_0152494 3300047315 Unclassified 1350
501 Ga0495604_0038247 3300047317 Bacteria 3775
502 Ga0495604_0258489 3300047317 Bacteria 1184
503 Ga0495672_0000491 3300047320 Bacteria 46089
504 Ga0495672_0002924 3300047320 Bacteria 15088
505 Ga0495672_0006898 3300047320 Bacteria 8659
506 Ga0495672_0007906 3300047320 Bacteria 7931
507 Ga0495672_0015946 3300047320 Bacteria 5085
508 Ga0495672_0023411 3300047320 Bacteria 3998
509 Ga0495672_0054247 3300047320 Bacteria 2344
510 Ga0495672_0071403 3300047320 Bacteria 1964
511 Ga0495672_0073003 3300047320 Bacteria 1936
512 Ga0495672_0093924 3300047320 Bacteria 1641
513 Ga0495672_0100671 3300047320 Bacteria 1568
514 Ga0495676_0017723 3300047321 Bacteria 6289
515 Ga0495676_0018006 3300047321 Bacteria 6230
516 Ga0495676_0021388 3300047321 Bacteria 5651
517 Ga0495680_0024712 3300047322 Bacteria 4980
518 Ga0495680_0053158 3300047322 Bacteria 3154
519 Ga0495683_0001298 3300047323 Bacteria 16884
520 Ga0495683_0003432 3300047323 Bacteria 9246
521 Ga0495683_0005290 3300047323 Bacteria 7169
522 Ga0495683_0024277 3300047323 Bacteria 3112
523 Ga0495683_0034471 3300047323 Bacteria 2574
524 Ga0495683_0040939 3300047323 Bacteria 2339
525 Ga0495683_0043892 3300047323 Bacteria 2249
526 Ga0495687_002427 3300047443 Bacteria 14989
527 Ga0495687_003489 3300047443 Bacteria 11351
528 Ga0495687_037574 3300047443 Bacteria 2156
529 Ga0495675_0003267 3300047444 Bacteria 9742
530 Ga0495675_0146893 3300047444 Bacteria 1458
531 Ga0495679_003166 3300047446 Bacteria 8029
532 Ga0495679_007055 3300047446 Bacteria 4743
533 Ga0495679_009977 3300047446 Bacteria 3762
534 Ga0495685_027654 3300047447 Bacteria 1951
535 Ga0495673_0000712 3300047469 Bacteria 32267
536 Ga0495673_0003310 3300047469 Bacteria 10683
537 Ga0495673_0003755 3300047469 Bacteria 9858
538 Ga0495673_0003825 3300047469 Bacteria 9723
539 Ga0495673_0003878 3300047469 Bacteria 9625
540 Ga0495673_0004036 3300047469 Bacteria 9357
541 Ga0495673_0005228 3300047469 Bacteria 7888
542 Ga0495673_0008480 3300047469 Bacteria 5775
543 Ga0495673_0010619 3300047469 Bacteria 4996
544 Ga0495673_0011276 3300047469 Bacteria 4818
545 Ga0495673_0014685 3300047469 Bacteria 4065
546 Ga0495673_0021263 3300047469 Bacteria 3209
547 Ga0495673_0023679 3300047469 Bacteria 2981
548 Ga0495673_0038578 3300047469 Bacteria 2172
549 Ga0495673_0039317 3300047469 Bacteria 2146
550 Ga0495681_0010568 3300047470 Bacteria 5581
551 Ga0495681_0011024 3300047470 Bacteria 5420
552 Ga0495681_0038055 3300047470 Bacteria 2362
553 Ga0495681_0059281 3300047470 Bacteria 1770
554 Ga0495681_0140326 3300047470 Bacteria 1021
555 Ga0495681_0154157 3300047470 Bacteria 961
556 Ga0495684_0106054 3300047471 Bacteria 2123
557 Ga0495686_0003511 3300047472 Bacteria 13527
558 Ga0495686_0067885 3300047472 Bacteria 2200
559 Ga0495593_0002213 3300047673 Bacteria 11651
560 Ga0495593_0011112 3300047673 Bacteria 5179
561 Ga0495593_0038428 3300047673 Bacteria 2585
562 Ga0495626_0000813 3300048091 Bacteria 28162
563 Ga0495626_0002075 3300048091 Bacteria 14587
564 Ga0495626_0005678 3300048091 Bacteria 7223
565 Ga0495626_0005953 3300048091 Bacteria 7013
566 Ga0495626_0012189 3300048091 Bacteria 4518
567 Ga0495626_0013213 3300048091 Bacteria 4296
568 Ga0495626_0021015 3300048091 Bacteria 3246
569 Ga0496110_0020692 3300048913 Bacteria 5556
570 Ga0496110_0078256 3300048913 Bacteria 2944
571 Ga0496111_0075938 3300048914 Bacteria 2449
572 Ga0496112_0526855 3300048915 Bacteria 1116
573 Ga0496115_0112688 3300048918 Bacteria 2235
574 Ga0496116_0005517 3300048919 Bacteria 11692
575 Ga0496116_0015643 3300048919 Bacteria 5989
576 Ga0496116_0027432 3300048919 Bacteria 4146
577 Ga0496117_0004901 3300048920 Bacteria 14414
578 Ga0496117_0013952 3300048920 Bacteria 6961
579 Ga0496117_0017670 3300048920 Bacteria 5950
580 Ga0496117_0062135 3300048920 Bacteria 2561
581 Ga0496117_0144293 3300048920 Bacteria 1420
582 Ga0496117_0340370 3300048920 Bacteria 778
583 Ga0496118_0005477 3300048921 Bacteria 14405
584 Ga0496118_0014959 3300048921 Bacteria 7218
585 Ga0496118_0029092 3300048921 Bacteria 4639
586 Ga0496118_0145325 3300048921 Bacteria 1494
587 Ga0496118_0229474 3300048921 Bacteria 1073
588 Ga0496119_0009901 3300048922 Bacteria 8095
589 Ga0496119_0013332 3300048922 Bacteria 6565
590 Ga0496119_0037168 3300048922 Bacteria 3167
591 Ga0496120_0018066 3300048923 Bacteria 4555
592 Ga0496120_0032129 3300048923 Bacteria 3168
593 Ga0496121_0024876 3300048924 Bacteria 5708
594 Ga0496121_0033115 3300048924 Bacteria 4684
595 Ga0496121_0219390 3300048924 Bacteria 1340
596 Ga0496122_0009950 3300048925 Bacteria 9904
597 Ga0496122_0011476 3300048925 Bacteria 8965
598 Ga0496123_0009492 3300048926 Bacteria 8757
599 Ga0496123_0039209 3300048926 Bacteria 3316
600 Ga0496124_0000329 3300048927 Bacteria 87707
601 Ga0496124_0022499 3300048927 Bacteria 5776
602 Ga0496124_0094002 3300048927 Bacteria 2439
603 Ga0496124_0236703 3300048927 Bacteria 1361
604 Ga0496124_0404059 3300048927 Bacteria 947
605 Ga0496125_0013998 3300048928 Bacteria 7844
606 Ga0496125_0018007 3300048928 Bacteria 6715
607 Ga0495678_007651 3300049459 Bacteria 5572
608 Ga0495678_008334 3300049459 Bacteria 5241
609 Ga0495678_009030 3300049459 Bacteria 4975
610 Ga0495678_010675 3300049459 Bacteria 4444
611 Ga0495678_019390 3300049459 Bacteria 3034
612 Ga0495678_022279 3300049459 Bacteria 2772
613 Ga0495678_026627 3300049459 Bacteria 2465
614 Ga0495678_061029 3300049459 Bacteria 1416
615 Ga0495678_094811 3300049459 Bacteria 1044
616 Ga0495682_0003238 3300049460 Bacteria 7302
617 Ga0495682_0003422 3300049460 Bacteria 7057
618 Ga0495682_0014163 3300049460 Bacteria 3025
619 Ga0495682_0018948 3300049460 Bacteria 2590
620 Ga0495682_0025762 3300049460 Bacteria 2187
621 Ga0495682_0026155 3300049460 Bacteria 2169
622 Ga0501292_010597 3300049515 Bacteria 1382
623 Ga0501211_005396 3300049658 Bacteria 1280
624 Ga0501241_001710 3300049758 Bacteria 4372
625 Ga0501269_002224 3300049766 Bacteria 2412
626 nmdc:mga03683_40187_c1 3300050489 Bacteria 1917
627 nmdc:mga00v17_50035_c1 3300050491 Bacteria 2537
628 nmdc:mga08x19_144113_c1 3300050514 Bacteria 1610
629 nmdc:mga08x19_342434_c1 3300050514 Bacteria 1043
630 nmdc:mga0sz30_12142_c1 3300050516 Bacteria 3343
631 nmdc:mga0sz30_43127_c1 3300050516 Bacteria 1898
632 Ga0500644_0233714 3300053088 Bacteria 770
633 Ga0500572_002472 3300053111 Bacteria 4436

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041405 Ga0439438_020393 Ga0439438_020393_17_625 191
2 3300046491 Ga0495584_0037266 Ga0495584_0037266_1597_2199 196
3 3300046520 Ga0495637_0186176 Ga0495637_0186176_15_620 198
4 3300046530 Ga0495654_0103075 Ga0495654_0103075_16_621 198
5 3300003781 Ga0055536_1000348 Ga0055536_100034836 210
6 3300013102 Ga0157371_10001164 Ga0157371_1000116437 210
7 3300046530 Ga0495654_0001548 Ga0495654_0001548_11364_12077 210
8 3300046691 Ga0495670_0230749 Ga0495670_0230749_16_657 210
9 3300046477 Ga0495664_0260168 Ga0495664_0260168_32_673 211
10 3300046492 Ga0495585_0095317 Ga0495585_0095317_920_1561 211
11 3300046519 Ga0495632_0187926 Ga0495632_0187926_49_690 211
12 3300046694 Ga0495649_0015451 Ga0495649_0015451_3508_4149 211
13 3300003775 Ga0055524_1000671 Ga0055524_100067122 212
14 3300046524 Ga0495648_0107240 Ga0495648_0107240_159_803 212
15 3300046665 Ga0495661_0085534 Ga0495661_0085534_1075_1719 212
16 3300047469 Ga0495673_0003878 Ga0495673_0003878_169_813 212
17 3300005834 Ga0068851_10000011 Ga0068851_10000011160 213
18 3300025321 Ga0207656_10000013 Ga0207656_1000001324 213
19 3300046463 Ga0495653_0072646 Ga0495653_0072646_1465_2178 214
20 3300046809 Ga0495600_0051722 Ga0495600_0051722_917_1630 214
21 3300047444 Ga0495675_0146893 Ga0495675_0146893_577_1290 214
22 3300047471 Ga0495684_0106054 Ga0495684_0106054_1298_2011 214
23 3300049459 Ga0495678_007651 Ga0495678_007651_1988_2644 216
24 3300049459 Ga0495678_010675 Ga0495678_010675_2534_3190 216
25 3300046519 Ga0495632_0318612 Ga0495632_0318612_16_675 217
26 3300050491 nmdc:mga00v17_50035_c1 nmdc:mga00v17_50035_c1_577_1290 220
27 3300046501 Ga0495607_0190715 Ga0495607_0190715_133_804 221
28 3300050489 nmdc:mga03683_40187_c1 nmdc:mga03683_40187_c1_19_732 221
29 3300050516 nmdc:mga0sz30_43127_c1 nmdc:mga0sz30_43127_c1_458_1171 221
30 3300046526 Ga0495666_0140421 Ga0495666_0140421_19_702 223
31 3300047315 Ga0495581_0152494 Ga0495581_0152494_68_751 223
32 3300041407 Ga0439447_015585 Ga0439447_015585_360_1073 225
33 3300041411 Ga0439466_0007441 Ga0439466_0007441_1389_2102 225
34 iso_pu_bacteria 2524614857 2526062273 227
35 iso_pu_bacteria 2739367875 2740063625 227
36 iso_pu_bacteria 2784132063 2784262992 229
37 iso_pu_bacteria 2842832357 2842837139 229
38 iso_pu_bacteria 2842843487 2842844927 229
39 3300005288 Ga0065714_10098822 Ga0065714_100988222 230
40 3300046512 Ga0495610_0003912 Ga0495610_0003912_1330_2034 230
41 3300046515 Ga0495620_0034870 Ga0495620_0034870_1559_2257 230
42 3300047472 Ga0495686_0003511 Ga0495686_0003511_11495_12199 230
43 iso_pu_bacteria 3007855910 3007858746 230
44 iso_pu_bacteria 2511231008 2511278051 231
45 iso_pu_bacteria 2511231023 2511370753 231
46 iso_pu_bacteria 2643221633 2644186400 231
47 iso_pu_bacteria 2773857670 2774122380 231
48 iso_pu_bacteria 2784132072 2784316218 231
49 iso_pu_bacteria 2808606377 2808931458 231
50 iso_pu_bacteria 2808606381 2808953580 231
51 iso_pu_bacteria 2808606385 2808979509 231
52 iso_pu_bacteria 2808606388 2808995221 231
53 iso_pu_bacteria 2818991456 2819655946 231
54 iso_pu_bacteria 2852657418 2852661228 231
55 iso_pu_bacteria 2860339153 2860341117 231
56 iso_pu_bacteria 2880230671 2880234813 231
57 iso_pu_bacteria 2904518522 2904521051 231
58 iso_pu_bacteria 2904550169 2904553851 231
59 iso_pu_bacteria 2919456309 2919459215 231
60 iso_pu_bacteria 2946006987 2946008101 231
61 iso_pu_bacteria 2974289157 2974289648 231
62 iso_pu_bacteria 3007619802 3007621718 231
63 iso_pu_bacteria 3007718800 3007720990 231
64 iso_pu_bacteria 3007861166 3007865711 231
65 iso_pu_bacteria 8054503363 8054507857 231
66 iso_pu_bacteria 8056161164 8056162480 231
67 iso_pu_bacteria 8056172158 8056172986 231
68 3300005548 Ga0070665_100038777 Ga0070665_1000387774 232
69 3300025728 Ga0207655_1018853 Ga0207655_10188535 232
70 3300046474 Ga0495605_0113214 Ga0495605_0113214_445_1182 232
71 3300046519 Ga0495632_0006101 Ga0495632_0006101_5441_6160 232
72 3300046616 Ga0495668_0004182 Ga0495668_0004182_5073_5792 232
73 iso_pu_bacteria 2511231007 2511270097 232
74 iso_pu_bacteria 2511231022 2511363054 232
75 iso_pu_bacteria 2738541271 2738689244 232
76 iso_pu_bacteria 2738543016 2739264632 232
77 iso_pu_bacteria 2998139840 2998144271 232
78 iso_pu_bacteria 8056166840 8056166992 232
79 3300003791 Ga0055530_10002671 Ga0055530_1000267111 233
80 3300003792 Ga0055540_1000188 Ga0055540_10001883 233
81 3300003794 Ga0055531_10000157 Ga0055531_1000015727 233
82 3300005288 Ga0065714_10003511 Ga0065714_100035116 233
83 3300006058 Ga0075432_10008938 Ga0075432_100089383 233
84 3300009011 Ga0105251_10018179 Ga0105251_100181795 233
85 3300009011 Ga0105251_10062220 Ga0105251_100622202 233
86 3300009036 Ga0105244_10039662 Ga0105244_100396622 233
87 3300009092 Ga0105250_10101526 Ga0105250_101015262 233
88 3300011119 Ga0105246_10060622 Ga0105246_100606222 233
89 3300013100 Ga0157373_10011890 Ga0157373_100118905 233
90 3300013104 Ga0157370_10033591 Ga0157370_100335916 233
91 3300013306 Ga0163162_10427564 Ga0163162_104275643 233
92 3300013308 Ga0157375_10181456 Ga0157375_101814562 233
93 3300014497 Ga0182008_10129824 Ga0182008_101298242 233
94 3300015262 Ga0182007_10040098 Ga0182007_100400982 233
95 3300015265 Ga0182005_1021906 Ga0182005_10219062 233
96 3300017792 Ga0163161_10016048 Ga0163161_100160486 233
97 3300025292 Ga0209676_1000010 Ga0209676_1000010403 233
98 3300025298 Ga0209050_1000019 Ga0209050_1000019458 233
99 3300025303 Ga0209051_1000146 Ga0209051_100014623 233
100 3300025304 Ga0209257_1000040 Ga0209257_1000040122 233
101 3300025711 Ga0207696_1048722 Ga0207696_10487221 233
102 3300025728 Ga0207655_1020207 Ga0207655_10202073 233
103 3300025735 Ga0207713_1007555 Ga0207713_10075557 233
104 3300025735 Ga0207713_1009736 Ga0207713_10097363 233
105 3300027907 Ga0207428_10083804 Ga0207428_100838043 233
106 3300031548 Ga0307408_100084856 Ga0307408_1000848562 233
107 3300046457 Ga0495590_0003583 Ga0495590_0003583_2739_3452 233
108 3300046460 Ga0495638_0034508 Ga0495638_0034508_2344_3057 233
109 3300046460 Ga0495638_0047148 Ga0495638_0047148_1147_1860 233
110 3300046463 Ga0495653_0033081 Ga0495653_0033081_2003_2716 233
111 3300046474 Ga0495605_0001541 Ga0495605_0001541_13074_13787 233
112 3300046501 Ga0495607_0000570 Ga0495607_0000570_31593_32306 233
113 3300046501 Ga0495607_0005380 Ga0495607_0005380_4700_5413 233
114 3300046513 Ga0495616_0000181 Ga0495616_0000181_3021_3734 233
115 3300046513 Ga0495616_0049488 Ga0495616_0049488_998_1711 233
116 3300046520 Ga0495637_0019808 Ga0495637_0019808_1043_1753 233
117 3300046538 Ga0495609_0055394 Ga0495609_0055394_308_1021 233
118 3300046542 Ga0495597_0066756 Ga0495597_0066756_828_1541 233
119 3300046615 Ga0495656_0115521 Ga0495656_0115521_491_1204 233
120 3300046691 Ga0495670_0000555 Ga0495670_0000555_4447_5160 233
121 3300046692 Ga0495671_0001622 Ga0495671_0001622_11275_11988 233
122 3300046694 Ga0495649_0098780 Ga0495649_0098780_537_1250 233
123 3300046810 Ga0495660_0042840 Ga0495660_0042840_1449_2162 233
124 3300047320 Ga0495672_0093924 Ga0495672_0093924_679_1392 233
125 3300047469 Ga0495673_0014685 Ga0495673_0014685_1545_2258 233
126 3300048919 Ga0496116_0027432 Ga0496116_0027432_2617_3330 233
127 3300049459 Ga0495678_008334 Ga0495678_008334_2282_2995 233
128 3300049460 Ga0495682_0003238 Ga0495682_0003238_2706_3419 233
129 3300049460 Ga0495682_0014163 Ga0495682_0014163_1344_2057 233
130 3300003781 Ga0055536_1000435 Ga0055536_10004353 234
131 3300005288 Ga0065714_10006535 Ga0065714_100065353 234
132 3300005288 Ga0065714_10078850 Ga0065714_100788502 234
133 3300005290 Ga0065712_10011240 Ga0065712_100112402 234
134 3300005293 Ga0065715_10326632 Ga0065715_103266321 234
135 3300005548 Ga0070665_100302495 Ga0070665_1003024952 234
136 3300005564 Ga0070664_100309425 Ga0070664_1003094252 234
137 3300006058 Ga0075432_10002100 Ga0075432_100021002 234
138 3300006058 Ga0075432_10022282 Ga0075432_100222823 234
139 3300006058 Ga0075432_10025828 Ga0075432_100258282 234
140 3300006058 Ga0075432_10039532 Ga0075432_100395322 234
141 3300006058 Ga0075432_10060510 Ga0075432_100605101 234
142 3300006177 Ga0075362_10098976 Ga0075362_100989761 234
143 3300006914 Ga0075436_100159833 Ga0075436_1001598332 234
144 3300006914 Ga0075436_100576510 Ga0075436_1005765101 234
145 3300006946 Ga0079104_1040767 Ga0079104_10407672 234
146 3300009011 Ga0105251_10002904 Ga0105251_100029042 234
147 3300009011 Ga0105251_10031428 Ga0105251_100314282 234
148 3300009036 Ga0105244_10009890 Ga0105244_100098903 234
149 3300009036 Ga0105244_10019832 Ga0105244_100198324 234
150 3300009036 Ga0105244_10040624 Ga0105244_100406242 234
151 3300009036 Ga0105244_10054379 Ga0105244_100543792 234
152 3300009092 Ga0105250_10000286 Ga0105250_1000028643 234
153 3300009092 Ga0105250_10007741 Ga0105250_100077413 234
154 3300009092 Ga0105250_10021868 Ga0105250_100218682 234
155 3300011119 Ga0105246_10004752 Ga0105246_100047524 234
156 3300013100 Ga0157373_10059166 Ga0157373_100591662 234
157 3300013100 Ga0157373_10075366 Ga0157373_100753662 234
158 3300013100 Ga0157373_10367773 Ga0157373_103677731 234
159 3300013102 Ga0157371_10070833 Ga0157371_100708332 234
160 3300013102 Ga0157371_10137837 Ga0157371_101378372 234
161 3300013102 Ga0157371_10187887 Ga0157371_101878872 234
162 3300013104 Ga0157370_10108155 Ga0157370_101081552 234
163 3300013104 Ga0157370_10342593 Ga0157370_103425932 234
164 3300013104 Ga0157370_10388876 Ga0157370_103888761 234
165 3300013104 Ga0157370_10427568 Ga0157370_104275682 234
166 3300013105 Ga0157369_10091190 Ga0157369_100911903 234
167 3300013105 Ga0157369_10162887 Ga0157369_101628872 234
168 3300013306 Ga0163162_10545686 Ga0163162_105456862 234
169 3300013307 Ga0157372_10003380 Ga0157372_100033803 234
170 3300014497 Ga0182008_10013732 Ga0182008_100137323 234
171 3300014497 Ga0182008_10049295 Ga0182008_100492953 234
172 3300014497 Ga0182008_10058774 Ga0182008_100587742 234
173 3300015261 Ga0182006_1002434 Ga0182006_10024343 234
174 3300015261 Ga0182006_1003371 Ga0182006_10033713 234
175 3300015261 Ga0182006_1016534 Ga0182006_10165342 234
176 3300015262 Ga0182007_10006082 Ga0182007_100060823 234
177 3300015265 Ga0182005_1001037 Ga0182005_10010372 234
178 3300015265 Ga0182005_1002856 Ga0182005_10028563 234
179 3300015265 Ga0182005_1003751 Ga0182005_10037515 234
180 3300015265 Ga0182005_1004635 Ga0182005_10046355 234
181 3300017792 Ga0163161_10028232 Ga0163161_100282322 234
182 3300017792 Ga0163161_10653394 Ga0163161_106533941 234
183 3300025230 Ga0209563_100275 Ga0209563_10027521 234
184 3300025292 Ga0209676_1000109 Ga0209676_1000109139 234
185 3300025711 Ga0207696_1000157 Ga0207696_100015758 234
186 3300025711 Ga0207696_1002272 Ga0207696_10022727 234
187 3300025711 Ga0207696_1015503 Ga0207696_10155032 234
188 3300025728 Ga0207655_1010456 Ga0207655_10104563 234
189 3300025728 Ga0207655_1014315 Ga0207655_10143153 234
190 3300025728 Ga0207655_1019429 Ga0207655_10194292 234
191 3300025728 Ga0207655_1037824 Ga0207655_10378242 234
192 3300025735 Ga0207713_1000625 Ga0207713_10006253 234
193 3300025735 Ga0207713_1010944 Ga0207713_10109445 234
194 3300025735 Ga0207713_1016362 Ga0207713_10163625 234
195 3300025735 Ga0207713_1019349 Ga0207713_10193493 234
196 3300025735 Ga0207713_1026426 Ga0207713_10264263 234
197 3300025735 Ga0207713_1046063 Ga0207713_10460633 234
198 3300025920 Ga0207649_10000623 Ga0207649_100006232 234
199 3300025945 Ga0207679_10000609 Ga0207679_100006092 234
200 3300027111 Ga0209281_1008032 Ga0209281_10080321 234
201 3300027907 Ga0207428_10032615 Ga0207428_100326153 234
202 3300027907 Ga0207428_10046875 Ga0207428_100468753 234
203 3300027907 Ga0207428_10085051 Ga0207428_100850512 234
204 3300027907 Ga0207428_10217206 Ga0207428_102172061 234
205 3300028379 Ga0268266_10084025 Ga0268266_100840252 234
206 3300030735 Ga0316178_1100242 Ga0316178_11002428 234
207 3300031548 Ga0307408_100015451 Ga0307408_1000154513 234
208 3300031548 Ga0307408_100029903 Ga0307408_1000299031 234
209 3300031731 Ga0307405_10000131 Ga0307405_100001312 234
210 3300031911 Ga0307412_10122626 Ga0307412_101226261 234
211 3300031911 Ga0307412_10200947 Ga0307412_102009472 234
212 3300032004 Ga0307414_10490275 Ga0307414_104902751 234
213 3300041405 Ga0439438_005893 Ga0439438_005893_3232_3945 234
214 3300041405 Ga0439438_007350 Ga0439438_007350_796_1509 234
215 3300041405 Ga0439438_013187 Ga0439438_013187_760_1473 234
216 3300041405 Ga0439438_019722 Ga0439438_019722_629_1342 234
217 3300041405 Ga0439438_063351 Ga0439438_063351_64_777 234
218 3300041407 Ga0439447_003377 Ga0439447_003377_1603_2316 234
219 3300041407 Ga0439447_003776 Ga0439447_003776_392_1105 234
220 3300041407 Ga0439447_004640 Ga0439447_004640_1225_1938 234
221 3300041407 Ga0439447_010164 Ga0439447_010164_809_1522 234
222 3300041407 Ga0439447_017532 Ga0439447_017532_970_1683 234
223 3300041407 Ga0439447_021466 Ga0439447_021466_939_1652 234
224 3300041411 Ga0439466_0004537 Ga0439466_0004537_236_949 234
225 3300041411 Ga0439466_0005101 Ga0439466_0005101_342_1055 234
226 3300041411 Ga0439466_0005835 Ga0439466_0005835_618_1331 234
227 3300041411 Ga0439466_0009539 Ga0439466_0009539_2626_3339 234
228 3300041411 Ga0439466_0022096 Ga0439466_0022096_806_1519 234
229 3300041411 Ga0439466_0022975 Ga0439466_0022975_605_1318 234
230 3300041411 Ga0439466_0033947 Ga0439466_0033947_177_890 234
231 3300041411 Ga0439466_0046276 Ga0439466_0046276_425_1138 234
232 3300042006 Ga0439432_002539 Ga0439432_002539_3935_4648 234
233 3300042006 Ga0439432_003991 Ga0439432_003991_3262_3975 234
234 3300042006 Ga0439432_013607 Ga0439432_013607_1619_2332 234
235 3300042006 Ga0439432_052610 Ga0439432_052610_507_1220 234
236 3300042009 Ga0439451_000830 Ga0439451_000830_720_1433 234
237 3300042010 Ga0439452_000495 Ga0439452_000495_19999_20712 234
238 3300042010 Ga0439452_000504 Ga0439452_000504_1378_2091 234
239 3300042010 Ga0439452_001408 Ga0439452_001408_2093_2806 234
240 3300042010 Ga0439452_003406 Ga0439452_003406_704_1417 234
241 3300042010 Ga0439452_004084 Ga0439452_004084_1177_1890 234
242 3300042010 Ga0439452_022975 Ga0439452_022975_483_1196 234
243 3300042013 Ga0439456_001413 Ga0439456_001413_178_891 234
244 3300042013 Ga0439456_004053 Ga0439456_004053_1235_1948 234
245 3300042013 Ga0439456_024852 Ga0439456_024852_167_880 234
246 3300042115 Ga0450911_002271 Ga0450911_002271_2010_2723 234
247 3300042115 Ga0450911_011596 Ga0450911_011596_221_934 234
248 3300042138 Ga0450903_006259 Ga0450903_006259_1140_1853 234
249 3300042139 Ga0450904_000161 Ga0450904_000161_1117_1830 234
250 3300042146 Ga0450907_002127 Ga0450907_002127_964_1677 234
251 3300042461 Ga0439460_0002811 Ga0439460_0002811_1167_1880 234
252 3300042532 Ga0450893_0002194 Ga0450893_0002194_1713_2426 234
253 3300042993 Ga0439440_0001069 Ga0439440_0001069_2705_3418 234
254 3300046452 Ga0495617_002006 Ga0495617_002006_1072_1785 234
255 3300046452 Ga0495617_005408 Ga0495617_005408_2981_3694 234
256 3300046453 Ga0495627_002616 Ga0495627_002616_561_1274 234
257 3300046453 Ga0495627_008705 Ga0495627_008705_606_1319 234
258 3300046455 Ga0495603_0039258 Ga0495603_0039258_1178_1891 234
259 3300046455 Ga0495603_0098249 Ga0495603_0098249_877_1590 234
260 3300046457 Ga0495590_0007371 Ga0495590_0007371_2615_3328 234
261 3300046457 Ga0495590_0050899 Ga0495590_0050899_454_1167 234
262 3300046457 Ga0495590_0124271 Ga0495590_0124271_94_807 234
263 3300046458 Ga0495591_001183 Ga0495591_001183_574_1287 234
264 3300046458 Ga0495591_008324 Ga0495591_008324_334_1047 234
265 3300046458 Ga0495591_017990 Ga0495591_017990_1062_1775 234
266 3300046458 Ga0495591_023575 Ga0495591_023575_325_1038 234
267 3300046458 Ga0495591_028030 Ga0495591_028030_790_1503 234
268 3300046458 Ga0495591_044700 Ga0495591_044700_420_1133 234
269 3300046459 Ga0495629_0079496 Ga0495629_0079496_139_852 234
270 3300046460 Ga0495638_0004842 Ga0495638_0004842_8341_9054 234
271 3300046460 Ga0495638_0006469 Ga0495638_0006469_436_1149 234
272 3300046460 Ga0495638_0013273 Ga0495638_0013273_4253_4966 234
273 3300046460 Ga0495638_0067731 Ga0495638_0067731_734_1447 234
274 3300046460 Ga0495638_0072490 Ga0495638_0072490_1014_1727 234
275 3300046463 Ga0495653_0002536 Ga0495653_0002536_1176_1889 234
276 3300046463 Ga0495653_0016789 Ga0495653_0016789_3264_3977 234
277 3300046463 Ga0495653_0078833 Ga0495653_0078833_394_1107 234
278 3300046463 Ga0495653_0143230 Ga0495653_0143230_636_1349 234
279 3300046471 Ga0495650_0004828 Ga0495650_0004828_2565_3278 234
280 3300046471 Ga0495650_0014957 Ga0495650_0014957_364_1077 234
281 3300046471 Ga0495650_0016172 Ga0495650_0016172_1820_2533 234
282 3300046471 Ga0495650_0021406 Ga0495650_0021406_1032_1745 234
283 3300046471 Ga0495650_0048382 Ga0495650_0048382_517_1230 234
284 3300046474 Ga0495605_0001814 Ga0495605_0001814_6170_6883 234
285 3300046474 Ga0495605_0002155 Ga0495605_0002155_9690_10403 234
286 3300046474 Ga0495605_0011699 Ga0495605_0011699_2880_3593 234
287 3300046474 Ga0495605_0018281 Ga0495605_0018281_2864_3577 234
288 3300046475 Ga0495639_0150216 Ga0495639_0150216_210_923 234
289 3300046491 Ga0495584_0002384 Ga0495584_0002384_6162_6875 234
290 3300046491 Ga0495584_0005917 Ga0495584_0005917_315_1028 234
291 3300046491 Ga0495584_0044119 Ga0495584_0044119_472_1188 234
292 3300046491 Ga0495584_0055602 Ga0495584_0055602_800_1513 234
293 3300046491 Ga0495584_0066115 Ga0495584_0066115_548_1261 234
294 3300046492 Ga0495585_0009492 Ga0495585_0009492_3768_4481 234
295 3300046492 Ga0495585_0023912 Ga0495585_0023912_1738_2451 234
296 3300046492 Ga0495585_0051468 Ga0495585_0051468_1210_1923 234
297 3300046499 Ga0495594_0031126 Ga0495594_0031126_1021_1734 234
298 3300046500 Ga0495596_0035185 Ga0495596_0035185_573_1286 234
299 3300046501 Ga0495607_0005445 Ga0495607_0005445_3749_4462 234
300 3300046501 Ga0495607_0011512 Ga0495607_0011512_1020_1733 234
301 3300046501 Ga0495607_0015319 Ga0495607_0015319_3181_3894 234
302 3300046501 Ga0495607_0031497 Ga0495607_0031497_1097_1810 234
303 3300046501 Ga0495607_0057407 Ga0495607_0057407_391_1104 234
304 3300046501 Ga0495607_0122747 Ga0495607_0122747_288_1004 234
305 3300046501 Ga0495607_0232900 Ga0495607_0232900_93_806 234
306 3300046506 Ga0495583_0002221 Ga0495583_0002221_15893_16606 234
307 3300046506 Ga0495583_0150435 Ga0495583_0150435_77_790 234
308 3300046507 Ga0495606_0000678 Ga0495606_0000678_42497_43210 234
309 3300046507 Ga0495606_0002819 Ga0495606_0002819_17986_18699 234
310 3300046507 Ga0495606_0043183 Ga0495606_0043183_1169_1882 234
311 3300046507 Ga0495606_0044942 Ga0495606_0044942_330_1043 234
312 3300046507 Ga0495606_0057591 Ga0495606_0057591_872_1585 234
313 3300046507 Ga0495606_0178655 Ga0495606_0178655_252_968 234
314 3300046512 Ga0495610_0001166 Ga0495610_0001166_563_1276 234
315 3300046512 Ga0495610_0004842 Ga0495610_0004842_665_1378 234
316 3300046512 Ga0495610_0005463 Ga0495610_0005463_1347_2060 234
317 3300046512 Ga0495610_0031514 Ga0495610_0031514_529_1242 234
318 3300046513 Ga0495616_0001311 Ga0495616_0001311_6187_6900 234
319 3300046513 Ga0495616_0014246 Ga0495616_0014246_2639_3352 234
320 3300046513 Ga0495616_0026565 Ga0495616_0026565_1599_2315 234
321 3300046513 Ga0495616_0050076 Ga0495616_0050076_304_1017 234
322 3300046513 Ga0495616_0083560 Ga0495616_0083560_196_909 234
323 3300046513 Ga0495616_0108107 Ga0495616_0108107_10_723 234
324 3300046515 Ga0495620_0010200 Ga0495620_0010200_1015_1728 234
325 3300046515 Ga0495620_0042779 Ga0495620_0042779_827_1540 234
326 3300046516 Ga0495628_0086103 Ga0495628_0086103_868_1581 234
327 3300046516 Ga0495628_0086182 Ga0495628_0086182_179_892 234
328 3300046517 Ga0495630_0005873 Ga0495630_0005873_6828_7541 234
329 3300046517 Ga0495630_0031307 Ga0495630_0031307_47_760 234
330 3300046517 Ga0495630_0035187 Ga0495630_0035187_1771_2484 234
331 3300046517 Ga0495630_0125370 Ga0495630_0125370_751_1464 234
332 3300046518 Ga0495631_0001499 Ga0495631_0001499_12184_12897 234
333 3300046518 Ga0495631_0101950 Ga0495631_0101950_404_1117 234
334 3300046519 Ga0495632_0012076 Ga0495632_0012076_687_1400 234
335 3300046519 Ga0495632_0023814 Ga0495632_0023814_1670_2383 234
336 3300046519 Ga0495632_0036089 Ga0495632_0036089_427_1140 234
337 3300046519 Ga0495632_0073644 Ga0495632_0073644_218_931 234
338 3300046520 Ga0495637_0000419 Ga0495637_0000419_1413_2126 234
339 3300046520 Ga0495637_0004534 Ga0495637_0004534_1163_1876 234
340 3300046520 Ga0495637_0019033 Ga0495637_0019033_1316_2029 234
341 3300046520 Ga0495637_0035721 Ga0495637_0035721_1056_1769 234
342 3300046520 Ga0495637_0056605 Ga0495637_0056605_267_980 234
343 3300046522 Ga0495643_0053946 Ga0495643_0053946_286_999 234
344 3300046522 Ga0495643_0055649 Ga0495643_0055649_1254_1967 234
345 3300046522 Ga0495643_0056532 Ga0495643_0056532_1087_1803 234
346 3300046523 Ga0495644_0010741 Ga0495644_0010741_1006_1719 234
347 3300046523 Ga0495644_0056591 Ga0495644_0056591_266_979 234
348 3300046524 Ga0495648_0000587 Ga0495648_0000587_36871_37584 234
349 3300046524 Ga0495648_0024316 Ga0495648_0024316_1344_2057 234
350 3300046524 Ga0495648_0027413 Ga0495648_0027413_2781_3494 234
351 3300046524 Ga0495648_0047001 Ga0495648_0047001_854_1567 234
352 3300046524 Ga0495648_0064450 Ga0495648_0064450_294_1007 234
353 3300046524 Ga0495648_0073498 Ga0495648_0073498_583_1296 234
354 3300046524 Ga0495648_0101298 Ga0495648_0101298_371_1084 234
355 3300046524 Ga0495648_0101445 Ga0495648_0101445_162_875 234
356 3300046526 Ga0495666_0000676 Ga0495666_0000676_13705_14418 234
357 3300046526 Ga0495666_0006179 Ga0495666_0006179_1182_1895 234
358 3300046526 Ga0495666_0051975 Ga0495666_0051975_1036_1749 234
359 3300046526 Ga0495666_0113134 Ga0495666_0113134_489_1202 234
360 3300046530 Ga0495654_0000980 Ga0495654_0000980_1427_2140 234
361 3300046530 Ga0495654_0000981 Ga0495654_0000981_15041_15754 234
362 3300046530 Ga0495654_0003248 Ga0495654_0003248_8708_9421 234
363 3300046530 Ga0495654_0005643 Ga0495654_0005643_643_1356 234
364 3300046530 Ga0495654_0024445 Ga0495654_0024445_272_988 234
365 3300046530 Ga0495654_0038342 Ga0495654_0038342_289_1002 234
366 3300046530 Ga0495654_0052316 Ga0495654_0052316_785_1498 234
367 3300046530 Ga0495654_0088886 Ga0495654_0088886_398_1111 234
368 3300046530 Ga0495654_0096075 Ga0495654_0096075_146_859 234
369 3300046530 Ga0495654_0161292 Ga0495654_0161292_93_806 234
370 3300046530 Ga0495654_0189589 Ga0495654_0189589_55_768 234
371 3300046536 Ga0495587_0012314 Ga0495587_0012314_3487_4200 234
372 3300046536 Ga0495587_0018414 Ga0495587_0018414_3336_4049 234
373 3300046538 Ga0495609_0001802 Ga0495609_0001802_3354_4067 234
374 3300046538 Ga0495609_0011795 Ga0495609_0011795_1388_2101 234
375 3300046538 Ga0495609_0014035 Ga0495609_0014035_2366_3079 234
376 3300046538 Ga0495609_0016436 Ga0495609_0016436_2358_3071 234
377 3300046538 Ga0495609_0016646 Ga0495609_0016646_1040_1753 234
378 3300046538 Ga0495609_0045679 Ga0495609_0045679_1086_1799 234
379 3300046538 Ga0495609_0061330 Ga0495609_0061330_102_815 234
380 3300046538 Ga0495609_0076696 Ga0495609_0076696_394_1107 234
381 3300046538 Ga0495609_0157790 Ga0495609_0157790_103_816 234
382 3300046542 Ga0495597_0001594 Ga0495597_0001594_3744_4457 234
383 3300046542 Ga0495597_0025709 Ga0495597_0025709_809_1522 234
384 3300046542 Ga0495597_0035699 Ga0495597_0035699_1257_1970 234
385 3300046542 Ga0495597_0038410 Ga0495597_0038410_711_1424 234
386 3300046542 Ga0495597_0061545 Ga0495597_0061545_406_1119 234
387 3300046543 Ga0495645_0149876 Ga0495645_0149876_101_814 234
388 3300046557 Ga0495622_0003719 Ga0495622_0003719_5205_5918 234
389 3300046557 Ga0495622_0021082 Ga0495622_0021082_1737_2450 234
390 3300046558 Ga0495633_0004922 Ga0495633_0004922_787_1500 234
391 3300046616 Ga0495668_0198558 Ga0495668_0198558_336_1052 234
392 3300046642 Ga0495634_0000547 Ga0495634_0000547_9208_9921 234
393 3300046648 Ga0495611_0048704 Ga0495611_0048704_268_981 234
394 3300046660 Ga0495625_0007777 Ga0495625_0007777_1868_2581 234
395 3300046660 Ga0495625_0033401 Ga0495625_0033401_2105_2818 234
396 3300046660 Ga0495625_0108160 Ga0495625_0108160_455_1168 234
397 3300046660 Ga0495625_0180798 Ga0495625_0180798_292_1005 234
398 3300046660 Ga0495625_0249269 Ga0495625_0249269_386_1102 234
399 3300046663 Ga0495635_0093206 Ga0495635_0093206_1246_1959 234
400 3300046664 Ga0495659_0006353 Ga0495659_0006353_1984_2697 234
401 3300046665 Ga0495661_0005238 Ga0495661_0005238_3437_4150 234
402 3300046665 Ga0495661_0038544 Ga0495661_0038544_1784_2500 234
403 3300046665 Ga0495661_0054285 Ga0495661_0054285_509_1222 234
404 3300046665 Ga0495661_0064790 Ga0495661_0064790_297_1010 234
405 3300046665 Ga0495661_0067484 Ga0495661_0067484_757_1470 234
406 3300046665 Ga0495661_0094307 Ga0495661_0094307_658_1371 234
407 3300046665 Ga0495661_0136236 Ga0495661_0136236_590_1303 234
408 3300046674 Ga0495588_0020121 Ga0495588_0020121_1989_2702 234
409 3300046679 Ga0495623_0012557 Ga0495623_0012557_3625_4338 234
410 3300046680 Ga0495646_0001334 Ga0495646_0001334_4806_5519 234
411 3300046680 Ga0495646_0011959 Ga0495646_0011959_1200_1913 234
412 3300046680 Ga0495646_0014008 Ga0495646_0014008_3046_3759 234
413 3300046684 Ga0495669_0021175 Ga0495669_0021175_858_1571 234
414 3300046689 Ga0495613_0056195 Ga0495613_0056195_1327_2040 234
415 3300046691 Ga0495670_0263744 Ga0495670_0263744_163_876 234
416 3300046691 Ga0495670_0341950 Ga0495670_0341950_75_788 234
417 3300046692 Ga0495671_0004229 Ga0495671_0004229_1200_1913 234
418 3300046692 Ga0495671_0015316 Ga0495671_0015316_2247_2960 234
419 3300046692 Ga0495671_0016515 Ga0495671_0016515_1543_2259 234
420 3300046692 Ga0495671_0023271 Ga0495671_0023271_2012_2725 234
421 3300046692 Ga0495671_0024161 Ga0495671_0024161_1380_2093 234
422 3300046692 Ga0495671_0053964 Ga0495671_0053964_270_983 234
423 3300046692 Ga0495671_0220989 Ga0495671_0220989_23_736 234
424 3300046692 Ga0495671_0292108 Ga0495671_0292108_10_723 234
425 3300046694 Ga0495649_0004123 Ga0495649_0004123_8306_9019 234
426 3300046694 Ga0495649_0005532 Ga0495649_0005532_450_1163 234
427 3300046694 Ga0495649_0015521 Ga0495649_0015521_2446_3159 234
428 3300046694 Ga0495649_0034378 Ga0495649_0034378_1104_1817 234
429 3300046694 Ga0495649_0037847 Ga0495649_0037847_275_991 234
430 3300046694 Ga0495649_0273774 Ga0495649_0273774_55_768 234
431 3300046794 Ga0495589_0000068 Ga0495589_0000068_21554_22267 234
432 3300046794 Ga0495589_0004587 Ga0495589_0004587_3463_4176 234
433 3300046794 Ga0495589_0015458 Ga0495589_0015458_2654_3367 234
434 3300046794 Ga0495589_0028131 Ga0495589_0028131_1385_2098 234
435 3300046794 Ga0495589_0034965 Ga0495589_0034965_152_910 234
436 3300046794 Ga0495589_0047015 Ga0495589_0047015_310_1023 234
437 3300046809 Ga0495600_0011606 Ga0495600_0011606_1432_2145 234
438 3300046810 Ga0495660_0025907 Ga0495660_0025907_327_1040 234
439 3300046810 Ga0495660_0030212 Ga0495660_0030212_1218_1931 234
440 3300046810 Ga0495660_0045227 Ga0495660_0045227_621_1334 234
441 3300046810 Ga0495660_0050143 Ga0495660_0050143_1026_1739 234
442 3300046810 Ga0495660_0054320 Ga0495660_0054320_641_1354 234
443 3300046810 Ga0495660_0097748 Ga0495660_0097748_324_1040 234
444 3300047315 Ga0495581_0044665 Ga0495581_0044665_478_1191 234
445 3300047317 Ga0495604_0038247 Ga0495604_0038247_2948_3661 234
446 3300047317 Ga0495604_0258489 Ga0495604_0258489_392_1105 234
447 3300047320 Ga0495672_0000491 Ga0495672_0000491_35861_36574 234
448 3300047320 Ga0495672_0002924 Ga0495672_0002924_12242_12955 234
449 3300047320 Ga0495672_0006898 Ga0495672_0006898_586_1299 234
450 3300047320 Ga0495672_0007906 Ga0495672_0007906_5959_6672 234
451 3300047320 Ga0495672_0015946 Ga0495672_0015946_3325_4038 234
452 3300047320 Ga0495672_0023411 Ga0495672_0023411_1273_1986 234
453 3300047320 Ga0495672_0054247 Ga0495672_0054247_1472_2188 234
454 3300047320 Ga0495672_0071403 Ga0495672_0071403_569_1282 234
455 3300047320 Ga0495672_0073003 Ga0495672_0073003_806_1519 234
456 3300047321 Ga0495676_0018006 Ga0495676_0018006_1784_2500 234
457 3300047321 Ga0495676_0021388 Ga0495676_0021388_599_1312 234
458 3300047322 Ga0495680_0024712 Ga0495680_0024712_93_806 234
459 3300047322 Ga0495680_0053158 Ga0495680_0053158_1106_1819 234
460 3300047323 Ga0495683_0003432 Ga0495683_0003432_1356_2069 234
461 3300047323 Ga0495683_0005290 Ga0495683_0005290_3058_3771 234
462 3300047323 Ga0495683_0024277 Ga0495683_0024277_922_1635 234
463 3300047323 Ga0495683_0034471 Ga0495683_0034471_1364_2077 234
464 3300047323 Ga0495683_0040939 Ga0495683_0040939_1109_1822 234
465 3300047323 Ga0495683_0043892 Ga0495683_0043892_429_1142 234
466 3300047443 Ga0495687_003489 Ga0495687_003489_1189_1902 234
467 3300047443 Ga0495687_037574 Ga0495687_037574_81_794 234
468 3300047444 Ga0495675_0003267 Ga0495675_0003267_7567_8280 234
469 3300047446 Ga0495679_003166 Ga0495679_003166_6612_7328 234
470 3300047446 Ga0495679_007055 Ga0495679_007055_3402_4115 234
471 3300047446 Ga0495679_009977 Ga0495679_009977_755_1468 234
472 3300047447 Ga0495685_027654 Ga0495685_027654_279_992 234
473 3300047469 Ga0495673_0000712 Ga0495673_0000712_1207_1920 234
474 3300047469 Ga0495673_0003310 Ga0495673_0003310_402_1115 234
475 3300047469 Ga0495673_0003825 Ga0495673_0003825_8566_9279 234
476 3300047469 Ga0495673_0004036 Ga0495673_0004036_549_1262 234
477 3300047469 Ga0495673_0010619 Ga0495673_0010619_2617_3333 234
478 3300047469 Ga0495673_0011276 Ga0495673_0011276_2794_3507 234
479 3300047469 Ga0495673_0021263 Ga0495673_0021263_1924_2637 234
480 3300047469 Ga0495673_0023679 Ga0495673_0023679_1641_2357 234
481 3300047469 Ga0495673_0039317 Ga0495673_0039317_1133_1846 234
482 3300047470 Ga0495681_0010568 Ga0495681_0010568_3625_4338 234
483 3300047470 Ga0495681_0011024 Ga0495681_0011024_357_1070 234
484 3300047470 Ga0495681_0038055 Ga0495681_0038055_462_1178 234
485 3300047470 Ga0495681_0154157 Ga0495681_0154157_64_777 234
486 3300047472 Ga0495686_0067885 Ga0495686_0067885_952_1665 234
487 3300047673 Ga0495593_0002213 Ga0495593_0002213_4952_5665 234
488 3300047673 Ga0495593_0038428 Ga0495593_0038428_938_1651 234
489 3300048091 Ga0495626_0000813 Ga0495626_0000813_26085_26798 234
490 3300048091 Ga0495626_0002075 Ga0495626_0002075_609_1322 234
491 3300048091 Ga0495626_0005678 Ga0495626_0005678_3041_3754 234
492 3300048091 Ga0495626_0005953 Ga0495626_0005953_569_1282 234
493 3300048091 Ga0495626_0013213 Ga0495626_0013213_449_1162 234
494 3300048091 Ga0495626_0021015 Ga0495626_0021015_1496_2212 234
495 3300048913 Ga0496110_0020692 Ga0496110_0020692_4500_5213 234
496 3300048913 Ga0496110_0078256 Ga0496110_0078256_1694_2407 234
497 3300048914 Ga0496111_0075938 Ga0496111_0075938_1515_2228 234
498 3300048915 Ga0496112_0526855 Ga0496112_0526855_90_803 234
499 3300048918 Ga0496115_0112688 Ga0496115_0112688_734_1447 234
500 3300048919 Ga0496116_0015643 Ga0496116_0015643_3327_4040 234
501 3300048920 Ga0496117_0004901 Ga0496117_0004901_13428_14141 234
502 3300048920 Ga0496117_0013952 Ga0496117_0013952_5779_6492 234
503 3300048920 Ga0496117_0017670 Ga0496117_0017670_3166_3879 234
504 3300048920 Ga0496117_0062135 Ga0496117_0062135_246_1004 234
505 3300048920 Ga0496117_0144293 Ga0496117_0144293_545_1258 234
506 3300048920 Ga0496117_0340370 Ga0496117_0340370_43_756 234
507 3300048921 Ga0496118_0005477 Ga0496118_0005477_322_1035 234
508 3300048921 Ga0496118_0014959 Ga0496118_0014959_5775_6488 234
509 3300048921 Ga0496118_0029092 Ga0496118_0029092_1974_2687 234
510 3300048921 Ga0496118_0145325 Ga0496118_0145325_562_1275 234
511 3300048921 Ga0496118_0229474 Ga0496118_0229474_103_861 234
512 3300048922 Ga0496119_0009901 Ga0496119_0009901_3403_4116 234
513 3300048922 Ga0496119_0013332 Ga0496119_0013332_5787_6500 234
514 3300048922 Ga0496119_0037168 Ga0496119_0037168_2151_2909 234
515 3300048923 Ga0496120_0018066 Ga0496120_0018066_3364_4077 234
516 3300048923 Ga0496120_0032129 Ga0496120_0032129_2131_2889 234
517 3300048924 Ga0496121_0033115 Ga0496121_0033115_699_1412 234
518 3300048924 Ga0496121_0219390 Ga0496121_0219390_363_1076 234
519 3300048925 Ga0496122_0009950 Ga0496122_0009950_433_1146 234
520 3300048926 Ga0496123_0039209 Ga0496123_0039209_326_1039 234
521 3300048927 Ga0496124_0022499 Ga0496124_0022499_4682_5395 234
522 3300048927 Ga0496124_0094002 Ga0496124_0094002_400_1113 234
523 3300048927 Ga0496124_0236703 Ga0496124_0236703_473_1186 234
524 3300048928 Ga0496125_0013998 Ga0496125_0013998_723_1436 234
525 3300048928 Ga0496125_0018007 Ga0496125_0018007_1168_1881 234
526 3300049459 Ga0495678_019390 Ga0495678_019390_1020_1733 234
527 3300049459 Ga0495678_022279 Ga0495678_022279_1395_2108 234
528 3300049459 Ga0495678_026627 Ga0495678_026627_921_1634 234
529 3300049459 Ga0495678_061029 Ga0495678_061029_421_1134 234
530 3300049459 Ga0495678_094811 Ga0495678_094811_61_774 234
531 3300049460 Ga0495682_0003422 Ga0495682_0003422_5297_6010 234
532 3300049460 Ga0495682_0018948 Ga0495682_0018948_1716_2429 234
533 3300049460 Ga0495682_0025762 Ga0495682_0025762_703_1416 234
534 3300049460 Ga0495682_0026155 Ga0495682_0026155_1175_1888 234
535 3300049758 Ga0501241_001710 Ga0501241_001710_832_1545 234
536 3300050514 nmdc:mga08x19_144113_c1 nmdc:mga08x19_144113_c1_459_1172 234
537 3300050514 nmdc:mga08x19_342434_c1 nmdc:mga08x19_342434_c1_197_910 234
538 3300050516 nmdc:mga0sz30_12142_c1 nmdc:mga0sz30_12142_c1_2361_3074 234
539 3300053088 Ga0500644_0233714 Ga0500644_0233714_36_749 234
540 iso_pu_bacteria 2623620446 2624490686 234
541 3300013104 Ga0157370_10049873 Ga0157370_100498732 235
542 3300014497 Ga0182008_10000781 Ga0182008_100007816 235
543 3300015262 Ga0182007_10023580 Ga0182007_100235802 235
544 3300017792 Ga0163161_10072868 Ga0163161_100728682 235
545 3300025735 Ga0207713_1014042 Ga0207713_10140422 235
546 3300031548 Ga0307408_100197308 Ga0307408_1001973081 235
547 3300032004 Ga0307414_10580574 Ga0307414_105805741 235
548 3300032005 Ga0307411_10349882 Ga0307411_103498822 235
549 3300041405 Ga0439438_005529 Ga0439438_005529_1054_1770 235
550 3300041405 Ga0439438_041270 Ga0439438_041270_162_878 235
551 3300041411 Ga0439466_0058846 Ga0439466_0058846_34_750 235
552 3300042006 Ga0439432_006466 Ga0439432_006466_304_1020 235
553 3300042009 Ga0439451_018700 Ga0439451_018700_601_1317 235
554 3300042013 Ga0439456_008691 Ga0439456_008691_271_987 235
555 3300046452 Ga0495617_000566 Ga0495617_000566_1226_1942 235
556 3300046458 Ga0495591_059281 Ga0495591_059281_258_974 235
557 3300046460 Ga0495638_0006872 Ga0495638_0006872_6268_6984 235
558 3300046460 Ga0495638_0037175 Ga0495638_0037175_2138_2854 235
559 3300046460 Ga0495638_0084095 Ga0495638_0084095_391_1110 235
560 3300046471 Ga0495650_0007807 Ga0495650_0007807_4671_5387 235
561 3300046474 Ga0495605_0003915 Ga0495605_0003915_7518_8237 235
562 3300046491 Ga0495584_0043427 Ga0495584_0043427_483_1199 235
563 3300046492 Ga0495585_0053015 Ga0495585_0053015_1222_1938 235
564 3300046492 Ga0495585_0293849 Ga0495585_0293849_72_788 235
565 3300046501 Ga0495607_0041070 Ga0495607_0041070_1541_2257 235
566 3300046501 Ga0495607_0049188 Ga0495607_0049188_1194_1913 235
567 3300046512 Ga0495610_0000721 Ga0495610_0000721_30128_30844 235
568 3300046530 Ga0495654_0010833 Ga0495654_0010833_261_977 235
569 3300046538 Ga0495609_0000121 Ga0495609_0000121_65428_66144 235
570 3300046538 Ga0495609_0005328 Ga0495609_0005328_2943_3659 235
571 3300046538 Ga0495609_0047874 Ga0495609_0047874_1046_1762 235
572 3300046542 Ga0495597_0007376 Ga0495597_0007376_3982_4698 235
573 3300046558 Ga0495633_0002836 Ga0495633_0002836_9973_10689 235
574 3300046615 Ga0495656_0096184 Ga0495656_0096184_392_1108 235
575 3300046660 Ga0495625_0003173 Ga0495625_0003173_4518_5234 235
576 3300046691 Ga0495670_0000161 Ga0495670_0000161_25524_26240 235
577 3300046691 Ga0495670_0003051 Ga0495670_0003051_6351_7067 235
578 3300046692 Ga0495671_0005007 Ga0495671_0005007_2415_3131 235
579 3300046692 Ga0495671_0168399 Ga0495671_0168399_142_858 235
580 3300046794 Ga0495589_0182288 Ga0495589_0182288_201_917 235
581 3300046810 Ga0495660_0013324 Ga0495660_0013324_1138_1854 235
582 3300046810 Ga0495660_0013503 Ga0495660_0013503_3752_4468 235
583 3300046810 Ga0495660_0032055 Ga0495660_0032055_928_1644 235
584 3300046810 Ga0495660_0045871 Ga0495660_0045871_247_963 235
585 3300047320 Ga0495672_0100671 Ga0495672_0100671_726_1442 235
586 3300047323 Ga0495683_0001298 Ga0495683_0001298_4755_5471 235
587 3300047443 Ga0495687_002427 Ga0495687_002427_1414_2130 235
588 3300047469 Ga0495673_0005228 Ga0495673_0005228_6063_6779 235
589 3300048091 Ga0495626_0012189 Ga0495626_0012189_3574_4290 235
590 3300048924 Ga0496121_0024876 Ga0496121_0024876_218_934 235
591 3300048925 Ga0496122_0011476 Ga0496122_0011476_5456_6172 235
592 3300048926 Ga0496123_0009492 Ga0496123_0009492_2591_3307 235
593 3300048927 Ga0496124_0000329 Ga0496124_0000329_14413_15132 235
594 3300049766 Ga0501269_002224 Ga0501269_002224_281_997 235
595 3300041405 Ga0439438_033473 Ga0439438_033473_329_1051 236
596 3300009148 Ga0105243_10000255 Ga0105243_1000025568 237
597 3300025728 Ga0207655_1001107 Ga0207655_100110721 237
598 3300025935 Ga0207709_10000013 Ga0207709_10000013138 237
599 3300017792 Ga0163161_10022368 Ga0163161_100223682 238
600 3300033180 Ga0307510_10019620 Ga0307510_100196202 238
601 3300042115 Ga0450911_000122 Ga0450911_000122_2777_3502 238
602 3300046452 Ga0495617_029733 Ga0495617_029733_155_880 238
603 3300046471 Ga0495650_0017490 Ga0495650_0017490_2636_3361 238
604 3300046500 Ga0495596_0021798 Ga0495596_0021798_490_1215 238
605 3300046501 Ga0495607_0048010 Ga0495607_0048010_552_1277 238
606 3300046513 Ga0495616_0123626 Ga0495616_0123626_120_845 238
607 3300046538 Ga0495609_0041115 Ga0495609_0041115_295_1020 238
608 3300046542 Ga0495597_0105284 Ga0495597_0105284_208_933 238
609 3300047469 Ga0495673_0038578 Ga0495673_0038578_255_980 238
610 iso_pu_bacteria 2511231010 2511287858 238
611 iso_pu_bacteria 2713897149 2715759274 238
612 iso_pu_bacteria 2919487758 2919489523 238
613 iso_pu_bacteria 2969304461 2969308975 238
614 3300005548 Ga0070665_100507333 Ga0070665_1005073332 241
615 3300013100 Ga0157373_10101855 Ga0157373_101018552 241
616 3300013105 Ga0157369_10039158 Ga0157369_100391581 241
617 3300013308 Ga0157375_10049874 Ga0157375_100498744 241
618 3300015261 Ga0182006_1055434 Ga0182006_10554342 241
619 3300025298 Ga0209050_1034073 Ga0209050_10340731 241
620 3300028379 Ga0268266_10052804 Ga0268266_100528042 241
621 3300046452 Ga0495617_006243 Ga0495617_006243_237_971 241
622 3300046492 Ga0495585_0077560 Ga0495585_0077560_460_1194 241
623 3300046501 Ga0495607_0095202 Ga0495607_0095202_670_1404 241
624 3300046515 Ga0495620_0020739 Ga0495620_0020739_2268_3002 241
625 3300046519 Ga0495632_0011513 Ga0495632_0011513_3749_4483 241
626 3300046520 Ga0495637_0004488 Ga0495637_0004488_6150_6884 241
627 3300046524 Ga0495648_0008381 Ga0495648_0008381_3994_4728 241
628 3300046524 Ga0495648_0010649 Ga0495648_0010649_3225_3959 241
629 3300046526 Ga0495666_0010885 Ga0495666_0010885_1218_1952 241
630 3300046530 Ga0495654_0013421 Ga0495654_0013421_214_948 241
631 3300046616 Ga0495668_0010354 Ga0495668_0010354_500_1234 241
632 3300046665 Ga0495661_0008550 Ga0495661_0008550_6140_6874 241
633 3300046674 Ga0495588_0038129 Ga0495588_0038129_56_790 241
634 3300046689 Ga0495613_0216532 Ga0495613_0216532_395_1129 241
635 3300046690 Ga0495624_0009124 Ga0495624_0009124_3607_4341 241
636 3300047321 Ga0495676_0017723 Ga0495676_0017723_3133_3867 241
637 3300047469 Ga0495673_0003755 Ga0495673_0003755_4441_5175 241
638 3300047469 Ga0495673_0008480 Ga0495673_0008480_1852_2586 241
639 3300047470 Ga0495681_0059281 Ga0495681_0059281_94_873 241
640 3300047470 Ga0495681_0140326 Ga0495681_0140326_216_950 241
641 3300047673 Ga0495593_0011112 Ga0495593_0011112_3420_4154 241
642 3300048919 Ga0496116_0005517 Ga0496116_0005517_4452_5186 241
643 3300048927 Ga0496124_0404059 Ga0496124_0404059_150_884 241
644 3300049459 Ga0495678_009030 Ga0495678_009030_3292_4026 241
645 3300053111 Ga0500572_002472 Ga0500572_002472_2955_3689 241
646 3300030731 Ga0316177_1184941 Ga0316177_11849411 244
647 3300046616 Ga0495668_0000046 Ga0495668_0000046_35472_36206 244
648 3300046492 Ga0495585_0002305 Ga0495585_0002305_5085_5867 245
649 3300046691 Ga0495670_0000632 Ga0495670_0000632_5766_6548 245
650 3300046557 Ga0495622_0013947 Ga0495622_0013947_2445_3221 247
651 3300002773 JGI25152J39213_1000180 JGI25152J39213_100018033 248
652 3300002774 JGI25150J39212_1000148 JGI25150J39212_10001487 248
653 3300003215 JGI25153J46596_10007904 JGI25153J46596_100079043 248
654 3300003771 Ga0055526_1001548 Ga0055526_10015482 248
655 3300003771 Ga0055526_1013740 Ga0055526_10137403 248
656 3300003773 Ga0055537_1001549 Ga0055537_10015494 248
657 3300003773 Ga0055537_1010881 Ga0055537_10108812 248
658 3300003775 Ga0055524_1035951 Ga0055524_10359512 248
659 3300003790 Ga0055528_1026615 Ga0055528_10266152 248
660 3300003791 Ga0055530_10001667 Ga0055530_1000166710 248
661 3300025245 Ga0207425_1000241 Ga0207425_100024133 248
662 3300025258 Ga0209129_1000320 Ga0209129_100032032 248
663 3300025263 Ga0209565_1001752 Ga0209565_10017523 248
664 3300025263 Ga0209565_1002147 Ga0209565_10021473 248
665 3300025273 Ga0209673_1010911 Ga0209673_10109113 248
666 3300025291 Ga0209675_1003137 Ga0209675_10031376 248
667 3300025295 Ga0209564_1002250 Ga0209564_10022509 248
668 3300025295 Ga0209564_1012869 Ga0209564_10128693 248
669 3300025297 Ga0209758_1000848 Ga0209758_100084833 248
670 3300025298 Ga0209050_1001237 Ga0209050_100123710 248
671 3300025299 Ga0209256_1001155 Ga0209256_100115520 248
672 3300031548 Ga0307408_100000289 Ga0307408_10000028944 248
673 3300049515 Ga0501292_010597 Ga0501292_010597_47_799 248
674 3300049658 Ga0501211_005396 Ga0501211_005396_158_910 248

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01844

HNH

HNH endonuclease

173

224

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8csz-assembly1.cif.gz_D iscb and wrna bound to target dna 0.8072 154 230
4h9d-assembly1.cif.gz_B crystal structure of mn-dependent gme hnh nicking endonuclease from geobacter metallireducens gs-15, northeast structural genomics consortium (nesg) target gmr87 0.7681 162 226
4h9d-assembly1.cif.gz_A crystal structure of mn-dependent gme hnh nicking endonuclease from geobacter metallireducens gs-15, northeast structural genomics consortium (nesg) target gmr87 0.7112 157 230
4h9d-assembly1.cif.gz_C crystal structure of mn-dependent gme hnh nicking endonuclease from geobacter metallireducens gs-15, northeast structural genomics consortium (nesg) target gmr87 0.6857 162 226
3ldy-assembly1.cif.gz_A an extraordinary mechanism of dna perturbation exhibited by the rare-cutting hnh restriction endonuclease paci 0.5729 156 229
ID Description Score Start End Superfamily
af_P24200_175_274_1.10.30.50 Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A; 0.9231 141 232 1.10.30.50
af_P24200_175_274_1.10.30.50 Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A; 0.8254 141 232 1.10.30.50
af_P71806_355_434_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7464 154 220 2.30.29.30
af_Q8LMG0_22_125_1.10.30.50 Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A; 0.6668 184 225 1.10.30.50
af_K7LJR0_93_187_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.6194 11 100 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A4Q6DF35-F1-model_v4 deleted 0.9957 10 75
AF-A0A0G4K1X6-F1-model_v4 5-methylcytosine-specific restriction enzyme A (EC 3.1.21.-) 0.975 166 237 GO:0003676
GO:0004519
GO:0008270
AF-A0A1I6M3K4-F1-model_v4 5-methylcytosine-specific restriction enzyme A 0.9661 10 102
AF-A0A3A5L1S4-F1-model_v4 DUF3883 domain-containing protein 0.9651 10 104
AF-A0A3G8H4P7-F1-model_v4 HNH endonuclease 0.9634 150 218 GO:0003676
GO:0004519
GO:0008270

Feature Viewer

pLDDT pTM Quality
89.75 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map