F474385

General Info

Members Datasets Scaffolds Average Seq Length
674 368 584 255

Family's Representative Sequence

Representative Sequence 3300046471|Ga0495650_0000018|Ga0495650_0000018_218774_219538
Length 248
Sequence MSDKTQRPKIILEPDQRKQLVNIQRRMLLRSGLTLGAVSMLTGCNLQDGDQVDKVLWAMSRWNDRVQSWLFSGQKLAQTYRADQITTPFRFNAYYPEYNVNYRLEVSGLVQKKAPWTLEQLQRLPQESQITRLICIEGWSAIGQWKGVPLKTFLQHVGADLTAKYVGFKCDDRYYSSIDMATALHPQTILALDFGGKPLPPDFGYPLRLRMPTKLGFKNAKHIGAIFVTNEYPGGYWEDQGYNWFSGI

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
4 2506520008 Serratia plymuthica AS12 Isolate Unclassified
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
7 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
8 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
9 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
10 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
11 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
12 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
13 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
14 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
15 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
16 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
17 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
18 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
19 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
20 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
21 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
22 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
23 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
24 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
25 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
26 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
27 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
28 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
29 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
30 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
31 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
32 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
33 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
34 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
35 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
36 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
37 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
38 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
39 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
40 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
41 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
42 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
43 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
44 2818991436 Collimonas arenae 515 Isolate Unclassified
45 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
46 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
47 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
48 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
49 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
50 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
51 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
52 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
53 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
54 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
55 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
56 2855730933 Achromobacter sp. HZ28 Isolate Nodule
57 2855767633 Achromobacter sp. HZ34 Isolate Nodule
58 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
59 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
60 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
61 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
62 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
63 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
64 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
65 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
66 2904504865 Serratia marcescens 1822 Isolate Unclassified
67 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
68 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
69 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
70 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
71 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
72 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
73 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
74 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
75 2919150387 Rahnella aceris 1817 Isolate Unclassified
76 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
77 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
78 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
79 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
80 2927143783 Rahnella sp. 2050 Isolate Unclassified
81 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
82 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
83 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
84 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
85 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
86 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
87 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
88 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
89 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
90 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
91 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
92 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
93 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
94 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
95 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
96 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
97 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
98 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
99 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
100 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
101 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
102 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
103 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
104 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
105 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
106 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
107 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
108 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
109 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
110 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
111 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
112 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
113 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
114 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
115 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
116 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
117 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
118 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
119 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
120 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
121 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
122 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
123 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
124 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
125 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
126 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
127 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
128 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
129 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
130 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
131 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
132 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
133 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
134 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
135 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
136 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
137 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
138 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
139 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
140 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
141 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
142 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
143 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
144 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
145 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
146 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
147 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
148 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
149 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
150 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
151 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
152 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
153 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
154 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
155 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
156 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
157 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
158 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
159 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
160 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
161 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
162 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
163 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
164 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
165 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
166 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
167 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
168 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
169 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
170 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
171 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
172 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
173 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
179 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
180 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
182 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
183 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
185 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
186 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
230 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
232 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
233 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
234 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
235 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
236 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
237 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
238 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
239 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
240 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
241 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
242 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
243 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
244 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
245 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
246 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
247 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
248 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
249 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
250 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
251 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
252 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
253 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
254 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
255 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
256 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
257 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
258 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
259 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
260 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
261 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
262 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
263 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
264 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
265 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
266 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
267 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
268 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
269 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
270 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
271 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
272 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
273 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
274 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
275 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
276 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
277 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
278 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
279 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
280 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
281 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
282 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
283 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
284 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
285 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
286 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
287 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
288 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
289 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
290 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
291 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
292 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
293 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
294 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
295 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
296 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
297 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
298 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
299 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
300 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
301 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
302 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
303 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
304 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
305 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
306 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
307 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
308 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
309 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
310 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
311 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
312 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
313 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
314 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
315 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
316 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
317 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
318 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
319 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
320 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
321 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
322 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
323 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
324 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
325 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
326 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
327 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
328 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
329 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
330 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
331 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
332 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
333 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
334 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
335 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
336 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
337 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
338 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
339 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
340 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
341 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
342 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
343 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
344 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
345 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
346 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
347 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
348 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
349 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
350 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
351 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
352 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
353 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
355 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
356 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
357 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
358 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
359 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
360 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
361 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
362 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
363 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
364 640753048 Serratia proteamaculans 568 Isolate Endosphere
365 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
366 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
367 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
368 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.65
Metatranscriptomes 0
Isolates 13.35

Biome Distribution

Category Percentage (%)
Aerial Root 0.15
Bulb 0
Endosphere 9.5
Nodule 1.63
Rhizoplane 3.12
Rhizosphere 69.73
Stem 0
Stem Tuber 0
Unclassified 15.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2097597 2162886007 Bacteria 1603
2 SwRhRL2b_contig_2326806 2162886007 Bacteria 4897
3 MRS1b_contig_117389 2162886011 Bacteria 898
4 JGI25155J39150_1000511 3300002704 Bacteria 9243
5 JGI25156J39149_1000320 3300002705 Bacteria 31857
6 JGI25156J39149_1009833 3300002705 Bacteria 2293
7 JGI25162J39368_1000002 3300002737 Bacteria 663004
8 JGI25162J39368_1000079 3300002737 Bacteria 115162
9 JGI25154J39366_1000264 3300002738 Bacteria 33263
10 JGI25154J39366_1000967 3300002738 Bacteria 11784
11 JGI25157J39369_1001592 3300002741 Bacteria 7972
12 JGI25163J39215_1000003 3300002771 Bacteria 149140
13 JGI25164J39214_1000041 3300002772 Bacteria 127466
14 JGI25165J46597_1000135 3300003214 Bacteria 122924
15 rootH1_10015053 3300003323 Bacteria 13144
16 Ga0055538_1000003 3300003751 Bacteria 663004
17 Ga0055538_1000055 3300003751 Bacteria 122924
18 Ga0055539_1000003 3300003752 Bacteria 663004
19 Ga0055539_1000080 3300003752 Bacteria 122924
20 Ga0055539_1000390 3300003752 Bacteria 17735
21 Ga0055533_1000005 3300003756 Bacteria 663004
22 Ga0055533_1000086 3300003756 Bacteria 122924
23 Ga0055533_1000382 3300003756 Bacteria 17735
24 Ga0055532_1000089 3300003758 Bacteria 105631
25 Ga0055525_1000005 3300003759 Bacteria 663004
26 Ga0055525_1000114 3300003759 Bacteria 122924
27 Ga0055525_1000545 3300003759 Bacteria 17735
28 Ga0055535_1013818 3300003761 Bacteria 1179
29 Ga0055536_1000072 3300003781 Bacteria 91344
30 Ga0055530_10000016 3300003791 Bacteria 146874
31 Ga0055540_1000048 3300003792 Bacteria 146874
32 Ga0055541_1000003 3300003841 Bacteria 663004
33 Ga0055541_1000057 3300003841 Bacteria 122924
34 Ga0055541_1000276 3300003841 Bacteria 17735
35 Ga0065704_10000133 3300005289 Bacteria 53116
36 Ga0065704_10070340 3300005289 Bacteria 31623
37 Ga0065712_10068515 3300005290 Bacteria 10156
38 Ga0065715_10127867 3300005293 Bacteria 2077
39 Ga0065715_10161229 3300005293 Bacteria 1627
40 Ga0070676_10070085 3300005328 Bacteria 2102
41 Ga0070690_100022014 3300005330 Bacteria 3897
42 Ga0070670_100000436 3300005331 Bacteria 34108
43 Ga0070670_100010016 3300005331 Bacteria 8092
44 Ga0070670_100131249 3300005331 Bacteria 2163
45 Ga0070677_10011729 3300005333 Bacteria 3028
46 Ga0070666_10087490 3300005335 Bacteria 2135
47 Ga0070689_100002776 3300005340 Bacteria 11491
48 Ga0070671_100044427 3300005355 Bacteria 3692
49 Ga0070688_100057321 3300005365 Bacteria 2448
50 Ga0070667_100051168 3300005367 Bacteria 3482
51 Ga0070709_10285931 3300005434 Bacteria 1200
52 Ga0070700_100040185 3300005441 Bacteria 2862
53 Ga0070662_100128236 3300005457 Bacteria 1952
54 Ga0070681_10018458 3300005458 Bacteria 6973
55 Ga0070706_100055789 3300005467 Bacteria 3647
56 Ga0070707_100187918 3300005468 Bacteria 2014
57 Ga0070699_100666240 3300005518 Bacteria 950
58 Ga0070672_100029387 3300005543 Bacteria 4121
59 Ga0070665_100166334 3300005548 Bacteria 2207
60 Ga0068855_100000037 3300005563 Bacteria 158161
61 Ga0068855_100032073 3300005563 Bacteria 6272
62 Ga0068854_100006645 3300005578 Bacteria 7368
63 Ga0068856_100027730 3300005614 Bacteria 5525
64 Ga0070702_100022041 3300005615 Bacteria 3362
65 Ga0068852_100002544 3300005616 Bacteria 12561
66 Ga0068870_10157525 3300005840 Bacteria 1343
67 Ga0068858_100054240 3300005842 Bacteria 3707
68 Ga0068860_100139725 3300005843 Bacteria 2327
69 Ga0081455_10000453 3300005937 Bacteria 53921
70 Ga0081455_10026391 3300005937 Bacteria 5343
71 Ga0070717_10060480 3300006028 Bacteria 3137
72 Ga0075434_100122072 3300006871 Bacteria 2621
73 Ga0075434_100332867 3300006871 Bacteria 1539
74 Ga0075434_100995172 3300006871 Bacteria 852
75 Ga0068865_100289272 3300006881 Bacteria 1307
76 Ga0105251_10000016 3300009011 Bacteria 146400
77 Ga0105251_10000119 3300009011 Bacteria 79040
78 Ga0105251_10003359 3300009011 Bacteria 11652
79 Ga0105251_10011487 3300009011 Bacteria 5056
80 Ga0105251_10082218 3300009011 Bacteria 1488
81 Ga0105251_10110851 3300009011 Bacteria 1250
82 Ga0105244_10000190 3300009036 Bacteria 62853
83 Ga0105244_10000216 3300009036 Bacteria 59709
84 Ga0105244_10000425 3300009036 Bacteria 39065
85 Ga0105244_10000450 3300009036 Bacteria 37505
86 Ga0105244_10077183 3300009036 Bacteria 1653
87 Ga0105250_10000003 3300009092 Bacteria 547770
88 Ga0105250_10000265 3300009092 Bacteria 42626
89 Ga0105250_10001281 3300009092 Bacteria 13801
90 Ga0105240_10001596 3300009093 Bacteria 38514
91 Ga0105240_10029133 3300009093 Bacteria 7199
92 Ga0105240_10534087 3300009093 Bacteria 1300
93 Ga0105240_11173564 3300009093 Bacteria 814
94 Ga0111539_10146112 3300009094 Bacteria 2768
95 Ga0105247_10000103 3300009101 Bacteria 90413
96 Ga0105243_10005208 3300009148 Bacteria 10173
97 Ga0105243_10152383 3300009148 Bacteria 1984
98 Ga0105241_10000004 3300009174 Bacteria 803007
99 Ga0105242_10045416 3300009176 Bacteria 3561
100 Ga0105248_10526428 3300009177 Bacteria 1333
101 Ga0105238_10001958 3300009551 Bacteria 20734
102 Ga0105238_10004012 3300009551 Bacteria 14607
103 Ga0105238_10053378 3300009551 Bacteria 4061
104 Ga0105239_10016513 3300010375 Bacteria 8165
105 Ga0105246_10037197 3300011119 Bacteria 3266
106 Ga0157373_10002585 3300013100 Bacteria 13746
107 Ga0157373_10055607 3300013100 Bacteria 2811
108 Ga0157371_10001449 3300013102 Bacteria 24611
109 Ga0157371_10003951 3300013102 Bacteria 13158
110 Ga0157370_10001398 3300013104 Bacteria 29918
111 Ga0157370_10003497 3300013104 Bacteria 18414
112 Ga0157370_10500792 3300013104 Bacteria 1115
113 Ga0157369_10045584 3300013105 Bacteria 4767
114 Ga0157378_10052710 3300013297 Bacteria 3620
115 Ga0157378_10737134 3300013297 Bacteria 1007
116 Ga0163162_10024709 3300013306 Bacteria 5934
117 Ga0157372_10894500 3300013307 Bacteria 1030
118 Ga0163163_10442330 3300014325 Bacteria 1360
119 Ga0157380_10007892 3300014326 Bacteria 7574
120 Ga0182008_10006908 3300014497 Bacteria 6304
121 Ga0182008_10007128 3300014497 Bacteria 6190
122 Ga0182008_10022934 3300014497 Bacteria 3194
123 Ga0182008_10048041 3300014497 Bacteria 2120
124 Ga0157377_10358254 3300014745 Bacteria 981
125 Ga0157379_10029779 3300014968 Bacteria 4854
126 Ga0157376_10670611 3300014969 Bacteria 1039
127 Ga0182006_1002060 3300015261 Bacteria 11273
128 Ga0182006_1021259 3300015261 Bacteria 2708
129 Ga0182006_1023940 3300015261 Bacteria 2525
130 Ga0182006_1046082 3300015261 Bacteria 1695
131 Ga0182007_10000471 3300015262 Bacteria 24311
132 Ga0182007_10003572 3300015262 Bacteria 7315
133 Ga0182007_10004652 3300015262 Bacteria 6195
134 Ga0182007_10026824 3300015262 Bacteria 1992
135 Ga0182005_1000151 3300015265 Bacteria 48745
136 Ga0182005_1000341 3300015265 Bacteria 27029
137 Ga0182005_1018141 3300015265 Bacteria 1945
138 Ga0163161_10000001 3300017792 Bacteria 2041488
139 Ga0213872_10000360 3300021361 Bacteria 38318
140 Ga0213872_10005698 3300021361 Bacteria 6343
141 Ga0213875_10014875 3300021388 Bacteria 3792
142 Ga0209435_100109 3300025206 Bacteria 32283
143 Ga0209435_100890 3300025206 Bacteria 4569
144 Ga0209760_100002 3300025207 Bacteria 274743
145 Ga0209760_101315 3300025207 Bacteria 2696
146 Ga0209784_100001 3300025224 Bacteria 3600592
147 Ga0209784_100010 3300025224 Bacteria 683664
148 Ga0209784_100018 3300025224 Bacteria 456816
149 Ga0209566_100001 3300025225 Bacteria 3600765
150 Ga0209566_100008 3300025225 Bacteria 683664
151 Ga0209566_100016 3300025225 Bacteria 456824
152 Ga0209674_100002 3300025226 Bacteria 3600592
153 Ga0209674_100019 3300025226 Bacteria 683664
154 Ga0209674_100030 3300025226 Bacteria 456824
155 Ga0209147_100060 3300025229 Bacteria 249588
156 Ga0209563_100002 3300025230 Bacteria 2045675
157 Ga0209563_100021 3300025230 Bacteria 683764
158 Ga0209563_100034 3300025230 Bacteria 456824
159 Ga0207427_100009 3300025231 Bacteria 663036
160 Ga0207427_100232 3300025231 Bacteria 46074
161 Ga0209437_100001 3300025233 Bacteria 2045675
162 Ga0209437_100019 3300025233 Bacteria 683764
163 Ga0209437_100081 3300025233 Bacteria 271072
164 Ga0209258_100141 3300025242 Bacteria 166385
165 Ga0209646_1000101 3300025246 Bacteria 164503
166 Ga0209646_1000176 3300025246 Bacteria 81901
167 Ga0209026_1000264 3300025250 Bacteria 64186
168 Ga0209026_1008395 3300025250 Bacteria 2162
169 Ga0209677_100002 3300025253 Bacteria 2045675
170 Ga0209677_100011 3300025253 Bacteria 683664
171 Ga0209677_100019 3300025253 Bacteria 456824
172 Ga0209759_1000264 3300025256 Bacteria 75893
173 Ga0209759_1000296 3300025256 Bacteria 68965
174 Ga0209233_1000025 3300025261 Bacteria 683764
175 Ga0209233_1002373 3300025261 Bacteria 6983
176 Ga0209455_1007786 3300025272 Bacteria 2984
177 Ga0209676_1000020 3300025292 Bacteria 617256
178 Ga0209676_1002238 3300025292 Bacteria 14283
179 Ga0209050_1000013 3300025298 Bacteria 811408
180 Ga0209051_1000007 3300025303 Bacteria 811408
181 Ga0209257_1002079 3300025304 Bacteria 21094
182 Ga0207697_10009917 3300025315 Bacteria 4092
183 Ga0207656_10092937 3300025321 Bacteria 1372
184 Ga0207696_1000001 3300025711 Bacteria 2579611
185 Ga0207696_1000004 3300025711 Bacteria 671626
186 Ga0207696_1000169 3300025711 Bacteria 103182
187 Ga0207655_1000011 3300025728 Bacteria 643321
188 Ga0207655_1000149 3300025728 Bacteria 129937
189 Ga0207655_1001337 3300025728 Bacteria 23216
190 Ga0207655_1002650 3300025728 Bacteria 14127
191 Ga0207655_1037529 3300025728 Bacteria 2133
192 Ga0207713_1000024 3300025735 Bacteria 339156
193 Ga0207713_1000026 3300025735 Bacteria 319032
194 Ga0207713_1000027 3300025735 Bacteria 312621
195 Ga0207713_1000060 3300025735 Bacteria 213145
196 Ga0207713_1002927 3300025735 Bacteria 11951
197 Ga0207713_1034337 3300025735 Bacteria 2204
198 Ga0207713_1075990 3300025735 Bacteria 1223
199 Ga0207642_10002399 3300025899 Bacteria 5833
200 Ga0207710_10000140 3300025900 Bacteria 83223
201 Ga0207688_10047958 3300025901 Bacteria 2386
202 Ga0207645_10005429 3300025907 Bacteria 9243
203 Ga0207643_10054002 3300025908 Bacteria 2283
204 Ga0207684_10134450 3300025910 Bacteria 2123
205 Ga0207654_10000006 3300025911 Bacteria 815027
206 Ga0207695_10000719 3300025913 Bacteria 64361
207 Ga0207695_10003386 3300025913 Bacteria 22534
208 Ga0207695_10038779 3300025913 Bacteria 5124
209 Ga0207695_10814049 3300025913 Bacteria 814
210 Ga0207695_10827877 3300025913 Bacteria 806
211 Ga0207671_10014094 3300025914 Bacteria 6336
212 Ga0207660_10184503 3300025917 Bacteria 1622
213 Ga0207662_10012698 3300025918 Bacteria 4694
214 Ga0207694_10000147 3300025924 Bacteria 72638
215 Ga0207694_10003504 3300025924 Bacteria 12469
216 Ga0207650_10000426 3300025925 Bacteria 37126
217 Ga0207650_10008535 3300025925 Bacteria 6995
218 Ga0207659_10098983 3300025926 Bacteria 2194
219 Ga0207644_10104930 3300025931 Bacteria 2128
220 Ga0207706_10143923 3300025933 Bacteria 2097
221 Ga0207686_10292086 3300025934 Bacteria 1207
222 Ga0207709_10022089 3300025935 Bacteria 3607
223 Ga0207709_10102116 3300025935 Bacteria 1898
224 Ga0207669_10026605 3300025937 Bacteria 3150
225 Ga0207704_10133532 3300025938 Bacteria 1723
226 Ga0207711_10283285 3300025941 Bacteria 1526
227 Ga0207689_10091514 3300025942 Bacteria 2499
228 Ga0207679_10329748 3300025945 Bacteria 1324
229 Ga0207667_10000053 3300025949 Bacteria 226712
230 Ga0207667_10014432 3300025949 Bacteria 9007
231 Ga0207668_10088515 3300025972 Bacteria 2268
232 Ga0207708_10007364 3300026075 Bacteria 8133
233 Ga0207702_10012304 3300026078 Bacteria 7123
234 Ga0207641_10014333 3300026088 Bacteria 6496
235 Ga0207648_10006414 3300026089 Bacteria 11693
236 Ga0207676_10106490 3300026095 Bacteria 2336
237 Ga0207675_100048538 3300026118 Bacteria 3962
238 Ga0207683_10132331 3300026121 Bacteria 2244
239 Ga0207698_10003252 3300026142 Bacteria 9762
240 Ga0207698_10503972 3300026142 Bacteria 1178
241 Ga0209281_1000008 3300027111 Bacteria 867470
242 Ga0209281_1001466 3300027111 Bacteria 13754
243 Ga0209371_1000348 3300027312 Bacteria 50540
244 Ga0307515_10000040 3300028794 Bacteria 322704
245 Ga0307515_10031174 3300028794 Bacteria 8901
246 Ga0268256_1000134 3300030500 Bacteria 102725
247 Ga0265328_10000378 3300031239 Bacteria 20768
248 Ga0265328_10006693 3300031239 Bacteria 4854
249 Ga0265320_10060938 3300031240 Bacteria 1800
250 Ga0265329_10005220 3300031242 Bacteria 5280
251 Ga0265331_10008145 3300031250 Bacteria 5983
252 Ga0265316_10044913 3300031344 Bacteria 3511
253 Ga0265314_10004765 3300031711 Bacteria 12429
254 Ga0307405_10140607 3300031731 Bacteria 1682
255 Ga0307405_10257292 3300031731 Bacteria 1302
256 Ga0307413_10071959 3300031824 Bacteria 2181
257 Ga0307406_10067539 3300031901 Bacteria 2331
258 Ga0307407_10060650 3300031903 Bacteria 2208
259 Ga0307412_10005141 3300031911 Bacteria 7326
260 Ga0307412_10140940 3300031911 Bacteria 1765
261 Ga0307409_100538079 3300031995 Bacteria 1144
262 Ga0307416_100063453 3300032002 Bacteria 3025
263 Ga0307416_100629067 3300032002 Bacteria 1156
264 Ga0307411_10007450 3300032005 Bacteria 5576
265 Ga0307411_10109452 3300032005 Bacteria 1973
266 Ga0436364_0266477 3300037853 Bacteria 1087
267 Ga0436364_0714820 3300037853 Bacteria 4974
268 Ga0436364_1535370 3300037853 Bacteria 953
269 Ga0436365_0916090 3300039437 Bacteria 1114
270 Ga0436361_0376772 3300039447 Bacteria 8066
271 Ga0436361_0409139 3300039447 Bacteria 31464
272 Ga0436361_0659952 3300039447 Bacteria 1671
273 Ga0436363_0254040 3300039450 Bacteria 1198
274 Ga0439438_001380 3300041405 Bacteria 10711
275 Ga0439447_006742 3300041407 Bacteria 3694
276 Ga0439466_0000495 3300041411 Bacteria 14922
277 Ga0439466_0028715 3300041411 Bacteria 1918
278 Ga0439466_0051780 3300041411 Bacteria 1343
279 Ga0439432_014263 3300042006 Bacteria 2691
280 Ga0439451_000047 3300042009 Bacteria 24088
281 Ga0439451_000377 3300042009 Bacteria 8626
282 Ga0439451_002515 3300042009 Bacteria 3725
283 Ga0439452_000043 3300042010 Bacteria 132609
284 Ga0439452_000605 3300042010 Bacteria 18365
285 Ga0439452_001052 3300042010 Bacteria 12186
286 Ga0439456_000335 3300042013 Bacteria 10659
287 Ga0439456_001538 3300042013 Bacteria 4649
288 Ga0439463_000294 3300042016 Bacteria 13843
289 Ga0439463_007569 3300042016 Bacteria 2678
290 Ga0450911_006623 3300042115 Bacteria 1716
291 Ga0450900_000128 3300042136 Bacteria 4434
292 Ga0450902_004091 3300042137 Bacteria 2162
293 Ga0450904_000487 3300042139 Bacteria 7796
294 Ga0450906_000010 3300042145 Bacteria 39195
295 Ga0450907_005684 3300042146 Bacteria 2099
296 Ga0439460_0000060 3300042461 Bacteria 16086
297 Ga0451576_0133593 3300045051 Bacteria 2587
298 Ga0495617_000642 3300046452 Bacteria 17510
299 Ga0495617_041529 3300046452 Bacteria 1537
300 Ga0495627_000018 3300046453 Bacteria 315125
301 Ga0495627_000380 3300046453 Bacteria 40821
302 Ga0495627_005333 3300046453 Bacteria 5204
303 Ga0495627_037220 3300046453 Bacteria 1509
304 Ga0495592_0001072 3300046454 Bacteria 18925
305 Ga0495603_0002989 3300046455 Bacteria 10004
306 Ga0495591_000041 3300046458 Bacteria 155639
307 Ga0495591_000189 3300046458 Bacteria 63919
308 Ga0495591_000234 3300046458 Bacteria 54016
309 Ga0495591_005709 3300046458 Bacteria 5680
310 Ga0495591_016739 3300046458 Bacteria 2539
311 Ga0495591_024088 3300046458 Bacteria 1935
312 Ga0495638_0030846 3300046460 Bacteria 3447
313 Ga0495651_0013562 3300046462 Bacteria 6301
314 Ga0495653_0001089 3300046463 Bacteria 20969
315 Ga0495653_0008898 3300046463 Bacteria 8210
316 Ga0495650_0000018 3300046471 Bacteria 538888
317 Ga0495650_0000034 3300046471 Bacteria 410132
318 Ga0495650_0000309 3300046471 Bacteria 88068
319 Ga0495650_0000780 3300046471 Bacteria 39115
320 Ga0495650_0003367 3300046471 Bacteria 11722
321 Ga0495650_0024507 3300046471 Bacteria 2847
322 Ga0495580_0044817 3300046472 Bacteria 3144
323 Ga0495580_0570184 3300046472 Bacteria 750
324 Ga0495605_0000045 3300046474 Bacteria 176155
325 Ga0495605_0000090 3300046474 Bacteria 116120
326 Ga0495605_0000124 3300046474 Bacteria 101623
327 Ga0495605_0000589 3300046474 Bacteria 29051
328 Ga0495605_0000705 3300046474 Bacteria 24816
329 Ga0495605_0000722 3300046474 Bacteria 24319
330 Ga0495605_0023604 3300046474 Bacteria 3230
331 Ga0495605_0034801 3300046474 Bacteria 2549
332 Ga0495605_0100361 3300046474 Bacteria 1331
333 Ga0495605_0218911 3300046474 Bacteria 823
334 Ga0495584_0002628 3300046491 Bacteria 10131
335 Ga0495584_0008800 3300046491 Bacteria 5220
336 Ga0495584_0009488 3300046491 Bacteria 5010
337 Ga0495585_0001433 3300046492 Bacteria 18714
338 Ga0495585_0002260 3300046492 Bacteria 13931
339 Ga0495594_0000711 3300046499 Bacteria 17137
340 Ga0495596_0013213 3300046500 Bacteria 3509
341 Ga0495596_0068391 3300046500 Bacteria 1380
342 Ga0495607_0000070 3300046501 Bacteria 100876
343 Ga0495607_0000106 3300046501 Bacteria 88081
344 Ga0495607_0000284 3300046501 Bacteria 54384
345 Ga0495607_0000369 3300046501 Bacteria 46319
346 Ga0495607_0005884 3300046501 Bacteria 8710
347 Ga0495607_0006909 3300046501 Bacteria 7912
348 Ga0495607_0012639 3300046501 Bacteria 5563
349 Ga0495607_0021888 3300046501 Bacteria 4020
350 Ga0495607_0081953 3300046501 Bacteria 1771
351 Ga0495607_0083646 3300046501 Bacteria 1747
352 Ga0495583_0000101 3300046506 Bacteria 144916
353 Ga0495583_0000765 3300046506 Bacteria 40365
354 Ga0495583_0001353 3300046506 Bacteria 25396
355 Ga0495583_0002114 3300046506 Bacteria 17839
356 Ga0495583_0002459 3300046506 Bacteria 15815
357 Ga0495583_0056234 3300046506 Bacteria 1775
358 Ga0495606_0000042 3300046507 Bacteria 215099
359 Ga0495606_0000081 3300046507 Bacteria 160491
360 Ga0495606_0000098 3300046507 Bacteria 151131
361 Ga0495606_0000410 3300046507 Bacteria 72184
362 Ga0495606_0000529 3300046507 Bacteria 61769
363 Ga0495606_0001296 3300046507 Bacteria 34490
364 Ga0495606_0003477 3300046507 Bacteria 16691
365 Ga0495606_0063602 3300046507 Bacteria 2352
366 Ga0495606_0097138 3300046507 Bacteria 1801
367 Ga0495608_0001962 3300046511 Bacteria 14737
368 Ga0495610_0012980 3300046512 Bacteria 4977
369 Ga0495616_0046339 3300046513 Bacteria 2195
370 Ga0495618_0003306 3300046514 Bacteria 10083
371 Ga0495620_0000001 3300046515 Bacteria 386508
372 Ga0495620_0001049 3300046515 Bacteria 16939
373 Ga0495620_0001966 3300046515 Bacteria 12033
374 Ga0495620_0049954 3300046515 Bacteria 1786
375 Ga0495628_0001529 3300046516 Bacteria 21206
376 Ga0495631_0001230 3300046518 Bacteria 15793
377 Ga0495631_0001306 3300046518 Bacteria 15273
378 Ga0495631_0005658 3300046518 Bacteria 6519
379 Ga0495631_0009509 3300046518 Bacteria 4854
380 Ga0495631_0032501 3300046518 Bacteria 2352
381 Ga0495631_0094113 3300046518 Bacteria 1290
382 Ga0495632_0002280 3300046519 Bacteria 14783
383 Ga0495632_0016439 3300046519 Bacteria 4116
384 Ga0495632_0041865 3300046519 Bacteria 2299
385 Ga0495632_0055118 3300046519 Bacteria 1946
386 Ga0495637_0000023 3300046520 Bacteria 172407
387 Ga0495637_0000486 3300046520 Bacteria 28876
388 Ga0495637_0001685 3300046520 Bacteria 12767
389 Ga0495637_0005119 3300046520 Bacteria 6725
390 Ga0495637_0014831 3300046520 Bacteria 3671
391 Ga0495637_0055348 3300046520 Bacteria 1645
392 Ga0495637_0067755 3300046520 Bacteria 1448
393 Ga0495643_0000721 3300046522 Bacteria 37800
394 Ga0495643_0019767 3300046522 Bacteria 3894
395 Ga0495643_0058000 3300046522 Bacteria 2061
396 Ga0495643_0092214 3300046522 Bacteria 1561
397 Ga0495644_0000910 3300046523 Bacteria 12254
398 Ga0495644_0002392 3300046523 Bacteria 7489
399 Ga0495648_0003650 3300046524 Bacteria 13464
400 Ga0495648_0004913 3300046524 Bacteria 11245
401 Ga0495648_0010650 3300046524 Bacteria 6987
402 Ga0495666_0035332 3300046526 Bacteria 2437
403 Ga0495652_0007377 3300046529 Bacteria 10136
404 Ga0495654_0000179 3300046530 Bacteria 62287
405 Ga0495654_0002585 3300046530 Bacteria 11561
406 Ga0495654_0004579 3300046530 Bacteria 8167
407 Ga0495654_0007597 3300046530 Bacteria 6041
408 Ga0495654_0010116 3300046530 Bacteria 5145
409 Ga0495654_0049717 3300046530 Bacteria 2052
410 Ga0495654_0059994 3300046530 Bacteria 1829
411 Ga0495609_0000011 3300046538 Bacteria 334377
412 Ga0495609_0000012 3300046538 Bacteria 333994
413 Ga0495609_0000145 3300046538 Bacteria 73765
414 Ga0495609_0004096 3300046538 Bacteria 8110
415 Ga0495609_0006406 3300046538 Bacteria 6009
416 Ga0495597_0000004 3300046542 Bacteria 307496
417 Ga0495597_0003740 3300046542 Bacteria 8677
418 Ga0495645_0108653 3300046543 Bacteria 1964
419 Ga0495645_0130468 3300046543 Bacteria 1762
420 Ga0495622_0004276 3300046557 Bacteria 6646
421 Ga0495622_0072380 3300046557 Bacteria 1590
422 Ga0495622_0114117 3300046557 Bacteria 1236
423 Ga0495633_0000016 3300046558 Bacteria 250457
424 Ga0495633_0000367 3300046558 Bacteria 48597
425 Ga0495633_0009020 3300046558 Bacteria 5548
426 Ga0495667_0379601 3300046559 Bacteria 891
427 Ga0495668_0050878 3300046616 Bacteria 2295
428 Ga0495668_0082153 3300046616 Bacteria 1767
429 Ga0495634_0077027 3300046642 Bacteria 2188
430 Ga0495611_0001082 3300046648 Bacteria 14368
431 Ga0495611_0001380 3300046648 Bacteria 12184
432 Ga0495611_0055885 3300046648 Bacteria 1786
433 Ga0495625_0000010 3300046660 Bacteria 381775
434 Ga0495625_0000108 3300046660 Bacteria 125604
435 Ga0495635_0032032 3300046663 Bacteria 3649
436 Ga0495661_0000004 3300046665 Bacteria 555340
437 Ga0495661_0000010 3300046665 Bacteria 284261
438 Ga0495661_0000018 3300046665 Bacteria 200787
439 Ga0495661_0000020 3300046665 Bacteria 196901
440 Ga0495661_0088125 3300046665 Bacteria 1772
441 Ga0495661_0126149 3300046665 Bacteria 1408
442 Ga0495661_0195530 3300046665 Bacteria 1062
443 Ga0495661_0197514 3300046665 Bacteria 1055
444 Ga0495657_0025488 3300046675 Bacteria 4198
445 Ga0495599_0012638 3300046678 Bacteria 5206
446 Ga0495623_0006756 3300046679 Bacteria 7466
447 Ga0495646_0001802 3300046680 Bacteria 12853
448 Ga0495658_0014570 3300046683 Bacteria 4021
449 Ga0495624_0010937 3300046690 Bacteria 6254
450 Ga0495670_0012175 3300046691 Bacteria 4230
451 Ga0495671_0001070 3300046692 Bacteria 18925
452 Ga0495671_0001369 3300046692 Bacteria 16544
453 Ga0495671_0007179 3300046692 Bacteria 6374
454 Ga0495671_0044115 3300046692 Bacteria 2236
455 Ga0495649_0000027 3300046694 Bacteria 164157
456 Ga0495649_0000083 3300046694 Bacteria 81883
457 Ga0495649_0019663 3300046694 Bacteria 3793
458 Ga0495649_0040948 3300046694 Bacteria 2534
459 Ga0495589_0000002 3300046794 Bacteria 758846
460 Ga0495589_0001428 3300046794 Bacteria 13797
461 Ga0495600_0005526 3300046809 Bacteria 7626
462 Ga0495660_0000004 3300046810 Bacteria 1003183
463 Ga0495660_0000020 3300046810 Bacteria 304768
464 Ga0495660_0000454 3300046810 Bacteria 34113
465 Ga0495660_0000637 3300046810 Bacteria 27250
466 Ga0495660_0007375 3300046810 Bacteria 6458
467 Ga0495660_0031802 3300046810 Bacteria 2965
468 Ga0495660_0087172 3300046810 Bacteria 1628
469 Ga0495604_0013783 3300047317 Bacteria 6445
470 Ga0495604_0034528 3300047317 Bacteria 4000
471 Ga0495672_0000011 3300047320 Bacteria 535362
472 Ga0495672_0003150 3300047320 Bacteria 14359
473 Ga0495672_0007746 3300047320 Bacteria 8038
474 Ga0495672_0016420 3300047320 Bacteria 4989
475 Ga0495672_0036521 3300047320 Bacteria 3016
476 Ga0495672_0061562 3300047320 Bacteria 2163
477 Ga0495672_0069236 3300047320 Bacteria 2004
478 Ga0495672_0111424 3300047320 Bacteria 1468
479 Ga0495676_0000002 3300047321 Bacteria 373918
480 Ga0495683_0000019 3300047323 Bacteria 183206
481 Ga0495683_0000063 3300047323 Bacteria 113542
482 Ga0495683_0000416 3300047323 Bacteria 34093
483 Ga0495683_0042954 3300047323 Bacteria 2277
484 Ga0495683_0092068 3300047323 Bacteria 1467
485 Ga0495687_000579 3300047443 Bacteria 42952
486 Ga0495679_000165 3300047446 Bacteria 59805
487 Ga0495679_000322 3300047446 Bacteria 38037
488 Ga0495673_0000020 3300047469 Bacteria 548327
489 Ga0495673_0000183 3300047469 Bacteria 101083
490 Ga0495673_0000758 3300047469 Bacteria 30622
491 Ga0495673_0001862 3300047469 Bacteria 15831
492 Ga0495673_0004738 3300047469 Bacteria 8437
493 Ga0495673_0010447 3300047469 Bacteria 5047
494 Ga0495673_0014825 3300047469 Bacteria 4039
495 Ga0495673_0019900 3300047469 Bacteria 3353
496 Ga0495673_0022461 3300047469 Bacteria 3091
497 Ga0495673_0055276 3300047469 Bacteria 1722
498 Ga0495673_0062263 3300047469 Bacteria 1594
499 Ga0495673_0089134 3300047469 Bacteria 1263
500 Ga0495681_0000538 3300047470 Bacteria 29051
501 Ga0495681_0001151 3300047470 Bacteria 20032
502 Ga0495681_0050837 3300047470 Bacteria 1951
503 Ga0495686_0055630 3300047472 Bacteria 2473
504 Ga0495686_0142909 3300047472 Bacteria 1411
505 Ga0495602_0025284 3300048088 Bacteria 5747
506 Ga0495626_0000007 3300048091 Bacteria 276374
507 Ga0495626_0000897 3300048091 Bacteria 26379
508 Ga0495626_0039485 3300048091 Bacteria 2234
509 Ga0496102_0782102 3300048905 Bacteria 877
510 Ga0496104_0001712 3300048907 Bacteria 18944
511 Ga0496110_0052219 3300048913 Bacteria 3593
512 Ga0496111_0388315 3300048914 Bacteria 1032
513 Ga0496113_0333225 3300048916 Bacteria 1217
514 Ga0496116_0000023 3300048919 Bacteria 475792
515 Ga0496116_0000083 3300048919 Bacteria 220955
516 Ga0496116_0026142 3300048919 Bacteria 4275
517 Ga0496117_0000463 3300048920 Bacteria 67832
518 Ga0496117_0003404 3300048920 Bacteria 18517
519 Ga0496117_0010690 3300048920 Bacteria 8307
520 Ga0496117_0061188 3300048920 Bacteria 2590
521 Ga0496117_0068768 3300048920 Bacteria 2389
522 Ga0496117_0165761 3300048920 Bacteria 1289
523 Ga0496118_0001450 3300048921 Bacteria 35711
524 Ga0496118_0008485 3300048921 Bacteria 10608
525 Ga0496118_0065412 3300048921 Bacteria 2661
526 Ga0496118_0129287 3300048921 Bacteria 1626
527 Ga0496119_0006664 3300048922 Bacteria 10622
528 Ga0496119_0007198 3300048922 Bacteria 10077
529 Ga0496119_0010183 3300048922 Bacteria 7938
530 Ga0496119_0108605 3300048922 Bacteria 1544
531 Ga0496120_0000052 3300048923 Bacteria 186071
532 Ga0496120_0001403 3300048923 Bacteria 29166
533 Ga0496120_0006927 3300048923 Bacteria 8551
534 Ga0496120_0063720 3300048923 Bacteria 2050
535 Ga0496121_0000824 3300048924 Bacteria 56559
536 Ga0496121_0003602 3300048924 Bacteria 21867
537 Ga0496121_0116803 3300048924 Bacteria 2023
538 Ga0496122_0000135 3300048925 Bacteria 170955
539 Ga0496122_0000146 3300048925 Bacteria 165614
540 Ga0496122_0000167 3300048925 Bacteria 157130
541 Ga0496122_0004158 3300048925 Bacteria 18262
542 Ga0496122_0107291 3300048925 Bacteria 1846
543 Ga0496123_0000004 3300048926 Bacteria 777230
544 Ga0496123_0000127 3300048926 Bacteria 154927
545 Ga0496123_0000475 3300048926 Bacteria 69749
546 Ga0496123_0003312 3300048926 Bacteria 18247
547 Ga0496123_0055389 3300048926 Bacteria 2602
548 Ga0496124_0000017 3300048927 Bacteria 444389
549 Ga0496124_0000140 3300048927 Bacteria 149743
550 Ga0496124_0000292 3300048927 Bacteria 94018
551 Ga0496124_0001314 3300048927 Bacteria 37530
552 Ga0496124_0010375 3300048927 Bacteria 9441
553 Ga0496124_0012407 3300048927 Bacteria 8414
554 Ga0496124_0163452 3300048927 Bacteria 1733
555 Ga0496125_0000131 3300048928 Bacteria 162607
556 Ga0496125_0000195 3300048928 Bacteria 129495
557 Ga0496125_0000896 3300048928 Bacteria 47203
558 Ga0496125_0021687 3300048928 Bacteria 5980
559 Ga0496125_0099143 3300048928 Bacteria 2153
560 Ga0496126_0000300 3300048929 Bacteria 105128
561 Ga0496126_0001270 3300048929 Bacteria 40566
562 Ga0495678_000036 3300049459 Bacteria 198018
563 Ga0495678_000120 3300049459 Bacteria 91473
564 Ga0495678_001857 3300049459 Bacteria 15449
565 Ga0495678_002399 3300049459 Bacteria 12794
566 Ga0495678_005571 3300049459 Bacteria 6899
567 Ga0495678_044875 3300049459 Bacteria 1746
568 Ga0495678_061852 3300049459 Bacteria 1403
569 Ga0495682_0000005 3300049460 Bacteria 360387
570 Ga0495682_0000241 3300049460 Bacteria 43383
571 Ga0495682_0001417 3300049460 Bacteria 13008
572 Ga0495682_0003494 3300049460 Bacteria 6983
573 Ga0501039_0500586 3300049575 Bacteria 954
574 Ga0501035_0604652 3300049822 Bacteria 893
575 nmdc:mga00v17_83208_c1 3300050491 Bacteria 2001
576 nmdc:mga0n895_311442_c1 3300050512 Bacteria 1595
577 nmdc:mga0n895_878473_c1 3300050512 Bacteria 883
578 Ga0495601_0009822 3300053077 Bacteria 5662
579 Ga0500555_003816 3300053103 Bacteria 4290
580 Ga0500618_001248 3300053125 Bacteria 11889
581 Ga0500621_000017 3300053126 Bacteria 87111
582 Ga0500574_003638 3300053141 Bacteria 2760
583 Ga0500616_0074678 3300053153 Bacteria 1718
584 Ga0500636_0008414 3300053177 Bacteria 5983

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046472 Ga0495580_0570184 Ga0495580_0570184_73_720 215
2 3300047469 Ga0495673_0055276 Ga0495673_0055276_36_689 217
3 3300006871 Ga0075434_100995172 Ga0075434_1009951721 228
4 3300050512 nmdc:mga0n895_878473_c1 nmdc:mga0n895_878473_c1_32_790 228
5 3300003791 Ga0055530_10000016 Ga0055530_1000001668 235
6 3300003792 Ga0055540_1000048 Ga0055540_100004868 235
7 3300025292 Ga0209676_1002238 Ga0209676_100223810 235
8 3300025298 Ga0209050_1000013 Ga0209050_1000013177 235
9 3300025303 Ga0209051_1000007 Ga0209051_1000007177 235
10 3300025304 Ga0209257_1002079 Ga0209257_10020797 235
11 3300050512 nmdc:mga0n895_311442_c1 nmdc:mga0n895_311442_c1_600_1325 241
12 3300049575 Ga0501039_0500586 Ga0501039_0500586_71_799 242
13 3300053177 Ga0500636_0008414 Ga0500636_0008414_1334_2068 244
14 iso_pu_bacteria 8002060224 8002060801 244
15 3300028794 Ga0307515_10000040 Ga0307515_10000040206 245
16 3300002737 JGI25162J39368_1000079 JGI25162J39368_100007948 247
17 3300003214 JGI25165J46597_1000135 JGI25165J46597_100013554 247
18 3300003751 Ga0055538_1000055 Ga0055538_100005554 247
19 3300003752 Ga0055539_1000080 Ga0055539_100008050 247
20 3300003756 Ga0055533_1000086 Ga0055533_100008650 247
21 3300003759 Ga0055525_1000114 Ga0055525_100011454 247
22 3300003841 Ga0055541_1000057 Ga0055541_100005750 247
23 3300006028 Ga0070717_10060480 Ga0070717_100604804 247
24 3300015265 Ga0182005_1000151 Ga0182005_100015126 247
25 3300025207 Ga0209760_101315 Ga0209760_1013153 247
26 3300025224 Ga0209784_100010 Ga0209784_100010117 247
27 3300025225 Ga0209566_100008 Ga0209566_100008117 247
28 3300025226 Ga0209674_100019 Ga0209674_100019117 247
29 3300025230 Ga0209563_100021 Ga0209563_100021117 247
30 3300025231 Ga0207427_100232 Ga0207427_10023225 247
31 3300025233 Ga0209437_100019 Ga0209437_100019117 247
32 3300025253 Ga0209677_100011 Ga0209677_100011117 247
33 3300025261 Ga0209233_1000025 Ga0209233_1000025117 247
34 3300037853 Ga0436364_0266477 Ga0436364_0266477_292_1053 247
35 3300046454 Ga0495592_0001072 Ga0495592_0001072_5917_6675 247
36 3300046462 Ga0495651_0013562 Ga0495651_0013562_1615_2373 247
37 3300046463 Ga0495653_0008898 Ga0495653_0008898_1247_2005 247
38 3300046507 Ga0495606_0000410 Ga0495606_0000410_57154_57915 247
39 3300046507 Ga0495606_0001296 Ga0495606_0001296_2935_3678 247
40 3300046511 Ga0495608_0001962 Ga0495608_0001962_11668_12426 247
41 3300046514 Ga0495618_0003306 Ga0495618_0003306_4682_5440 247
42 3300046516 Ga0495628_0001529 Ga0495628_0001529_7938_8696 247
43 3300046529 Ga0495652_0007377 Ga0495652_0007377_329_1087 247
44 3300046543 Ga0495645_0108653 Ga0495645_0108653_1134_1892 247
45 3300046642 Ga0495634_0077027 Ga0495634_0077027_1002_1760 247
46 3300046663 Ga0495635_0032032 Ga0495635_0032032_1875_2633 247
47 3300046675 Ga0495657_0025488 Ga0495657_0025488_3335_4093 247
48 3300046678 Ga0495599_0012638 Ga0495599_0012638_74_832 247
49 3300046679 Ga0495623_0006756 Ga0495623_0006756_1777_2535 247
50 3300046680 Ga0495646_0001802 Ga0495646_0001802_10167_10925 247
51 3300046690 Ga0495624_0010937 Ga0495624_0010937_2731_3489 247
52 3300046809 Ga0495600_0005526 Ga0495600_0005526_4970_5728 247
53 3300047317 Ga0495604_0013783 Ga0495604_0013783_2964_3722 247
54 3300048088 Ga0495602_0025284 Ga0495602_0025284_2445_3203 247
55 3300053077 Ga0495601_0009822 Ga0495601_0009822_1569_2327 247
56 3300053103 Ga0500555_003816 Ga0500555_003816_3097_3840 247
57 3300053141 Ga0500574_003638 Ga0500574_003638_119_877 247
58 iso_pu_bacteria 2738541281 2738744476 247
59 iso_pu_bacteria 2738543032 2739353706 247
60 iso_pu_bacteria 2773857672 2774131990 247
61 iso_pu_bacteria 2818991436 2819541971 247
62 iso_pu_bacteria 2842698319 2842700068 247
63 iso_pu_bacteria 2919125081 2919128711 247
64 iso_pu_bacteria 2984499530 2984503523 247
65 3300009094 Ga0111539_10146112 Ga0111539_101461122 248
66 3300009148 Ga0105243_10005208 Ga0105243_100052082 248
67 3300009176 Ga0105242_10045416 Ga0105242_100454161 248
68 3300009177 Ga0105248_10526428 Ga0105248_105264282 248
69 3300013297 Ga0157378_10052710 Ga0157378_100527104 248
70 3300014326 Ga0157380_10007892 Ga0157380_100078923 248
71 3300014968 Ga0157379_10029779 Ga0157379_100297792 248
72 3300014969 Ga0157376_10670611 Ga0157376_106706112 248
73 3300021388 Ga0213875_10014875 Ga0213875_100148758 248
74 3300046471 Ga0495650_0000018 Ga0495650_0000018_218774_219538 248
75 3300005937 Ga0081455_10000453 Ga0081455_1000045341 249
76 3300005937 Ga0081455_10026391 Ga0081455_100263914 249
77 3300021361 Ga0213872_10005698 Ga0213872_100056984 249
78 3300028794 Ga0307515_10031174 Ga0307515_100311748 249
79 3300037853 Ga0436364_0714820 Ga0436364_0714820_2512_3267 249
80 3300039437 Ga0436365_0916090 Ga0436365_0916090_189_947 249
81 3300039447 Ga0436361_0376772 Ga0436361_0376772_4660_5421 249
82 3300039447 Ga0436361_0659952 Ga0436361_0659952_18_779 249
83 3300039450 Ga0436363_0254040 Ga0436363_0254040_345_1103 249
84 3300046507 Ga0495606_0063602 Ga0495606_0063602_720_1478 249
85 3300046522 Ga0495643_0019767 Ga0495643_0019767_1861_2619 249
86 3300005563 Ga0068855_100032073 Ga0068855_1000320732 250
87 3300006871 Ga0075434_100122072 Ga0075434_1001220722 250
88 3300025949 Ga0207667_10014432 Ga0207667_1001443210 250
89 3300037853 Ga0436364_1535370 Ga0436364_1535370_148_909 250
90 3300046660 Ga0495625_0000108 Ga0495625_0000108_78937_79737 250
91 3300049822 Ga0501035_0604652 Ga0501035_0604652_16_777 250
92 iso_pu_bacteria 2506520007 2506577533 250
93 iso_pu_bacteria 2506520008 2506582671 250
94 iso_pu_bacteria 2554235234 2555261202 250
95 iso_pu_bacteria 2585427591 2585829745 250
96 iso_pu_bacteria 2585427592 2585835247 250
97 iso_pu_bacteria 2654587920 2656277421 250
98 iso_pu_bacteria 2654587920 2656279128 250
99 iso_pu_bacteria 2667528173 2671106985 250
100 iso_pu_bacteria 2687453601 2689444012 250
101 iso_pu_bacteria 2738543015 2739261439 250
102 iso_pu_bacteria 2806310673 2807179568 250
103 iso_pu_bacteria 2869551831 2869553387 250
104 iso_pu_bacteria 2888366609 2888368061 250
105 iso_pu_bacteria 2904474040 2904475910 250
106 iso_pu_bacteria 2904504865 2904505349 250
107 iso_pu_bacteria 2919108558 2919111346 250
108 iso_pu_bacteria 2919150387 2919152079 250
109 iso_pu_bacteria 2927143783 2927144748 250
110 iso_pu_bacteria 2971820967 2971822809 250
111 iso_pu_bacteria 640753048 640937027 250
112 iso_pu_bacteria 8015394850 8015394875 250
113 3300002704 JGI25155J39150_1000511 JGI25155J39150_10005115 251
114 3300002705 JGI25156J39149_1000320 JGI25156J39149_100032017 251
115 3300002705 JGI25156J39149_1009833 JGI25156J39149_10098331 251
116 3300002738 JGI25154J39366_1000264 JGI25154J39366_100026418 251
117 3300002738 JGI25154J39366_1000967 JGI25154J39366_100096710 251
118 3300002741 JGI25157J39369_1001592 JGI25157J39369_10015925 251
119 3300003752 Ga0055539_1000390 Ga0055539_10003905 251
120 3300003756 Ga0055533_1000382 Ga0055533_10003825 251
121 3300003758 Ga0055532_1000089 Ga0055532_100008940 251
122 3300003759 Ga0055525_1000545 Ga0055525_10005455 251
123 3300003761 Ga0055535_1013818 Ga0055535_10138182 251
124 3300003841 Ga0055541_1000276 Ga0055541_10002765 251
125 3300005331 Ga0070670_100010016 Ga0070670_1000100167 251
126 3300005563 Ga0068855_100000037 Ga0068855_10000003791 251
127 3300005578 Ga0068854_100006645 Ga0068854_1000066458 251
128 3300005614 Ga0068856_100027730 Ga0068856_1000277302 251
129 3300005616 Ga0068852_100002544 Ga0068852_1000025448 251
130 3300009011 Ga0105251_10082218 Ga0105251_100822182 251
131 3300009036 Ga0105244_10077183 Ga0105244_100771831 251
132 3300009093 Ga0105240_10001596 Ga0105240_1000159622 251
133 3300009551 Ga0105238_10001958 Ga0105238_1000195813 251
134 3300009551 Ga0105238_10053378 Ga0105238_100533782 251
135 3300010375 Ga0105239_10016513 Ga0105239_100165133 251
136 3300013102 Ga0157371_10003951 Ga0157371_100039516 251
137 3300013105 Ga0157369_10045584 Ga0157369_100455845 251
138 3300013307 Ga0157372_10894500 Ga0157372_108945001 251
139 3300014497 Ga0182008_10048041 Ga0182008_100480411 251
140 3300015261 Ga0182006_1002060 Ga0182006_10020608 251
141 3300015261 Ga0182006_1023940 Ga0182006_10239403 251
142 3300015262 Ga0182007_10004652 Ga0182007_100046522 251
143 3300021361 Ga0213872_10000360 Ga0213872_1000036018 251
144 3300025206 Ga0209435_100109 Ga0209435_10010919 251
145 3300025206 Ga0209435_100890 Ga0209435_1008903 251
146 3300025224 Ga0209784_100018 Ga0209784_100018345 251
147 3300025225 Ga0209566_100016 Ga0209566_100016345 251
148 3300025226 Ga0209674_100030 Ga0209674_100030345 251
149 3300025229 Ga0209147_100060 Ga0209147_100060103 251
150 3300025230 Ga0209563_100034 Ga0209563_100034345 251
151 3300025233 Ga0209437_100081 Ga0209437_10008141 251
152 3300025242 Ga0209258_100141 Ga0209258_100141133 251
153 3300025246 Ga0209646_1000101 Ga0209646_100010193 251
154 3300025246 Ga0209646_1000176 Ga0209646_100017620 251
155 3300025250 Ga0209026_1000264 Ga0209026_100026462 251
156 3300025250 Ga0209026_1008395 Ga0209026_10083952 251
157 3300025253 Ga0209677_100019 Ga0209677_100019345 251
158 3300025256 Ga0209759_1000264 Ga0209759_100026419 251
159 3300025256 Ga0209759_1000296 Ga0209759_100029642 251
160 3300025272 Ga0209455_1007786 Ga0209455_10077863 251
161 3300025321 Ga0207656_10092937 Ga0207656_100929372 251
162 3300025735 Ga0207713_1034337 Ga0207713_10343371 251
163 3300025735 Ga0207713_1075990 Ga0207713_10759902 251
164 3300025913 Ga0207695_10000719 Ga0207695_1000071932 251
165 3300025913 Ga0207695_10003386 Ga0207695_1000338618 251
166 3300025914 Ga0207671_10014094 Ga0207671_100140942 251
167 3300025924 Ga0207694_10000147 Ga0207694_1000014751 251
168 3300025925 Ga0207650_10008535 Ga0207650_100085353 251
169 3300025949 Ga0207667_10000053 Ga0207667_1000005397 251
170 3300026078 Ga0207702_10012304 Ga0207702_100123045 251
171 3300026142 Ga0207698_10003252 Ga0207698_100032529 251
172 3300039447 Ga0436361_0409139 Ga0436361_0409139_11042_11818 251
173 3300046471 Ga0495650_0000034 Ga0495650_0000034_295051_295806 251
174 3300046474 Ga0495605_0100361 Ga0495605_0100361_424_1179 251
175 3300046507 Ga0495606_0000529 Ga0495606_0000529_53133_53888 251
176 3300046520 Ga0495637_0067755 Ga0495637_0067755_357_1112 251
177 3300046523 Ga0495644_0000910 Ga0495644_0000910_4616_5371 251
178 3300046524 Ga0495648_0003650 Ga0495648_0003650_4394_5149 251
179 3300046530 Ga0495654_0002585 Ga0495654_0002585_10578_11333 251
180 3300046530 Ga0495654_0059994 Ga0495654_0059994_347_1102 251
181 3300046559 Ga0495667_0379601 Ga0495667_0379601_115_879 251
182 3300046694 Ga0495649_0019663 Ga0495649_0019663_2126_2881 251
183 3300046810 Ga0495660_0000020 Ga0495660_0000020_28760_29515 251
184 3300047320 Ga0495672_0000011 Ga0495672_0000011_321741_322496 251
185 3300047323 Ga0495683_0042954 Ga0495683_0042954_822_1577 251
186 3300047469 Ga0495673_0000020 Ga0495673_0000020_306953_307708 251
187 3300047469 Ga0495673_0089134 Ga0495673_0089134_141_896 251
188 3300048919 Ga0496116_0026142 Ga0496116_0026142_3452_4240 251
189 3300048925 Ga0496122_0000146 Ga0496122_0000146_60738_61526 251
190 3300048926 Ga0496123_0000475 Ga0496123_0000475_8224_9012 251
191 3300048928 Ga0496125_0000896 Ga0496125_0000896_13098_13886 251
192 3300048928 Ga0496125_0099143 Ga0496125_0099143_581_1369 251
193 3300049459 Ga0495678_002399 Ga0495678_002399_4210_4965 251
194 3300049460 Ga0495682_0000005 Ga0495682_0000005_234999_235754 251
195 3300053126 Ga0500621_000017 Ga0500621_000017_7016_7771 251
196 iso_pu_bacteria 2511231003 2511252247 251
197 iso_pu_bacteria 2551306416 2553005414 251
198 iso_pu_bacteria 2765235838 2765568344 251
199 iso_pu_bacteria 2818991445 2819594450 251
200 iso_pu_bacteria 2818991449 2819617780 251
201 iso_pu_bacteria 2839094727 2839094766 251
202 iso_pu_bacteria 2842854478 2842858544 251
203 iso_pu_bacteria 2852612431 2852614606 251
204 iso_pu_bacteria 2852667396 2852667656 251
205 iso_pu_bacteria 2884811622 2884814170 251
206 iso_pu_bacteria 2884836552 2884840874 251
207 iso_pu_bacteria 2884852848 2884857530 251
208 iso_pu_bacteria 2896154374 2896158470 251
209 iso_pu_bacteria 2904439833 2904440039 251
210 iso_pu_bacteria 2904530477 2904531010 251
211 iso_pu_bacteria 2904584206 2904587344 251
212 iso_pu_bacteria 2904589729 2904592621 251
213 iso_pu_bacteria 2904601388 2904604597 251
214 iso_pu_bacteria 2919046199 2919047263 251
215 iso_pu_bacteria 2919079590 2919082418 251
216 iso_pu_bacteria 2923510766 2923515894 251
217 iso_pu_bacteria 2928130867 2928133341 251
218 3300005293 Ga0065715_10161229 Ga0065715_101612292 252
219 3300005328 Ga0070676_10070085 Ga0070676_100700852 252
220 3300005330 Ga0070690_100022014 Ga0070690_1000220143 252
221 3300005331 Ga0070670_100131249 Ga0070670_1001312492 252
222 3300005333 Ga0070677_10011729 Ga0070677_100117292 252
223 3300005335 Ga0070666_10087490 Ga0070666_100874902 252
224 3300005340 Ga0070689_100002776 Ga0070689_1000027766 252
225 3300005355 Ga0070671_100044427 Ga0070671_1000444272 252
226 3300005365 Ga0070688_100057321 Ga0070688_1000573213 252
227 3300005367 Ga0070667_100051168 Ga0070667_1000511682 252
228 3300005434 Ga0070709_10285931 Ga0070709_102859312 252
229 3300005441 Ga0070700_100040185 Ga0070700_1000401852 252
230 3300005457 Ga0070662_100128236 Ga0070662_1001282362 252
231 3300005458 Ga0070681_10018458 Ga0070681_100184586 252
232 3300005467 Ga0070706_100055789 Ga0070706_1000557894 252
233 3300005468 Ga0070707_100187918 Ga0070707_1001879181 252
234 3300005518 Ga0070699_100666240 Ga0070699_1006662402 252
235 3300005543 Ga0070672_100029387 Ga0070672_1000293874 252
236 3300005548 Ga0070665_100166334 Ga0070665_1001663343 252
237 3300005615 Ga0070702_100022041 Ga0070702_1000220412 252
238 3300005840 Ga0068870_10157525 Ga0068870_101575252 252
239 3300005842 Ga0068858_100054240 Ga0068858_1000542402 252
240 3300005843 Ga0068860_100139725 Ga0068860_1001397252 252
241 3300006871 Ga0075434_100332867 Ga0075434_1003328672 252
242 3300006881 Ga0068865_100289272 Ga0068865_1002892722 252
243 3300009093 Ga0105240_10029133 Ga0105240_100291333 252
244 3300009093 Ga0105240_10534087 Ga0105240_105340872 252
245 3300009093 Ga0105240_11173564 Ga0105240_111735641 252
246 3300009551 Ga0105238_10004012 Ga0105238_100040125 252
247 3300013297 Ga0157378_10737134 Ga0157378_107371342 252
248 3300014325 Ga0163163_10442330 Ga0163163_104423302 252
249 3300014745 Ga0157377_10358254 Ga0157377_103582542 252
250 3300025315 Ga0207697_10009917 Ga0207697_100099173 252
251 3300025899 Ga0207642_10002399 Ga0207642_100023994 252
252 3300025901 Ga0207688_10047958 Ga0207688_100479582 252
253 3300025907 Ga0207645_10005429 Ga0207645_100054293 252
254 3300025908 Ga0207643_10054002 Ga0207643_100540023 252
255 3300025910 Ga0207684_10134450 Ga0207684_101344503 252
256 3300025913 Ga0207695_10038779 Ga0207695_100387795 252
257 3300025913 Ga0207695_10814049 Ga0207695_108140491 252
258 3300025913 Ga0207695_10827877 Ga0207695_108278771 252
259 3300025917 Ga0207660_10184503 Ga0207660_101845032 252
260 3300025918 Ga0207662_10012698 Ga0207662_100126984 252
261 3300025924 Ga0207694_10003504 Ga0207694_100035042 252
262 3300025926 Ga0207659_10098983 Ga0207659_100989832 252
263 3300025931 Ga0207644_10104930 Ga0207644_101049302 252
264 3300025933 Ga0207706_10143923 Ga0207706_101439232 252
265 3300025934 Ga0207686_10292086 Ga0207686_102920862 252
266 3300025935 Ga0207709_10022089 Ga0207709_100220893 252
267 3300025937 Ga0207669_10026605 Ga0207669_100266052 252
268 3300025938 Ga0207704_10133532 Ga0207704_101335322 252
269 3300025941 Ga0207711_10283285 Ga0207711_102832852 252
270 3300025942 Ga0207689_10091514 Ga0207689_100915142 252
271 3300025945 Ga0207679_10329748 Ga0207679_103297482 252
272 3300025972 Ga0207668_10088515 Ga0207668_100885152 252
273 3300026075 Ga0207708_10007364 Ga0207708_100073643 252
274 3300026088 Ga0207641_10014333 Ga0207641_100143335 252
275 3300026089 Ga0207648_10006414 Ga0207648_100064147 252
276 3300026095 Ga0207676_10106490 Ga0207676_101064902 252
277 3300026118 Ga0207675_100048538 Ga0207675_1000485382 252
278 3300026121 Ga0207683_10132331 Ga0207683_101323312 252
279 3300026142 Ga0207698_10503972 Ga0207698_105039722 252
280 3300031239 Ga0265328_10000378 Ga0265328_100003783 252
281 3300031239 Ga0265328_10006693 Ga0265328_100066933 252
282 3300031240 Ga0265320_10060938 Ga0265320_100609382 252
283 3300031242 Ga0265329_10005220 Ga0265329_100052203 252
284 3300031250 Ga0265331_10008145 Ga0265331_100081453 252
285 3300031344 Ga0265316_10044913 Ga0265316_100449132 252
286 3300031711 Ga0265314_10004765 Ga0265314_1000476516 252
287 3300045051 Ga0451576_0133593 Ga0451576_0133593_1075_1842 252
288 3300046557 Ga0495622_0114117 Ga0495622_0114117_19_786 252
289 3300046683 Ga0495658_0014570 Ga0495658_0014570_103_864 252
290 iso_pu_bacteria 2510065019 2510136388 252
291 iso_pu_bacteria 2513237084 2513568682 252
292 iso_pu_bacteria 2513237085 2513574457 252
293 iso_pu_bacteria 2599185155 2599330506 252
294 iso_pu_bacteria 2599185212 2599612201 252
295 iso_pu_bacteria 2599185300 2599932389 252
296 iso_pu_bacteria 2599185307 2599970765 252
297 iso_pu_bacteria 2599185311 2599993103 252
298 iso_pu_bacteria 2599185316 2600022891 252
299 iso_pu_bacteria 2599185317 2600028968 252
300 iso_pu_bacteria 2599185318 2600036724 252
301 iso_pu_bacteria 2599185319 2600043033 252
302 iso_pu_bacteria 2599185322 2600057989 252
303 iso_pu_bacteria 2599185323 2600066319 252
304 iso_pu_bacteria 2599185325 2600076259 252
305 iso_pu_bacteria 2600254930 2600358135 252
306 iso_pu_bacteria 2600255283 2601625072 252
307 iso_pu_bacteria 2667528176 2671130254 252
308 iso_pu_bacteria 2713897148 2715751410 252
309 iso_pu_bacteria 2738541271 2738688658 252
310 iso_pu_bacteria 2738543016 2739265030 252
311 iso_pu_bacteria 2826581358 2826585216 252
312 iso_pu_bacteria 2842815866 2842818824 252
313 iso_pu_bacteria 2842832357 2842834971 252
314 iso_pu_bacteria 2842849001 2842853582 252
315 iso_pu_bacteria 2919481497 2919482282 252
316 iso_pu_bacteria 2919487758 2919489222 252
317 iso_pu_bacteria 2923586266 2923588491 252
318 iso_pu_bacteria 2931369376 2931375443 252
319 iso_pu_bacteria 2969304461 2969307727 252
320 iso_pu_bacteria 2974289157 2974291065 252
321 iso_pu_bacteria 8018150411 8018154112 252
322 iso_pu_bacteria 8056166840 8056168518 252
323 2162886007 SwRhRL2b_contig_2326806 SwRhRL2b_0098.00007030 254
324 3300002737 JGI25162J39368_1000002 JGI25162J39368_1000002509 254
325 3300002771 JGI25163J39215_1000003 JGI25163J39215_1000003111 254
326 3300002772 JGI25164J39214_1000041 JGI25164J39214_1000041111 254
327 3300003751 Ga0055538_1000003 Ga0055538_1000003509 254
328 3300003752 Ga0055539_1000003 Ga0055539_1000003111 254
329 3300003756 Ga0055533_1000005 Ga0055533_1000005111 254
330 3300003759 Ga0055525_1000005 Ga0055525_1000005509 254
331 3300003841 Ga0055541_1000003 Ga0055541_1000003509 254
332 3300005289 Ga0065704_10000133 Ga0065704_1000013316 254
333 3300009011 Ga0105251_10000119 Ga0105251_1000011964 254
334 3300009011 Ga0105251_10003359 Ga0105251_100033599 254
335 3300009011 Ga0105251_10011487 Ga0105251_100114875 254
336 3300009036 Ga0105244_10000190 Ga0105244_1000019014 254
337 3300009036 Ga0105244_10000216 Ga0105244_1000021640 254
338 3300009036 Ga0105244_10000450 Ga0105244_100004507 254
339 3300009092 Ga0105250_10000265 Ga0105250_100002656 254
340 3300009092 Ga0105250_10001281 Ga0105250_1000128113 254
341 3300009101 Ga0105247_10000103 Ga0105247_1000010382 254
342 3300009174 Ga0105241_10000004 Ga0105241_10000004674 254
343 3300011119 Ga0105246_10037197 Ga0105246_100371972 254
344 3300013104 Ga0157370_10001398 Ga0157370_100013983 254
345 3300013306 Ga0163162_10024709 Ga0163162_100247097 254
346 3300017792 Ga0163161_10000001 Ga0163161_10000001245 254
347 3300025207 Ga0209760_100002 Ga0209760_100002203 254
348 3300025224 Ga0209784_100001 Ga0209784_1000012870 254
349 3300025225 Ga0209566_100001 Ga0209566_1000012870 254
350 3300025226 Ga0209674_100002 Ga0209674_1000022870 254
351 3300025230 Ga0209563_100002 Ga0209563_1000021405 254
352 3300025231 Ga0207427_100009 Ga0207427_100009503 254
353 3300025233 Ga0209437_100001 Ga0209437_1000011405 254
354 3300025253 Ga0209677_100002 Ga0209677_1000021405 254
355 3300025261 Ga0209233_1002373 Ga0209233_10023733 254
356 3300025711 Ga0207696_1000001 Ga0207696_1000001329 254
357 3300025711 Ga0207696_1000004 Ga0207696_1000004479 254
358 3300025711 Ga0207696_1000169 Ga0207696_100016984 254
359 3300025728 Ga0207655_1000011 Ga0207655_1000011546 254
360 3300025728 Ga0207655_1000149 Ga0207655_10001494 254
361 3300025728 Ga0207655_1001337 Ga0207655_100133716 254
362 3300025735 Ga0207713_1000024 Ga0207713_1000024225 254
363 3300025735 Ga0207713_1000026 Ga0207713_1000026114 254
364 3300025735 Ga0207713_1000027 Ga0207713_100002712 254
365 3300025735 Ga0207713_1002927 Ga0207713_10029276 254
366 3300025900 Ga0207710_10000140 Ga0207710_1000014051 254
367 3300025911 Ga0207654_10000006 Ga0207654_10000006692 254
368 3300027111 Ga0209281_1000008 Ga0209281_1000008108 254
369 3300027312 Ga0209371_1000348 Ga0209371_100034842 254
370 3300030500 Ga0268256_1000134 Ga0268256_100013495 254
371 3300042006 Ga0439432_014263 Ga0439432_014263_1369_2136 254
372 3300046453 Ga0495627_000018 Ga0495627_000018_298654_299421 254
373 3300046530 Ga0495654_0000179 Ga0495654_0000179_13579_14346 254
374 3300046794 Ga0495589_0000002 Ga0495589_0000002_348707_349474 254
375 3300046810 Ga0495660_0000004 Ga0495660_0000004_454624_455388 254
376 3300047443 Ga0495687_000579 Ga0495687_000579_32708_33481 254
377 3300048907 Ga0496104_0001712 Ga0496104_0001712_17795_18559 254
378 3300048919 Ga0496116_0000023 Ga0496116_0000023_211834_212601 254
379 3300048919 Ga0496116_0000083 Ga0496116_0000083_50696_51460 254
380 3300048920 Ga0496117_0000463 Ga0496117_0000463_62229_62996 254
381 3300048920 Ga0496117_0003404 Ga0496117_0003404_3268_4032 254
382 3300048920 Ga0496117_0010690 Ga0496117_0010690_408_1172 254
383 3300048921 Ga0496118_0001450 Ga0496118_0001450_34483_35247 254
384 3300048921 Ga0496118_0008485 Ga0496118_0008485_2428_3192 254
385 3300048922 Ga0496119_0006664 Ga0496119_0006664_8250_9017 254
386 3300048922 Ga0496119_0007198 Ga0496119_0007198_2593_3360 254
387 3300048922 Ga0496119_0010183 Ga0496119_0010183_2428_3192 254
388 3300048922 Ga0496119_0108605 Ga0496119_0108605_762_1529 254
389 3300048923 Ga0496120_0000052 Ga0496120_0000052_174966_175733 254
390 3300048923 Ga0496120_0001403 Ga0496120_0001403_10361_11128 254
391 3300048923 Ga0496120_0006927 Ga0496120_0006927_2935_3702 254
392 3300048923 Ga0496120_0063720 Ga0496120_0063720_41_808 254
393 3300048925 Ga0496122_0000135 Ga0496122_0000135_86156_86920 254
394 3300048926 Ga0496123_0000004 Ga0496123_0000004_86064_86828 254
395 3300048927 Ga0496124_0000017 Ga0496124_0000017_264871_265638 254
396 3300048927 Ga0496124_0000140 Ga0496124_0000140_126640_127404 254
397 3300048927 Ga0496124_0012407 Ga0496124_0012407_5030_5797 254
398 3300048928 Ga0496125_0000131 Ga0496125_0000131_111147_111911 254
399 3300048928 Ga0496125_0021687 Ga0496125_0021687_491_1258 254
400 3300048929 Ga0496126_0000300 Ga0496126_0000300_5719_6483 254
401 3300003323 rootH1_10015053 rootH1_1001505310 255
402 3300046472 Ga0495580_0044817 Ga0495580_0044817_1555_2400 255
403 3300046492 Ga0495585_0002260 Ga0495585_0002260_10961_11728 255
404 3300046526 Ga0495666_0035332 Ga0495666_0035332_716_1561 255
405 3300046665 Ga0495661_0000010 Ga0495661_0000010_98574_99341 255
406 3300047317 Ga0495604_0034528 Ga0495604_0034528_1915_2760 255
407 3300048920 Ga0496117_0061188 Ga0496117_0061188_1670_2482 255
408 3300048921 Ga0496118_0065412 Ga0496118_0065412_243_1073 255
409 3300048924 Ga0496121_0116803 Ga0496121_0116803_1123_1953 255
410 3300048929 Ga0496126_0001270 Ga0496126_0001270_21320_22132 255
411 3300053153 Ga0500616_0074678 Ga0500616_0074678_859_1665 255
412 iso_pu_bacteria 2802429635 2806061259 255
413 iso_pu_bacteria 2802429636 2806065677 255
414 iso_pu_bacteria 2855730933 2855736457 255
415 iso_pu_bacteria 2855767633 2855773394 255
416 2162886011 MRS1b_contig_117389 MRS1b_0437.00000680 256
417 3300003781 Ga0055536_1000072 Ga0055536_100007216 256
418 3300005289 Ga0065704_10070340 Ga0065704_100703403 256
419 3300005290 Ga0065712_10068515 Ga0065712_1006851511 256
420 3300005293 Ga0065715_10127867 Ga0065715_101278672 256
421 3300005331 Ga0070670_100000436 Ga0070670_10000043624 256
422 3300009011 Ga0105251_10000016 Ga0105251_1000001669 256
423 3300009011 Ga0105251_10110851 Ga0105251_101108511 256
424 3300009036 Ga0105244_10000425 Ga0105244_1000042535 256
425 3300009092 Ga0105250_10000003 Ga0105250_10000003154 256
426 3300009148 Ga0105243_10152383 Ga0105243_101523833 256
427 3300013100 Ga0157373_10055607 Ga0157373_100556072 256
428 3300013102 Ga0157371_10001449 Ga0157371_1000144913 256
429 3300013104 Ga0157370_10003497 Ga0157370_1000349712 256
430 3300013104 Ga0157370_10500792 Ga0157370_105007921 256
431 3300014497 Ga0182008_10007128 Ga0182008_100071283 256
432 3300014497 Ga0182008_10022934 Ga0182008_100229345 256
433 3300015261 Ga0182006_1046082 Ga0182006_10460822 256
434 3300015262 Ga0182007_10000471 Ga0182007_100004714 256
435 3300015262 Ga0182007_10026824 Ga0182007_100268243 256
436 3300015265 Ga0182005_1000341 Ga0182005_10003412 256
437 3300015265 Ga0182005_1018141 Ga0182005_10181412 256
438 3300025292 Ga0209676_1000020 Ga0209676_100002035 256
439 3300025728 Ga0207655_1002650 Ga0207655_100265013 256
440 3300025728 Ga0207655_1037529 Ga0207655_10375292 256
441 3300025735 Ga0207713_1000060 Ga0207713_1000060129 256
442 3300025925 Ga0207650_10000426 Ga0207650_1000042626 256
443 3300025935 Ga0207709_10102116 Ga0207709_101021163 256
444 3300027111 Ga0209281_1001466 Ga0209281_100146617 256
445 3300031731 Ga0307405_10140607 Ga0307405_101406071 256
446 3300031824 Ga0307413_10071959 Ga0307413_100719592 256
447 3300031903 Ga0307407_10060650 Ga0307407_100606502 256
448 3300031911 Ga0307412_10140940 Ga0307412_101409402 256
449 3300031995 Ga0307409_100538079 Ga0307409_1005380792 256
450 3300032002 Ga0307416_100063453 Ga0307416_1000634531 256
451 3300032005 Ga0307411_10007450 Ga0307411_100074506 256
452 3300041405 Ga0439438_001380 Ga0439438_001380_7476_8246 256
453 3300041407 Ga0439447_006742 Ga0439447_006742_672_1442 256
454 3300041411 Ga0439466_0000495 Ga0439466_0000495_13001_13771 256
455 3300041411 Ga0439466_0028715 Ga0439466_0028715_427_1197 256
456 3300041411 Ga0439466_0051780 Ga0439466_0051780_251_1021 256
457 3300042009 Ga0439451_000377 Ga0439451_000377_147_917 256
458 3300042010 Ga0439452_000043 Ga0439452_000043_84335_85105 256
459 3300042010 Ga0439452_000605 Ga0439452_000605_8374_9144 256
460 3300042010 Ga0439452_001052 Ga0439452_001052_5361_6131 256
461 3300042013 Ga0439456_000335 Ga0439456_000335_7050_7820 256
462 3300042016 Ga0439463_000294 Ga0439463_000294_13018_13788 256
463 3300042016 Ga0439463_007569 Ga0439463_007569_1312_2082 256
464 3300042115 Ga0450911_006623 Ga0450911_006623_316_1086 256
465 3300042136 Ga0450900_000128 Ga0450900_000128_3116_3886 256
466 3300042137 Ga0450902_004091 Ga0450902_004091_1118_1888 256
467 3300042139 Ga0450904_000487 Ga0450904_000487_4872_5642 256
468 3300042145 Ga0450906_000010 Ga0450906_000010_22094_22864 256
469 3300042146 Ga0450907_005684 Ga0450907_005684_22_792 256
470 3300046452 Ga0495617_000642 Ga0495617_000642_16561_17331 256
471 3300046452 Ga0495617_041529 Ga0495617_041529_297_1067 256
472 3300046453 Ga0495627_005333 Ga0495627_005333_292_1062 256
473 3300046453 Ga0495627_037220 Ga0495627_037220_675_1445 256
474 3300046455 Ga0495603_0002989 Ga0495603_0002989_1885_2655 256
475 3300046458 Ga0495591_000041 Ga0495591_000041_84737_85519 256
476 3300046458 Ga0495591_000189 Ga0495591_000189_55269_56039 256
477 3300046458 Ga0495591_000234 Ga0495591_000234_28888_29658 256
478 3300046458 Ga0495591_005709 Ga0495591_005709_2811_3581 256
479 3300046458 Ga0495591_016739 Ga0495591_016739_727_1497 256
480 3300046458 Ga0495591_024088 Ga0495591_024088_730_1500 256
481 3300046460 Ga0495638_0030846 Ga0495638_0030846_2618_3388 256
482 3300046463 Ga0495653_0001089 Ga0495653_0001089_8322_9092 256
483 3300046471 Ga0495650_0000309 Ga0495650_0000309_57006_57776 256
484 3300046471 Ga0495650_0000780 Ga0495650_0000780_12256_13026 256
485 3300046471 Ga0495650_0003367 Ga0495650_0003367_10581_11351 256
486 3300046471 Ga0495650_0024507 Ga0495650_0024507_1798_2568 256
487 3300046474 Ga0495605_0000045 Ga0495605_0000045_74439_75209 256
488 3300046474 Ga0495605_0000090 Ga0495605_0000090_26535_27305 256
489 3300046474 Ga0495605_0000124 Ga0495605_0000124_47747_48517 256
490 3300046474 Ga0495605_0000589 Ga0495605_0000589_10180_10962 256
491 3300046474 Ga0495605_0000705 Ga0495605_0000705_20632_21402 256
492 3300046474 Ga0495605_0000722 Ga0495605_0000722_15815_16585 256
493 3300046474 Ga0495605_0023604 Ga0495605_0023604_2432_3202 256
494 3300046474 Ga0495605_0034801 Ga0495605_0034801_336_1106 256
495 3300046474 Ga0495605_0218911 Ga0495605_0218911_20_802 256
496 3300046491 Ga0495584_0002628 Ga0495584_0002628_8416_9186 256
497 3300046491 Ga0495584_0008800 Ga0495584_0008800_4209_4979 256
498 3300046491 Ga0495584_0009488 Ga0495584_0009488_1503_2273 256
499 3300046492 Ga0495585_0001433 Ga0495585_0001433_1640_2410 256
500 3300046499 Ga0495594_0000711 Ga0495594_0000711_7305_8075 256
501 3300046500 Ga0495596_0013213 Ga0495596_0013213_2064_2834 256
502 3300046500 Ga0495596_0068391 Ga0495596_0068391_266_1036 256
503 3300046501 Ga0495607_0000070 Ga0495607_0000070_28049_28831 256
504 3300046501 Ga0495607_0000106 Ga0495607_0000106_41788_42558 256
505 3300046501 Ga0495607_0000284 Ga0495607_0000284_10452_11222 256
506 3300046501 Ga0495607_0000369 Ga0495607_0000369_42989_43771 256
507 3300046501 Ga0495607_0005884 Ga0495607_0005884_2375_3145 256
508 3300046501 Ga0495607_0006909 Ga0495607_0006909_6766_7536 256
509 3300046501 Ga0495607_0012639 Ga0495607_0012639_95_865 256
510 3300046501 Ga0495607_0021888 Ga0495607_0021888_237_1007 256
511 3300046501 Ga0495607_0081953 Ga0495607_0081953_734_1504 256
512 3300046501 Ga0495607_0083646 Ga0495607_0083646_172_942 256
513 3300046506 Ga0495583_0000101 Ga0495583_0000101_52887_53657 256
514 3300046506 Ga0495583_0000765 Ga0495583_0000765_8409_9179 256
515 3300046506 Ga0495583_0001353 Ga0495583_0001353_23271_24041 256
516 3300046506 Ga0495583_0002114 Ga0495583_0002114_4839_5609 256
517 3300046506 Ga0495583_0002459 Ga0495583_0002459_140_910 256
518 3300046506 Ga0495583_0056234 Ga0495583_0056234_277_1047 256
519 3300046507 Ga0495606_0000042 Ga0495606_0000042_106184_106954 256
520 3300046507 Ga0495606_0000081 Ga0495606_0000081_153646_154416 256
521 3300046507 Ga0495606_0000098 Ga0495606_0000098_9871_10641 256
522 3300046507 Ga0495606_0003477 Ga0495606_0003477_4898_5668 256
523 3300046507 Ga0495606_0097138 Ga0495606_0097138_347_1117 256
524 3300046513 Ga0495616_0046339 Ga0495616_0046339_167_937 256
525 3300046515 Ga0495620_0000001 Ga0495620_0000001_195573_196343 256
526 3300046515 Ga0495620_0001049 Ga0495620_0001049_15568_16338 256
527 3300046515 Ga0495620_0001966 Ga0495620_0001966_823_1593 256
528 3300046515 Ga0495620_0049954 Ga0495620_0049954_664_1434 256
529 3300046518 Ga0495631_0001230 Ga0495631_0001230_14909_15679 256
530 3300046518 Ga0495631_0005658 Ga0495631_0005658_2005_2775 256
531 3300046518 Ga0495631_0009509 Ga0495631_0009509_326_1096 256
532 3300046518 Ga0495631_0032501 Ga0495631_0032501_1071_1841 256
533 3300046518 Ga0495631_0094113 Ga0495631_0094113_110_880 256
534 3300046519 Ga0495632_0002280 Ga0495632_0002280_1670_2440 256
535 3300046519 Ga0495632_0016439 Ga0495632_0016439_2355_3125 256
536 3300046519 Ga0495632_0041865 Ga0495632_0041865_1323_2093 256
537 3300046519 Ga0495632_0055118 Ga0495632_0055118_329_1099 256
538 3300046520 Ga0495637_0000023 Ga0495637_0000023_128694_129464 256
539 3300046520 Ga0495637_0000486 Ga0495637_0000486_7797_8567 256
540 3300046520 Ga0495637_0001685 Ga0495637_0001685_11837_12607 256
541 3300046520 Ga0495637_0005119 Ga0495637_0005119_4531_5301 256
542 3300046520 Ga0495637_0014831 Ga0495637_0014831_2760_3542 256
543 3300046520 Ga0495637_0055348 Ga0495637_0055348_569_1339 256
544 3300046522 Ga0495643_0000721 Ga0495643_0000721_15445_16215 256
545 3300046522 Ga0495643_0058000 Ga0495643_0058000_1044_1814 256
546 3300046522 Ga0495643_0092214 Ga0495643_0092214_567_1337 256
547 3300046523 Ga0495644_0002392 Ga0495644_0002392_5596_6366 256
548 3300046524 Ga0495648_0004913 Ga0495648_0004913_10023_10793 256
549 3300046524 Ga0495648_0010650 Ga0495648_0010650_2310_3080 256
550 3300046530 Ga0495654_0004579 Ga0495654_0004579_6872_7642 256
551 3300046530 Ga0495654_0007597 Ga0495654_0007597_5131_5901 256
552 3300046530 Ga0495654_0010116 Ga0495654_0010116_3176_3946 256
553 3300046530 Ga0495654_0049717 Ga0495654_0049717_840_1610 256
554 3300046538 Ga0495609_0000011 Ga0495609_0000011_144628_145398 256
555 3300046538 Ga0495609_0000012 Ga0495609_0000012_233358_234128 256
556 3300046538 Ga0495609_0000145 Ga0495609_0000145_43190_43960 256
557 3300046538 Ga0495609_0004096 Ga0495609_0004096_768_1538 256
558 3300046538 Ga0495609_0006406 Ga0495609_0006406_1469_2239 256
559 3300046542 Ga0495597_0000004 Ga0495597_0000004_70878_71660 256
560 3300046542 Ga0495597_0003740 Ga0495597_0003740_1851_2621 256
561 3300046543 Ga0495645_0130468 Ga0495645_0130468_278_1048 256
562 3300046557 Ga0495622_0004276 Ga0495622_0004276_3816_4586 256
563 3300046557 Ga0495622_0072380 Ga0495622_0072380_354_1124 256
564 3300046558 Ga0495633_0000016 Ga0495633_0000016_53292_54062 256
565 3300046558 Ga0495633_0000367 Ga0495633_0000367_37267_38037 256
566 3300046558 Ga0495633_0009020 Ga0495633_0009020_2435_3205 256
567 3300046616 Ga0495668_0050878 Ga0495668_0050878_687_1457 256
568 3300046616 Ga0495668_0082153 Ga0495668_0082153_291_1061 256
569 3300046648 Ga0495611_0001082 Ga0495611_0001082_5538_6308 256
570 3300046648 Ga0495611_0001380 Ga0495611_0001380_8742_9512 256
571 3300046648 Ga0495611_0055885 Ga0495611_0055885_680_1450 256
572 3300046660 Ga0495625_0000010 Ga0495625_0000010_148337_149107 256
573 3300046665 Ga0495661_0000004 Ga0495661_0000004_316570_317340 256
574 3300046665 Ga0495661_0000018 Ga0495661_0000018_108930_109700 256
575 3300046665 Ga0495661_0000020 Ga0495661_0000020_137173_137943 256
576 3300046665 Ga0495661_0088125 Ga0495661_0088125_274_1044 256
577 3300046665 Ga0495661_0126149 Ga0495661_0126149_511_1281 256
578 3300046665 Ga0495661_0195530 Ga0495661_0195530_77_847 256
579 3300046665 Ga0495661_0197514 Ga0495661_0197514_107_877 256
580 3300046691 Ga0495670_0012175 Ga0495670_0012175_909_1679 256
581 3300046692 Ga0495671_0001369 Ga0495671_0001369_1127_1897 256
582 3300046692 Ga0495671_0007179 Ga0495671_0007179_394_1164 256
583 3300046692 Ga0495671_0044115 Ga0495671_0044115_970_1740 256
584 3300046694 Ga0495649_0000027 Ga0495649_0000027_106683_107453 256
585 3300046694 Ga0495649_0000083 Ga0495649_0000083_58553_59323 256
586 3300046694 Ga0495649_0040948 Ga0495649_0040948_1410_2180 256
587 3300046794 Ga0495589_0001428 Ga0495589_0001428_1872_2642 256
588 3300046810 Ga0495660_0000454 Ga0495660_0000454_26846_27616 256
589 3300046810 Ga0495660_0000637 Ga0495660_0000637_2115_2897 256
590 3300046810 Ga0495660_0007375 Ga0495660_0007375_900_1670 256
591 3300046810 Ga0495660_0031802 Ga0495660_0031802_1645_2415 256
592 3300046810 Ga0495660_0087172 Ga0495660_0087172_76_858 256
593 3300047320 Ga0495672_0003150 Ga0495672_0003150_568_1338 256
594 3300047320 Ga0495672_0007746 Ga0495672_0007746_4175_4945 256
595 3300047320 Ga0495672_0016420 Ga0495672_0016420_243_1013 256
596 3300047320 Ga0495672_0036521 Ga0495672_0036521_926_1696 256
597 3300047320 Ga0495672_0061562 Ga0495672_0061562_1280_2062 256
598 3300047320 Ga0495672_0069236 Ga0495672_0069236_555_1337 256
599 3300047320 Ga0495672_0111424 Ga0495672_0111424_623_1405 256
600 3300047321 Ga0495676_0000002 Ga0495676_0000002_229632_230402 256
601 3300047323 Ga0495683_0000019 Ga0495683_0000019_171160_171930 256
602 3300047323 Ga0495683_0000063 Ga0495683_0000063_23396_24166 256
603 3300047323 Ga0495683_0000416 Ga0495683_0000416_15794_16564 256
604 3300047323 Ga0495683_0092068 Ga0495683_0092068_471_1241 256
605 3300047446 Ga0495679_000165 Ga0495679_000165_17278_18048 256
606 3300047446 Ga0495679_000322 Ga0495679_000322_12192_12962 256
607 3300047469 Ga0495673_0000183 Ga0495673_0000183_45628_46398 256
608 3300047469 Ga0495673_0000758 Ga0495673_0000758_11209_11979 256
609 3300047469 Ga0495673_0001862 Ga0495673_0001862_24_794 256
610 3300047469 Ga0495673_0004738 Ga0495673_0004738_7040_7810 256
611 3300047469 Ga0495673_0010447 Ga0495673_0010447_3932_4702 256
612 3300047469 Ga0495673_0014825 Ga0495673_0014825_851_1621 256
613 3300047469 Ga0495673_0019900 Ga0495673_0019900_1593_2363 256
614 3300047469 Ga0495673_0022461 Ga0495673_0022461_825_1595 256
615 3300047469 Ga0495673_0062263 Ga0495673_0062263_527_1297 256
616 3300047470 Ga0495681_0000538 Ga0495681_0000538_11326_12096 256
617 3300047470 Ga0495681_0001151 Ga0495681_0001151_15116_15886 256
618 3300047470 Ga0495681_0050837 Ga0495681_0050837_750_1520 256
619 3300047472 Ga0495686_0055630 Ga0495686_0055630_1422_2192 256
620 3300047472 Ga0495686_0142909 Ga0495686_0142909_487_1257 256
621 3300048091 Ga0495626_0000007 Ga0495626_0000007_232470_233240 256
622 3300048091 Ga0495626_0039485 Ga0495626_0039485_709_1479 256
623 3300048905 Ga0496102_0782102 Ga0496102_0782102_31_801 256
624 3300048913 Ga0496110_0052219 Ga0496110_0052219_2423_3193 256
625 3300048914 Ga0496111_0388315 Ga0496111_0388315_180_950 256
626 3300048916 Ga0496113_0333225 Ga0496113_0333225_80_850 256
627 3300048920 Ga0496117_0068768 Ga0496117_0068768_315_1085 256
628 3300048920 Ga0496117_0165761 Ga0496117_0165761_119_889 256
629 3300048921 Ga0496118_0129287 Ga0496118_0129287_261_1031 256
630 3300048924 Ga0496121_0000824 Ga0496121_0000824_4006_4776 256
631 3300048924 Ga0496121_0003602 Ga0496121_0003602_17382_18152 256
632 3300048925 Ga0496122_0000167 Ga0496122_0000167_50686_51456 256
633 3300048925 Ga0496122_0107291 Ga0496122_0107291_478_1248 256
634 3300048926 Ga0496123_0000127 Ga0496123_0000127_93809_94579 256
635 3300048926 Ga0496123_0055389 Ga0496123_0055389_587_1357 256
636 3300048927 Ga0496124_0000292 Ga0496124_0000292_531_1301 256
637 3300048927 Ga0496124_0010375 Ga0496124_0010375_4544_5314 256
638 3300048927 Ga0496124_0163452 Ga0496124_0163452_363_1133 256
639 3300049459 Ga0495678_000036 Ga0495678_000036_122858_123628 256
640 3300049459 Ga0495678_000120 Ga0495678_000120_16732_17502 256
641 3300049459 Ga0495678_001857 Ga0495678_001857_365_1135 256
642 3300049459 Ga0495678_005571 Ga0495678_005571_5460_6230 256
643 3300049459 Ga0495678_044875 Ga0495678_044875_716_1486 256
644 3300049459 Ga0495678_061852 Ga0495678_061852_221_991 256
645 3300049460 Ga0495682_0000241 Ga0495682_0000241_35568_36338 256
646 3300049460 Ga0495682_0001417 Ga0495682_0001417_863_1633 256
647 3300049460 Ga0495682_0003494 Ga0495682_0003494_3491_4261 256
648 3300050491 nmdc:mga00v17_83208_c1 nmdc:mga00v17_83208_c1_19_789 256
649 3300053125 Ga0500618_001248 Ga0500618_001248_7385_8155 256
650 3300031731 Ga0307405_10257292 Ga0307405_102572921 257
651 3300031901 Ga0307406_10067539 Ga0307406_100675392 257
652 3300031911 Ga0307412_10005141 Ga0307412_100051413 257
653 3300032002 Ga0307416_100629067 Ga0307416_1006290672 257
654 3300032005 Ga0307411_10109452 Ga0307411_101094523 257
655 iso_pu_bacteria 2808606385 2808979829 257
656 iso_pu_bacteria 2808606388 2808995549 257
657 2162886007 SwRhRL2b_contig_2097597 SwRhRL2b_0559.00008460 258
658 3300013100 Ga0157373_10002585 Ga0157373_1000258512 258
659 3300014497 Ga0182008_10006908 Ga0182008_100069084 258
660 3300015261 Ga0182006_1021259 Ga0182006_10212593 258
661 3300015262 Ga0182007_10003572 Ga0182007_100035725 258
662 3300042009 Ga0439451_000047 Ga0439451_000047_12177_12953 258
663 3300042009 Ga0439451_002515 Ga0439451_002515_2217_3008 258
664 3300042013 Ga0439456_001538 Ga0439456_001538_1991_2767 258
665 3300042461 Ga0439460_0000060 Ga0439460_0000060_10265_11041 258
666 3300046453 Ga0495627_000380 Ga0495627_000380_15550_16326 258
667 3300046512 Ga0495610_0012980 Ga0495610_0012980_531_1307 258
668 3300046518 Ga0495631_0001306 Ga0495631_0001306_3878_4654 258
669 3300046692 Ga0495671_0001070 Ga0495671_0001070_13936_14712 258
670 3300048091 Ga0495626_0000897 Ga0495626_0000897_4202_4978 258
671 3300048925 Ga0496122_0004158 Ga0496122_0004158_3983_4759 258
672 3300048926 Ga0496123_0003312 Ga0496123_0003312_13504_14280 258
673 3300048927 Ga0496124_0001314 Ga0496124_0001314_13050_13826 258
674 3300048928 Ga0496125_0000195 Ga0496125_0000195_124765_125541 258

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

92

237

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hc2-assembly1.cif.gz_A-2 crystal structure of chicken sulfite oxidase mutant tyr 322 phe 0.9021 104 247
2a99-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9008 104 247
3r18-assembly1.cif.gz_A-2 chicken sulfite oxidase double mutant with altered activity and substrate affinity 0.8995 104 247
2xts-assembly1.cif.gz_C crystal structure of the sulfane dehydrogenase soxcd from paracoccus pantotrophus 0.8977 104 241
3hbp-assembly1.cif.gz_A-2 the crystal structure of c185s mutant of recombinant sulfite oxidase with bound substrate, sulfite, at the active site 0.8971 104 247
ID Description Score Start End Superfamily
2xtsA01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8976 104 241 3.90.420.10
af_A0A0R4IKF7_192_441_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8777 104 252 3.90.420.10
2ca4A01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.849 80 252 3.90.420.10
af_Q54XJ8_10_262_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8429 85 247 3.90.420.10
af_P96400_291_442_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8374 93 241 3.90.420.10
ID Description Score Start End GO Terms
AF-A0A6I4SVQ0-F1-model_v4 Molybdopterin-dependent oxidoreductase 0.9707 110 221
AF-A0A537TEQ0-F1-model_v4 Molybdopterin-binding protein 0.9635 79 258
AF-A0A537S0D7-F1-model_v4 Molybdopterin-binding protein 0.9591 48 258
AF-A0A537ALX2-F1-model_v4 Molybdopterin-binding protein 0.9537 48 258
AF-A0A537TEQ0-F1-model_v4 Molybdopterin-binding protein 0.948 79 258

Feature Viewer

pLDDT pTM Quality
79.8 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map