F474211
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 672 | 202 | 672 | 178 |
Family's Representative Sequence
| Representative Sequence | 3300005355|Ga0070671_100248616|Ga0070671_1002486162 |
| Length | 191 |
| Sequence | MDSPFRGNDDTGDCVQFNLIPHPTTPPSKPLKVWAIVDHAASLGSVASTNIWFGVGAPAVGFAIPEAAEPARAEDLWQTTCFEAFLRIPGAEGYREWNFAPSGEWAAYDFESHREGRSDADVAAPYVRIEDNLTWWALGATIPVDADAIWSLALSAILEEKDGTKSYWALAHPPGDKPDFHAADCFAARLP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 67 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 92 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 143 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 144 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 145 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 146 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 147 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 148 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 149 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 150 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 151 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 152 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 153 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 154 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 155 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 156 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 157 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 159 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 160 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 161 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 162 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 163 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 164 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 165 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 166 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 167 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 168 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 169 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 170 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 171 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 172 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 173 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 174 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 175 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 181 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 183 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 184 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 185 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 186 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 187 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 190 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 191 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 192 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 193 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 194 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 195 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 196 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 197 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 198 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 199 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 201 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 202 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.7 |
| Rhizosphere | 93.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10044166 | 3300001979 | Bacteria | 1324 |
| 2 | JGI24739J22299_10001515 | 3300001989 | Bacteria | 8773 |
| 3 | JGI24739J22299_10046778 | 3300001989 | Bacteria | 1415 |
| 4 | JGI24737J22298_10114970 | 3300001990 | Bacteria | 795 |
| 5 | JGI24738J21930_10063765 | 3300002075 | Unclassified | 758 |
| 6 | JGI24744J21845_10003924 | 3300002077 | Bacteria | 3065 |
| 7 | JGI24034J26672_10021898 | 3300002239 | Bacteria | 1007 |
| 8 | Ga0065715_10222191 | 3300005293 | Bacteria | 1267 |
| 9 | Ga0065715_10445978 | 3300005293 | Bacteria | 831 |
| 10 | Ga0070658_10097808 | 3300005327 | Bacteria | 2423 |
| 11 | Ga0070658_10263399 | 3300005327 | Bacteria | 1464 |
| 12 | Ga0070658_10322390 | 3300005327 | Bacteria | 1319 |
| 13 | Ga0070658_10433439 | 3300005327 | Bacteria | 1131 |
| 14 | Ga0070658_10863229 | 3300005327 | Bacteria | 787 |
| 15 | Ga0070658_11042174 | 3300005327 | Bacteria | 711 |
| 16 | Ga0070658_11211751 | 3300005327 | Bacteria | 656 |
| 17 | Ga0070676_10098830 | 3300005328 | Bacteria | 1800 |
| 18 | Ga0070676_10181641 | 3300005328 | Bacteria | 1368 |
| 19 | Ga0070676_10223414 | 3300005328 | Bacteria | 1245 |
| 20 | Ga0070676_10334284 | 3300005328 | Bacteria | 1037 |
| 21 | Ga0070683_100148560 | 3300005329 | Bacteria | 2222 |
| 22 | Ga0070683_100560315 | 3300005329 | Bacteria | 1093 |
| 23 | Ga0070683_100594518 | 3300005329 | Bacteria | 1059 |
| 24 | Ga0070683_101172081 | 3300005329 | Bacteria | 738 |
| 25 | Ga0070690_100025707 | 3300005330 | Bacteria | 3625 |
| 26 | Ga0070690_100059041 | 3300005330 | Bacteria | 2465 |
| 27 | Ga0070690_100846723 | 3300005330 | Bacteria | 712 |
| 28 | Ga0070670_100004708 | 3300005331 | Bacteria | 11450 |
| 29 | Ga0070670_100037311 | 3300005331 | Bacteria | 4181 |
| 30 | Ga0070670_100038135 | 3300005331 | Bacteria | 4132 |
| 31 | Ga0070670_100231757 | 3300005331 | Bacteria | 1607 |
| 32 | Ga0070670_100273793 | 3300005331 | Bacteria | 1473 |
| 33 | Ga0070677_10041020 | 3300005333 | Bacteria | 1825 |
| 34 | Ga0068869_100612305 | 3300005334 | Bacteria | 921 |
| 35 | Ga0070666_10001646 | 3300005335 | Bacteria | 13611 |
| 36 | Ga0070666_10001840 | 3300005335 | Bacteria | 12925 |
| 37 | Ga0070666_10019786 | 3300005335 | Bacteria | 4348 |
| 38 | Ga0070666_10025241 | 3300005335 | Bacteria | 3873 |
| 39 | Ga0070666_10047624 | 3300005335 | Bacteria | 2878 |
| 40 | Ga0070666_10134351 | 3300005335 | Bacteria | 1720 |
| 41 | Ga0070666_10234356 | 3300005335 | Bacteria | 1297 |
| 42 | Ga0068868_100001374 | 3300005338 | Bacteria | 16758 |
| 43 | Ga0068868_100018524 | 3300005338 | Bacteria | 5207 |
| 44 | Ga0068868_100027559 | 3300005338 | Bacteria | 4335 |
| 45 | Ga0068868_100064966 | 3300005338 | Bacteria | 2898 |
| 46 | Ga0068868_100297182 | 3300005338 | Bacteria | 1371 |
| 47 | Ga0068868_100347962 | 3300005338 | Bacteria | 1269 |
| 48 | Ga0068868_100824753 | 3300005338 | Bacteria | 838 |
| 49 | Ga0070660_100010347 | 3300005339 | Bacteria | 6589 |
| 50 | Ga0070660_100014609 | 3300005339 | Bacteria | 5663 |
| 51 | Ga0070660_100153338 | 3300005339 | Bacteria | 1853 |
| 52 | Ga0070660_100196915 | 3300005339 | Bacteria | 1634 |
| 53 | Ga0070660_100593668 | 3300005339 | Bacteria | 926 |
| 54 | Ga0070689_100792404 | 3300005340 | Bacteria | 833 |
| 55 | Ga0070687_100351234 | 3300005343 | Bacteria | 952 |
| 56 | Ga0070687_100394410 | 3300005343 | Bacteria | 906 |
| 57 | Ga0070687_100438231 | 3300005343 | Bacteria | 866 |
| 58 | Ga0070661_100077229 | 3300005344 | Bacteria | 2455 |
| 59 | Ga0070661_100127405 | 3300005344 | Bacteria | 1910 |
| 60 | Ga0070661_100153148 | 3300005344 | Bacteria | 1744 |
| 61 | Ga0070661_100167816 | 3300005344 | Bacteria | 1666 |
| 62 | Ga0070661_100299856 | 3300005344 | Bacteria | 1251 |
| 63 | Ga0070661_100914795 | 3300005344 | Bacteria | 725 |
| 64 | Ga0070661_101177320 | 3300005344 | Bacteria | 640 |
| 65 | Ga0070692_10003915 | 3300005345 | Bacteria | 6138 |
| 66 | Ga0070668_100053350 | 3300005347 | Bacteria | 3118 |
| 67 | Ga0070668_100474401 | 3300005347 | Bacteria | 1079 |
| 68 | Ga0070669_100185962 | 3300005353 | Bacteria | 1627 |
| 69 | Ga0070669_100203467 | 3300005353 | Bacteria | 1559 |
| 70 | Ga0070669_100355195 | 3300005353 | Bacteria | 1190 |
| 71 | Ga0070669_100448159 | 3300005353 | Bacteria | 1063 |
| 72 | Ga0070675_100009388 | 3300005354 | Bacteria | 7611 |
| 73 | Ga0070675_100035449 | 3300005354 | Bacteria | 4054 |
| 74 | Ga0070675_100920121 | 3300005354 | Bacteria | 802 |
| 75 | Ga0070671_100019434 | 3300005355 | Bacteria | 5528 |
| 76 | Ga0070671_100045542 | 3300005355 | Bacteria | 3647 |
| 77 | Ga0070671_100083872 | 3300005355 | Bacteria | 2665 |
| 78 | Ga0070671_100141007 | 3300005355 | Bacteria | 2034 |
| 79 | Ga0070671_100142406 | 3300005355 | Bacteria | 2023 |
| 80 | Ga0070671_100248616 | 3300005355 | Bacteria | 1510 |
| 81 | Ga0070671_100260286 | 3300005355 | Bacteria | 1474 |
| 82 | Ga0070671_100874413 | 3300005355 | Unclassified | 784 |
| 83 | Ga0070671_100915330 | 3300005355 | Bacteria | 766 |
| 84 | Ga0070674_100044341 | 3300005356 | Bacteria | 3031 |
| 85 | Ga0070674_100045140 | 3300005356 | Bacteria | 3010 |
| 86 | Ga0070674_100135073 | 3300005356 | Bacteria | 1844 |
| 87 | Ga0070674_100473902 | 3300005356 | Bacteria | 1038 |
| 88 | Ga0070674_100615085 | 3300005356 | Bacteria | 920 |
| 89 | Ga0070673_100000346 | 3300005364 | Bacteria | 24441 |
| 90 | Ga0070673_100121514 | 3300005364 | Bacteria | 2179 |
| 91 | Ga0070673_100243170 | 3300005364 | Bacteria | 1566 |
| 92 | Ga0070673_100352350 | 3300005364 | Bacteria | 1307 |
| 93 | Ga0070673_100485717 | 3300005364 | Bacteria | 1115 |
| 94 | Ga0070673_101328256 | 3300005364 | Bacteria | 676 |
| 95 | Ga0070688_100847579 | 3300005365 | Bacteria | 718 |
| 96 | Ga0070659_100005873 | 3300005366 | Bacteria | 8844 |
| 97 | Ga0070659_100025309 | 3300005366 | Bacteria | 4556 |
| 98 | Ga0070659_100036446 | 3300005366 | Bacteria | 3835 |
| 99 | Ga0070659_100090911 | 3300005366 | Bacteria | 2446 |
| 100 | Ga0070659_100339314 | 3300005366 | Bacteria | 1258 |
| 101 | Ga0070659_100463260 | 3300005366 | Bacteria | 1076 |
| 102 | Ga0070659_100554784 | 3300005366 | Bacteria | 984 |
| 103 | Ga0070659_100568334 | 3300005366 | Bacteria | 972 |
| 104 | Ga0070659_100623253 | 3300005366 | Bacteria | 928 |
| 105 | Ga0070667_100002025 | 3300005367 | Bacteria | 17950 |
| 106 | Ga0070667_100002154 | 3300005367 | Bacteria | 17347 |
| 107 | Ga0070667_100002178 | 3300005367 | Bacteria | 17241 |
| 108 | Ga0070667_100199767 | 3300005367 | Bacteria | 1774 |
| 109 | Ga0070667_100254506 | 3300005367 | Bacteria | 1571 |
| 110 | Ga0070667_100432757 | 3300005367 | Bacteria | 1200 |
| 111 | Ga0070667_100501407 | 3300005367 | Bacteria | 1113 |
| 112 | Ga0070667_100523350 | 3300005367 | Bacteria | 1088 |
| 113 | Ga0070667_101407426 | 3300005367 | Unclassified | 654 |
| 114 | Ga0070714_100038119 | 3300005435 | Bacteria | 4042 |
| 115 | Ga0070701_10384826 | 3300005438 | Bacteria | 885 |
| 116 | Ga0070694_100005140 | 3300005444 | Bacteria | 7888 |
| 117 | Ga0070663_100051594 | 3300005455 | Bacteria | 2931 |
| 118 | Ga0070663_100136288 | 3300005455 | Bacteria | 1869 |
| 119 | Ga0070663_100159869 | 3300005455 | Bacteria | 1733 |
| 120 | Ga0070663_100220927 | 3300005455 | Bacteria | 1487 |
| 121 | Ga0070663_100263044 | 3300005455 | Bacteria | 1369 |
| 122 | Ga0070663_100335743 | 3300005455 | Bacteria | 1219 |
| 123 | Ga0070663_100374509 | 3300005455 | Bacteria | 1158 |
| 124 | Ga0070663_100442434 | 3300005455 | Bacteria | 1070 |
| 125 | Ga0070678_100003221 | 3300005456 | Bacteria | 9062 |
| 126 | Ga0070678_100073959 | 3300005456 | Bacteria | 2559 |
| 127 | Ga0070678_100081233 | 3300005456 | Bacteria | 2457 |
| 128 | Ga0070678_100755229 | 3300005456 | Bacteria | 880 |
| 129 | Ga0070662_100009105 | 3300005457 | Bacteria | 6481 |
| 130 | Ga0070662_100032279 | 3300005457 | Bacteria | 3680 |
| 131 | Ga0070662_100055180 | 3300005457 | Bacteria | 2882 |
| 132 | Ga0070662_100068687 | 3300005457 | Bacteria | 2606 |
| 133 | Ga0070662_100075828 | 3300005457 | Bacteria | 2491 |
| 134 | Ga0070662_100152695 | 3300005457 | Bacteria | 1799 |
| 135 | Ga0070662_100203686 | 3300005457 | Bacteria | 1571 |
| 136 | Ga0070662_100235049 | 3300005457 | Bacteria | 1468 |
| 137 | Ga0070662_100274369 | 3300005457 | Bacteria | 1362 |
| 138 | Ga0070662_101190864 | 3300005457 | Bacteria | 655 |
| 139 | Ga0070681_10623849 | 3300005458 | Bacteria | 993 |
| 140 | Ga0068867_100065520 | 3300005459 | Bacteria | 2704 |
| 141 | Ga0068867_100066622 | 3300005459 | Bacteria | 2683 |
| 142 | Ga0068867_101068544 | 3300005459 | Bacteria | 735 |
| 143 | Ga0070685_10071423 | 3300005466 | Bacteria | 2058 |
| 144 | Ga0068853_100066823 | 3300005539 | Bacteria | 3123 |
| 145 | Ga0068853_100250976 | 3300005539 | Bacteria | 1623 |
| 146 | Ga0068853_100329120 | 3300005539 | Bacteria | 1417 |
| 147 | Ga0068853_100376770 | 3300005539 | Bacteria | 1325 |
| 148 | Ga0068853_100404906 | 3300005539 | Bacteria | 1277 |
| 149 | Ga0070672_100002995 | 3300005543 | Bacteria | 10885 |
| 150 | Ga0070672_100069279 | 3300005543 | Bacteria | 2800 |
| 151 | Ga0070672_100130574 | 3300005543 | Bacteria | 2064 |
| 152 | Ga0070672_100144676 | 3300005543 | Bacteria | 1964 |
| 153 | Ga0070672_100305875 | 3300005543 | Bacteria | 1349 |
| 154 | Ga0070695_100325650 | 3300005545 | Bacteria | 1144 |
| 155 | Ga0070695_100847516 | 3300005545 | Bacteria | 735 |
| 156 | Ga0070693_100035832 | 3300005547 | Bacteria | 2754 |
| 157 | Ga0070665_100008473 | 3300005548 | Bacteria | 10404 |
| 158 | Ga0070665_100012511 | 3300005548 | Bacteria | 8550 |
| 159 | Ga0070665_100015258 | 3300005548 | Bacteria | 7713 |
| 160 | Ga0070665_100485298 | 3300005548 | Bacteria | 1246 |
| 161 | Ga0070665_100547973 | 3300005548 | Bacteria | 1169 |
| 162 | Ga0070665_100700161 | 3300005548 | Bacteria | 1026 |
| 163 | Ga0068855_100148527 | 3300005563 | Bacteria | 2666 |
| 164 | Ga0068855_100424104 | 3300005563 | Bacteria | 1455 |
| 165 | Ga0070664_100002277 | 3300005564 | Bacteria | 15441 |
| 166 | Ga0070664_100016176 | 3300005564 | Bacteria | 6113 |
| 167 | Ga0070664_100047762 | 3300005564 | Bacteria | 3617 |
| 168 | Ga0070664_100139937 | 3300005564 | Bacteria | 2130 |
| 169 | Ga0070664_100152958 | 3300005564 | Bacteria | 2037 |
| 170 | Ga0070664_100203028 | 3300005564 | Bacteria | 1769 |
| 171 | Ga0070664_100495612 | 3300005564 | Bacteria | 1125 |
| 172 | Ga0070664_100770046 | 3300005564 | Bacteria | 899 |
| 173 | Ga0068857_100015547 | 3300005577 | Bacteria | 6649 |
| 174 | Ga0068857_100133252 | 3300005577 | Bacteria | 2242 |
| 175 | Ga0068857_100225298 | 3300005577 | Bacteria | 1713 |
| 176 | Ga0068857_100233169 | 3300005577 | Bacteria | 1684 |
| 177 | Ga0068854_100017334 | 3300005578 | Bacteria | 4819 |
| 178 | Ga0068854_100051213 | 3300005578 | Bacteria | 2957 |
| 179 | Ga0068854_100185115 | 3300005578 | Bacteria | 1629 |
| 180 | Ga0068854_100714372 | 3300005578 | Bacteria | 866 |
| 181 | Ga0068854_100742551 | 3300005578 | Bacteria | 851 |
| 182 | Ga0068854_100771845 | 3300005578 | Bacteria | 835 |
| 183 | Ga0068856_100984857 | 3300005614 | Bacteria | 862 |
| 184 | Ga0070702_100282860 | 3300005615 | Bacteria | 1140 |
| 185 | Ga0068852_100088342 | 3300005616 | Bacteria | 2768 |
| 186 | Ga0068852_100121904 | 3300005616 | Bacteria | 2389 |
| 187 | Ga0068852_100235400 | 3300005616 | Bacteria | 1748 |
| 188 | Ga0068852_100311921 | 3300005616 | Bacteria | 1525 |
| 189 | Ga0068852_100396906 | 3300005616 | Bacteria | 1356 |
| 190 | Ga0068852_100411859 | 3300005616 | Bacteria | 1332 |
| 191 | Ga0068852_100575719 | 3300005616 | Bacteria | 1128 |
| 192 | Ga0068852_101029463 | 3300005616 | Bacteria | 842 |
| 193 | Ga0068852_101090496 | 3300005616 | Bacteria | 818 |
| 194 | Ga0068859_100045775 | 3300005617 | Bacteria | 4395 |
| 195 | Ga0068859_100088510 | 3300005617 | Bacteria | 3146 |
| 196 | Ga0068859_100266898 | 3300005617 | Bacteria | 1803 |
| 197 | Ga0068859_100551423 | 3300005617 | Bacteria | 1247 |
| 198 | Ga0068859_100742780 | 3300005617 | Bacteria | 1070 |
| 199 | Ga0068864_100010084 | 3300005618 | Bacteria | 7803 |
| 200 | Ga0068864_100066231 | 3300005618 | Bacteria | 3135 |
| 201 | Ga0068864_100306639 | 3300005618 | Bacteria | 1487 |
| 202 | Ga0068864_100458777 | 3300005618 | Bacteria | 1220 |
| 203 | Ga0068864_100684424 | 3300005618 | Bacteria | 1001 |
| 204 | Ga0068864_100711254 | 3300005618 | Bacteria | 982 |
| 205 | Ga0068866_10006749 | 3300005718 | Bacteria | 4786 |
| 206 | Ga0068866_10391689 | 3300005718 | Bacteria | 894 |
| 207 | Ga0068861_100299232 | 3300005719 | Bacteria | 1393 |
| 208 | Ga0068851_10002715 | 3300005834 | Bacteria | 7792 |
| 209 | Ga0068851_10114074 | 3300005834 | Bacteria | 1446 |
| 210 | Ga0068851_10187922 | 3300005834 | Bacteria | 1147 |
| 211 | Ga0068851_10265089 | 3300005834 | Bacteria | 978 |
| 212 | Ga0068851_10308308 | 3300005834 | Bacteria | 912 |
| 213 | Ga0068863_100000616 | 3300005841 | Bacteria | 36095 |
| 214 | Ga0068863_100006484 | 3300005841 | Bacteria | 11474 |
| 215 | Ga0068863_100092085 | 3300005841 | Bacteria | 2875 |
| 216 | Ga0068863_100144044 | 3300005841 | Bacteria | 2279 |
| 217 | Ga0068858_100004194 | 3300005842 | Bacteria | 14189 |
| 218 | Ga0068858_100007187 | 3300005842 | Bacteria | 10794 |
| 219 | Ga0068858_100063635 | 3300005842 | Bacteria | 3413 |
| 220 | Ga0068858_100320673 | 3300005842 | Bacteria | 1481 |
| 221 | Ga0068858_100708757 | 3300005842 | Bacteria | 979 |
| 222 | Ga0068858_101484133 | 3300005842 | Bacteria | 668 |
| 223 | Ga0068860_100061719 | 3300005843 | Bacteria | 3561 |
| 224 | Ga0068860_100066587 | 3300005843 | Bacteria | 3421 |
| 225 | Ga0068860_100148559 | 3300005843 | Bacteria | 2256 |
| 226 | Ga0068860_100195121 | 3300005843 | Bacteria | 1961 |
| 227 | Ga0068860_100635252 | 3300005843 | Bacteria | 1075 |
| 228 | Ga0068862_100081634 | 3300005844 | Bacteria | 2805 |
| 229 | Ga0068862_100382267 | 3300005844 | Bacteria | 1313 |
| 230 | Ga0068862_100729128 | 3300005844 | Bacteria | 962 |
| 231 | Ga0068862_100730753 | 3300005844 | Bacteria | 961 |
| 232 | Ga0081539_10062552 | 3300005985 | Bacteria | 2034 |
| 233 | Ga0097621_100022615 | 3300006237 | Bacteria | 4882 |
| 234 | Ga0097621_100244088 | 3300006237 | Bacteria | 1571 |
| 235 | Ga0097621_100499238 | 3300006237 | Bacteria | 1102 |
| 236 | Ga0097621_101051707 | 3300006237 | Unclassified | 763 |
| 237 | Ga0068871_100208915 | 3300006358 | Bacteria | 1688 |
| 238 | Ga0068871_101088954 | 3300006358 | Bacteria | 747 |
| 239 | Ga0068871_101433663 | 3300006358 | Unclassified | 651 |
| 240 | Ga0068865_100040177 | 3300006881 | Bacteria | 3177 |
| 241 | Ga0068865_100044991 | 3300006881 | Bacteria | 3024 |
| 242 | Ga0068865_100133430 | 3300006881 | Bacteria | 1863 |
| 243 | Ga0068865_100325691 | 3300006881 | Bacteria | 1237 |
| 244 | Ga0097620_100045772 | 3300006931 | Bacteria | 4395 |
| 245 | Ga0097620_100088518 | 3300006931 | Bacteria | 3146 |
| 246 | Ga0097620_100266897 | 3300006931 | Bacteria | 1803 |
| 247 | Ga0097620_100551404 | 3300006931 | Bacteria | 1247 |
| 248 | Ga0097620_100742800 | 3300006931 | Bacteria | 1070 |
| 249 | Ga0075435_100510190 | 3300007076 | Bacteria | 1040 |
| 250 | Ga0105251_10101150 | 3300009011 | Bacteria | 1317 |
| 251 | Ga0105250_10272567 | 3300009092 | Bacteria | 727 |
| 252 | Ga0105245_10048004 | 3300009098 | Bacteria | 3818 |
| 253 | Ga0105245_10068217 | 3300009098 | Bacteria | 3222 |
| 254 | Ga0105245_10197442 | 3300009098 | Bacteria | 1931 |
| 255 | Ga0105245_10654205 | 3300009098 | Bacteria | 1081 |
| 256 | Ga0105243_10156449 | 3300009148 | Bacteria | 1960 |
| 257 | Ga0105243_10246758 | 3300009148 | Bacteria | 1592 |
| 258 | Ga0105241_10707824 | 3300009174 | Bacteria | 920 |
| 259 | Ga0105242_10896806 | 3300009176 | Bacteria | 886 |
| 260 | Ga0105248_10001411 | 3300009177 | Bacteria | 26840 |
| 261 | Ga0105248_10003908 | 3300009177 | Bacteria | 16478 |
| 262 | Ga0105248_10018999 | 3300009177 | Bacteria | 7598 |
| 263 | Ga0105248_10105359 | 3300009177 | Bacteria | 3179 |
| 264 | Ga0105248_10374413 | 3300009177 | Bacteria | 1603 |
| 265 | Ga0105248_10377469 | 3300009177 | Bacteria | 1596 |
| 266 | Ga0105248_10816550 | 3300009177 | Bacteria | 1052 |
| 267 | Ga0105248_11214028 | 3300009177 | Unclassified | 853 |
| 268 | Ga0105237_10630500 | 3300009545 | Bacteria | 1079 |
| 269 | Ga0105238_10207749 | 3300009551 | Bacteria | 1934 |
| 270 | Ga0105238_10619968 | 3300009551 | Bacteria | 1090 |
| 271 | Ga0105249_10013895 | 3300009553 | Bacteria | 7118 |
| 272 | Ga0105249_10603575 | 3300009553 | Bacteria | 1152 |
| 273 | Ga0105239_10085530 | 3300010375 | Bacteria | 3476 |
| 274 | Ga0105246_10142976 | 3300011119 | Bacteria | 1801 |
| 275 | Ga0105246_10159299 | 3300011119 | Bacteria | 1718 |
| 276 | Ga0105246_10421760 | 3300011119 | Bacteria | 1114 |
| 277 | Ga0157373_10043020 | 3300013100 | Bacteria | 3227 |
| 278 | Ga0157373_10122337 | 3300013100 | Bacteria | 1829 |
| 279 | Ga0157373_10174005 | 3300013100 | Bacteria | 1515 |
| 280 | Ga0157371_10028899 | 3300013102 | Bacteria | 4014 |
| 281 | Ga0157371_10081105 | 3300013102 | Bacteria | 2297 |
| 282 | Ga0157371_10335148 | 3300013102 | Bacteria | 1099 |
| 283 | Ga0157369_10522132 | 3300013105 | Bacteria | 1228 |
| 284 | Ga0157374_10004257 | 3300013296 | Bacteria | 12033 |
| 285 | Ga0157374_10030163 | 3300013296 | Bacteria | 4921 |
| 286 | Ga0157374_10277662 | 3300013296 | Bacteria | 1653 |
| 287 | Ga0157374_10341455 | 3300013296 | Bacteria | 1487 |
| 288 | Ga0157374_10382466 | 3300013296 | Bacteria | 1402 |
| 289 | Ga0157374_11835200 | 3300013296 | Unclassified | 632 |
| 290 | Ga0157378_10288740 | 3300013297 | Bacteria | 1583 |
| 291 | Ga0157378_10366194 | 3300013297 | Bacteria | 1412 |
| 292 | Ga0157378_10499479 | 3300013297 | Bacteria | 1215 |
| 293 | Ga0163162_10000645 | 3300013306 | Bacteria | 32309 |
| 294 | Ga0163162_10050129 | 3300013306 | Bacteria | 4187 |
| 295 | Ga0163162_11391322 | 3300013306 | Bacteria | 798 |
| 296 | Ga0163162_12295873 | 3300013306 | Unclassified | 620 |
| 297 | Ga0157372_10023759 | 3300013307 | Bacteria | 6649 |
| 298 | Ga0157372_11925914 | 3300013307 | Unclassified | 679 |
| 299 | Ga0157375_10013824 | 3300013308 | Bacteria | 7194 |
| 300 | Ga0157375_10021664 | 3300013308 | Bacteria | 5899 |
| 301 | Ga0157375_10537932 | 3300013308 | Bacteria | 1331 |
| 302 | Ga0157375_10587329 | 3300013308 | Bacteria | 1274 |
| 303 | Ga0157375_11378080 | 3300013308 | Bacteria | 830 |
| 304 | Ga0163163_10014438 | 3300014325 | Bacteria | 7261 |
| 305 | Ga0163163_10071584 | 3300014325 | Bacteria | 3455 |
| 306 | Ga0163163_10083214 | 3300014325 | Bacteria | 3205 |
| 307 | Ga0163163_10124736 | 3300014325 | Bacteria | 2612 |
| 308 | Ga0157377_10008557 | 3300014745 | Bacteria | 4993 |
| 309 | Ga0157379_10001782 | 3300014968 | Bacteria | 17776 |
| 310 | Ga0157379_10026764 | 3300014968 | Bacteria | 5134 |
| 311 | Ga0157379_10057142 | 3300014968 | Bacteria | 3487 |
| 312 | Ga0157379_10909005 | 3300014968 | Bacteria | 835 |
| 313 | Ga0163161_10367571 | 3300017792 | Bacteria | 1147 |
| 314 | Ga0213876_10039897 | 3300021384 | Bacteria | 2480 |
| 315 | Ga0207697_10021713 | 3300025315 | Bacteria | 2629 |
| 316 | Ga0207697_10219700 | 3300025315 | Bacteria | 838 |
| 317 | Ga0207656_10013560 | 3300025321 | Bacteria | 3119 |
| 318 | Ga0207656_10216066 | 3300025321 | Bacteria | 931 |
| 319 | Ga0207682_10008218 | 3300025893 | Bacteria | 4137 |
| 320 | Ga0207642_10040110 | 3300025899 | Bacteria | 2041 |
| 321 | Ga0207688_10025327 | 3300025901 | Bacteria | 3257 |
| 322 | Ga0207688_10041320 | 3300025901 | Bacteria | 2565 |
| 323 | Ga0207688_10141012 | 3300025901 | Bacteria | 1419 |
| 324 | Ga0207680_10005316 | 3300025903 | Bacteria | 6148 |
| 325 | Ga0207680_10005472 | 3300025903 | Bacteria | 6069 |
| 326 | Ga0207680_10013886 | 3300025903 | Bacteria | 4151 |
| 327 | Ga0207680_10025541 | 3300025903 | Bacteria | 3260 |
| 328 | Ga0207680_10122207 | 3300025903 | Bacteria | 1704 |
| 329 | Ga0207680_10160456 | 3300025903 | Bacteria | 1507 |
| 330 | Ga0207680_10444685 | 3300025903 | Bacteria | 920 |
| 331 | Ga0207647_10003939 | 3300025904 | Bacteria | 11083 |
| 332 | Ga0207647_10014370 | 3300025904 | Bacteria | 5458 |
| 333 | Ga0207645_10036726 | 3300025907 | Bacteria | 3146 |
| 334 | Ga0207645_10102840 | 3300025907 | Bacteria | 1844 |
| 335 | Ga0207645_10109045 | 3300025907 | Bacteria | 1791 |
| 336 | Ga0207645_10174139 | 3300025907 | Bacteria | 1411 |
| 337 | Ga0207645_10178160 | 3300025907 | Bacteria | 1394 |
| 338 | Ga0207643_10122743 | 3300025908 | Bacteria | 1540 |
| 339 | Ga0207705_10003103 | 3300025909 | Bacteria | 12670 |
| 340 | Ga0207705_10004954 | 3300025909 | Bacteria | 9997 |
| 341 | Ga0207705_10130873 | 3300025909 | Bacteria | 1867 |
| 342 | Ga0207705_10218103 | 3300025909 | Bacteria | 1448 |
| 343 | Ga0207705_10428860 | 3300025909 | Bacteria | 1024 |
| 344 | Ga0207662_10160306 | 3300025918 | Bacteria | 1437 |
| 345 | Ga0207662_10203519 | 3300025918 | Bacteria | 1282 |
| 346 | Ga0207657_10008170 | 3300025919 | Bacteria | 10663 |
| 347 | Ga0207657_10019353 | 3300025919 | Bacteria | 6468 |
| 348 | Ga0207657_10200823 | 3300025919 | Bacteria | 1604 |
| 349 | Ga0207657_10514929 | 3300025919 | Bacteria | 937 |
| 350 | Ga0207657_10564964 | 3300025919 | Bacteria | 889 |
| 351 | Ga0207657_10940270 | 3300025919 | Bacteria | 665 |
| 352 | Ga0207649_10025348 | 3300025920 | Bacteria | 3456 |
| 353 | Ga0207649_10041227 | 3300025920 | Bacteria | 2810 |
| 354 | Ga0207649_10057363 | 3300025920 | Bacteria | 2435 |
| 355 | Ga0207649_10071522 | 3300025920 | Bacteria | 2216 |
| 356 | Ga0207649_10109523 | 3300025920 | Bacteria | 1843 |
| 357 | Ga0207649_10211799 | 3300025920 | Bacteria | 1375 |
| 358 | Ga0207649_10619719 | 3300025920 | Bacteria | 834 |
| 359 | Ga0207649_10632779 | 3300025920 | Bacteria | 825 |
| 360 | Ga0207649_10840760 | 3300025920 | Unclassified | 718 |
| 361 | Ga0207681_10169137 | 3300025923 | Bacteria | 1655 |
| 362 | Ga0207681_10182457 | 3300025923 | Bacteria | 1600 |
| 363 | Ga0207694_10239640 | 3300025924 | Bacteria | 1482 |
| 364 | Ga0207650_10016148 | 3300025925 | Bacteria | 5213 |
| 365 | Ga0207650_10018523 | 3300025925 | Bacteria | 4886 |
| 366 | Ga0207650_10025993 | 3300025925 | Bacteria | 4173 |
| 367 | Ga0207650_10040083 | 3300025925 | Bacteria | 3426 |
| 368 | Ga0207650_10138955 | 3300025925 | Bacteria | 1908 |
| 369 | Ga0207650_10293004 | 3300025925 | Bacteria | 1327 |
| 370 | Ga0207650_10650950 | 3300025925 | Bacteria | 888 |
| 371 | Ga0207650_10954520 | 3300025925 | Bacteria | 729 |
| 372 | Ga0207659_10052602 | 3300025926 | Bacteria | 2902 |
| 373 | Ga0207659_10101363 | 3300025926 | Bacteria | 2171 |
| 374 | Ga0207687_10017705 | 3300025927 | Bacteria | 4695 |
| 375 | Ga0207687_10109576 | 3300025927 | Bacteria | 2046 |
| 376 | Ga0207687_10324423 | 3300025927 | Bacteria | 1247 |
| 377 | Ga0207644_10004377 | 3300025931 | Bacteria | 9166 |
| 378 | Ga0207644_10008224 | 3300025931 | Bacteria | 6833 |
| 379 | Ga0207644_10010174 | 3300025931 | Bacteria | 6197 |
| 380 | Ga0207644_10076393 | 3300025931 | Bacteria | 2464 |
| 381 | Ga0207644_10120867 | 3300025931 | Bacteria | 1994 |
| 382 | Ga0207644_10308873 | 3300025931 | Bacteria | 1276 |
| 383 | Ga0207644_10945355 | 3300025931 | Bacteria | 723 |
| 384 | Ga0207690_10007764 | 3300025932 | Bacteria | 6370 |
| 385 | Ga0207690_10008141 | 3300025932 | Bacteria | 6221 |
| 386 | Ga0207690_10039855 | 3300025932 | Bacteria | 3067 |
| 387 | Ga0207690_10117963 | 3300025932 | Bacteria | 1922 |
| 388 | Ga0207690_10405984 | 3300025932 | Bacteria | 1087 |
| 389 | Ga0207706_10000742 | 3300025933 | Bacteria | 33946 |
| 390 | Ga0207706_10000893 | 3300025933 | Bacteria | 30622 |
| 391 | Ga0207706_10004043 | 3300025933 | Bacteria | 13878 |
| 392 | Ga0207706_10011556 | 3300025933 | Bacteria | 8040 |
| 393 | Ga0207706_10018841 | 3300025933 | Bacteria | 6207 |
| 394 | Ga0207706_10036685 | 3300025933 | Bacteria | 4354 |
| 395 | Ga0207706_10072603 | 3300025933 | Bacteria | 3027 |
| 396 | Ga0207706_10114309 | 3300025933 | Bacteria | 2374 |
| 397 | Ga0207706_10264113 | 3300025933 | Bacteria | 1502 |
| 398 | Ga0207706_10276530 | 3300025933 | Bacteria | 1465 |
| 399 | Ga0207709_10068490 | 3300025935 | Bacteria | 2243 |
| 400 | Ga0207669_10108034 | 3300025937 | Bacteria | 1857 |
| 401 | Ga0207669_10483542 | 3300025937 | Bacteria | 987 |
| 402 | Ga0207669_10596151 | 3300025937 | Bacteria | 897 |
| 403 | Ga0207704_10007623 | 3300025938 | Bacteria | 5126 |
| 404 | Ga0207704_10109742 | 3300025938 | Bacteria | 1862 |
| 405 | Ga0207704_10241090 | 3300025938 | Bacteria | 1351 |
| 406 | Ga0207704_10268910 | 3300025938 | Bacteria | 1290 |
| 407 | Ga0207691_10000820 | 3300025940 | Bacteria | 30962 |
| 408 | Ga0207691_10005345 | 3300025940 | Bacteria | 12394 |
| 409 | Ga0207691_10013135 | 3300025940 | Bacteria | 7928 |
| 410 | Ga0207691_10066301 | 3300025940 | Bacteria | 3266 |
| 411 | Ga0207691_10105143 | 3300025940 | Bacteria | 2515 |
| 412 | Ga0207711_10001274 | 3300025941 | Bacteria | 23890 |
| 413 | Ga0207711_10004315 | 3300025941 | Bacteria | 12151 |
| 414 | Ga0207711_10007890 | 3300025941 | Bacteria | 8902 |
| 415 | Ga0207711_10015675 | 3300025941 | Bacteria | 6286 |
| 416 | Ga0207711_10125118 | 3300025941 | Bacteria | 2299 |
| 417 | Ga0207711_10557334 | 3300025941 | Bacteria | 1069 |
| 418 | Ga0207711_10579790 | 3300025941 | Bacteria | 1046 |
| 419 | Ga0207689_10023182 | 3300025942 | Bacteria | 5211 |
| 420 | Ga0207689_10035485 | 3300025942 | Bacteria | 4142 |
| 421 | Ga0207689_10279293 | 3300025942 | Bacteria | 1383 |
| 422 | Ga0207689_10420103 | 3300025942 | Bacteria | 1116 |
| 423 | Ga0207661_10095297 | 3300025944 | Bacteria | 2488 |
| 424 | Ga0207661_10814020 | 3300025944 | Bacteria | 860 |
| 425 | Ga0207661_11185691 | 3300025944 | Bacteria | 703 |
| 426 | Ga0207679_10004636 | 3300025945 | Bacteria | 8556 |
| 427 | Ga0207679_10056175 | 3300025945 | Bacteria | 2905 |
| 428 | Ga0207679_10106452 | 3300025945 | Bacteria | 2204 |
| 429 | Ga0207679_10143780 | 3300025945 | Bacteria | 1932 |
| 430 | Ga0207679_10153164 | 3300025945 | Bacteria | 1879 |
| 431 | Ga0207679_10158306 | 3300025945 | Bacteria | 1851 |
| 432 | Ga0207679_10570475 | 3300025945 | Bacteria | 1017 |
| 433 | Ga0207667_10022584 | 3300025949 | Bacteria | 6944 |
| 434 | Ga0207667_10679885 | 3300025949 | Bacteria | 1033 |
| 435 | Ga0207651_10015279 | 3300025960 | Bacteria | 4456 |
| 436 | Ga0207651_10020635 | 3300025960 | Bacteria | 3982 |
| 437 | Ga0207651_10025830 | 3300025960 | Bacteria | 3657 |
| 438 | Ga0207651_10166768 | 3300025960 | Bacteria | 1732 |
| 439 | Ga0207651_10265791 | 3300025960 | Bacteria | 1410 |
| 440 | Ga0207651_10309706 | 3300025960 | Bacteria | 1316 |
| 441 | Ga0207712_10002542 | 3300025961 | Bacteria | 11728 |
| 442 | Ga0207712_10604818 | 3300025961 | Bacteria | 949 |
| 443 | Ga0207668_10140995 | 3300025972 | Bacteria | 1854 |
| 444 | Ga0207668_10196874 | 3300025972 | Bacteria | 1602 |
| 445 | Ga0207668_10336687 | 3300025972 | Bacteria | 1257 |
| 446 | Ga0207640_10006679 | 3300025981 | Bacteria | 6339 |
| 447 | Ga0207640_10051244 | 3300025981 | Bacteria | 2682 |
| 448 | Ga0207640_10064855 | 3300025981 | Bacteria | 2434 |
| 449 | Ga0207640_10232852 | 3300025981 | Bacteria | 1418 |
| 450 | Ga0207640_10257496 | 3300025981 | Bacteria | 1358 |
| 451 | Ga0207640_10493687 | 3300025981 | Bacteria | 1018 |
| 452 | Ga0207640_10570229 | 3300025981 | Bacteria | 954 |
| 453 | Ga0207658_10001885 | 3300025986 | Bacteria | 15696 |
| 454 | Ga0207658_10007523 | 3300025986 | Bacteria | 7419 |
| 455 | Ga0207658_10008648 | 3300025986 | Bacteria | 6921 |
| 456 | Ga0207658_10017392 | 3300025986 | Bacteria | 4953 |
| 457 | Ga0207658_10071299 | 3300025986 | Bacteria | 2631 |
| 458 | Ga0207658_10117946 | 3300025986 | Bacteria | 2110 |
| 459 | Ga0207658_10321305 | 3300025986 | Bacteria | 1340 |
| 460 | Ga0207658_10326170 | 3300025986 | Bacteria | 1330 |
| 461 | Ga0207658_10438386 | 3300025986 | Bacteria | 1155 |
| 462 | Ga0207658_10569889 | 3300025986 | Bacteria | 1015 |
| 463 | Ga0207677_10000890 | 3300026023 | Bacteria | 16790 |
| 464 | Ga0207677_10064764 | 3300026023 | Bacteria | 2547 |
| 465 | Ga0207677_10125417 | 3300026023 | Bacteria | 1940 |
| 466 | Ga0207677_10143124 | 3300026023 | Bacteria | 1834 |
| 467 | Ga0207677_10266324 | 3300026023 | Bacteria | 1399 |
| 468 | Ga0207677_10318573 | 3300026023 | Bacteria | 1291 |
| 469 | Ga0207677_10597282 | 3300026023 | Bacteria | 968 |
| 470 | Ga0207703_10003017 | 3300026035 | Bacteria | 14263 |
| 471 | Ga0207703_10027953 | 3300026035 | Bacteria | 4441 |
| 472 | Ga0207703_10255557 | 3300026035 | Bacteria | 1582 |
| 473 | Ga0207703_10415808 | 3300026035 | Bacteria | 1250 |
| 474 | Ga0207639_10144631 | 3300026041 | Bacteria | 1985 |
| 475 | Ga0207639_10313157 | 3300026041 | Bacteria | 1391 |
| 476 | Ga0207639_10362512 | 3300026041 | Bacteria | 1297 |
| 477 | Ga0207639_10518794 | 3300026041 | Bacteria | 1091 |
| 478 | Ga0207639_10796789 | 3300026041 | Bacteria | 880 |
| 479 | Ga0207678_10000558 | 3300026067 | Bacteria | 34014 |
| 480 | Ga0207678_10001651 | 3300026067 | Bacteria | 20438 |
| 481 | Ga0207678_10005870 | 3300026067 | Bacteria | 10947 |
| 482 | Ga0207678_10115782 | 3300026067 | Bacteria | 2287 |
| 483 | Ga0207678_10228086 | 3300026067 | Bacteria | 1595 |
| 484 | Ga0207678_10302667 | 3300026067 | Bacteria | 1374 |
| 485 | Ga0207678_10513188 | 3300026067 | Bacteria | 1046 |
| 486 | Ga0207702_10497558 | 3300026078 | Bacteria | 1188 |
| 487 | Ga0207702_10624504 | 3300026078 | Bacteria | 1058 |
| 488 | Ga0207641_10003074 | 3300026088 | Bacteria | 15050 |
| 489 | Ga0207641_10013048 | 3300026088 | Bacteria | 6815 |
| 490 | Ga0207641_10051781 | 3300026088 | Bacteria | 3477 |
| 491 | Ga0207641_10250929 | 3300026088 | Bacteria | 1652 |
| 492 | Ga0207641_11368771 | 3300026088 | Bacteria | 709 |
| 493 | Ga0207648_10005192 | 3300026089 | Bacteria | 13188 |
| 494 | Ga0207648_10005560 | 3300026089 | Bacteria | 12686 |
| 495 | Ga0207648_10087242 | 3300026089 | Bacteria | 2723 |
| 496 | Ga0207648_10095447 | 3300026089 | Bacteria | 2601 |
| 497 | Ga0207648_10947568 | 3300026089 | Bacteria | 805 |
| 498 | Ga0207676_10007129 | 3300026095 | Bacteria | 7918 |
| 499 | Ga0207676_10059822 | 3300026095 | Bacteria | 3010 |
| 500 | Ga0207676_10495068 | 3300026095 | Bacteria | 1160 |
| 501 | Ga0207676_10496341 | 3300026095 | Bacteria | 1158 |
| 502 | Ga0207676_10507507 | 3300026095 | Bacteria | 1146 |
| 503 | Ga0207674_10001601 | 3300026116 | Bacteria | 29155 |
| 504 | Ga0207674_10002680 | 3300026116 | Bacteria | 22216 |
| 505 | Ga0207674_10007257 | 3300026116 | Bacteria | 12920 |
| 506 | Ga0207674_10019167 | 3300026116 | Bacteria | 7418 |
| 507 | Ga0207674_10039628 | 3300026116 | Bacteria | 4883 |
| 508 | Ga0207674_11255945 | 3300026116 | Bacteria | 710 |
| 509 | Ga0207675_100157398 | 3300026118 | Bacteria | 2165 |
| 510 | Ga0207683_10007896 | 3300026121 | Bacteria | 9102 |
| 511 | Ga0207683_10019662 | 3300026121 | Bacteria | 5770 |
| 512 | Ga0207683_10046328 | 3300026121 | Bacteria | 3805 |
| 513 | Ga0207683_10133954 | 3300026121 | Bacteria | 2230 |
| 514 | Ga0207698_10116555 | 3300026142 | Bacteria | 2251 |
| 515 | Ga0207698_10121945 | 3300026142 | Bacteria | 2208 |
| 516 | Ga0207698_10140337 | 3300026142 | Bacteria | 2081 |
| 517 | Ga0207698_10157645 | 3300026142 | Bacteria | 1980 |
| 518 | Ga0207698_10166044 | 3300026142 | Bacteria | 1937 |
| 519 | Ga0207698_10174346 | 3300026142 | Bacteria | 1897 |
| 520 | Ga0207698_10188095 | 3300026142 | Bacteria | 1836 |
| 521 | Ga0207698_10220108 | 3300026142 | Bacteria | 1715 |
| 522 | Ga0207698_10432273 | 3300026142 | Bacteria | 1266 |
| 523 | Ga0268266_10010106 | 3300028379 | Bacteria | 8274 |
| 524 | Ga0268266_10150624 | 3300028379 | Bacteria | 2096 |
| 525 | Ga0268265_10144046 | 3300028380 | Bacteria | 1999 |
| 526 | Ga0268265_10291751 | 3300028380 | Bacteria | 1464 |
| 527 | Ga0268265_10632620 | 3300028380 | Bacteria | 1026 |
| 528 | Ga0268264_10007642 | 3300028381 | Bacteria | 9010 |
| 529 | Ga0268264_10029770 | 3300028381 | Bacteria | 4474 |
| 530 | Ga0268264_10210676 | 3300028381 | Bacteria | 1784 |
| 531 | Ga0268264_10433370 | 3300028381 | Bacteria | 1270 |
| 532 | Ga0268264_10440128 | 3300028381 | Bacteria | 1261 |
| 533 | Ga0307408_100121665 | 3300031548 | Bacteria | 2023 |
| 534 | Ga0307408_100200839 | 3300031548 | Bacteria | 1613 |
| 535 | Ga0307405_10204901 | 3300031731 | Bacteria | 1435 |
| 536 | Ga0307405_10785965 | 3300031731 | Bacteria | 796 |
| 537 | Ga0307413_10165600 | 3300031824 | Bacteria | 1558 |
| 538 | Ga0307413_10306613 | 3300031824 | Bacteria | 1206 |
| 539 | Ga0307410_10670604 | 3300031852 | Bacteria | 871 |
| 540 | Ga0307406_10222113 | 3300031901 | Bacteria | 1405 |
| 541 | Ga0307406_10603114 | 3300031901 | Bacteria | 905 |
| 542 | Ga0307412_10500473 | 3300031911 | Bacteria | 1011 |
| 543 | Ga0307409_100108393 | 3300031995 | Bacteria | 2323 |
| 544 | Ga0307416_100006146 | 3300032002 | Bacteria | 7484 |
| 545 | Ga0307416_100245785 | 3300032002 | Bacteria | 1737 |
| 546 | Ga0307416_101845024 | 3300032002 | Unclassified | 708 |
| 547 | Ga0307411_10186562 | 3300032005 | Bacteria | 1579 |
| 548 | Ga0307411_10250357 | 3300032005 | Bacteria | 1392 |
| 549 | Ga0307415_100009011 | 3300032126 | Bacteria | 5566 |
| 550 | Ga0307415_100284462 | 3300032126 | Bacteria | 1361 |
| 551 | Ga0307415_100450701 | 3300032126 | Bacteria | 1112 |
| 552 | Ga0307415_101301272 | 3300032126 | Unclassified | 688 |
| 553 | Ga0373945_0069172 | 3300035116 | Bacteria | 1333 |
| 554 | Ga0373946_0100125 | 3300035171 | Bacteria | 1298 |
| 555 | Ga0373946_0279511 | 3300035171 | Bacteria | 821 |
| 556 | Ga0373962_0222350 | 3300035242 | Bacteria | 647 |
| 557 | Ga0373935_0233231 | 3300035692 | Bacteria | 1282 |
| 558 | Ga0373947_0095669 | 3300035725 | Bacteria | 1859 |
| 559 | Ga0373925_0126560 | 3300037068 | Bacteria | 1988 |
| 560 | Ga0395899_0368419 | 3300037312 | Bacteria | 957 |
| 561 | Ga0395900_0051457 | 3300037418 | Bacteria | 4243 |
| 562 | Ga0395900_0098248 | 3300037418 | Bacteria | 3008 |
| 563 | Ga0395900_0122741 | 3300037418 | Bacteria | 2664 |
| 564 | Ga0395900_0244574 | 3300037418 | Bacteria | 1798 |
| 565 | Ga0395900_0422899 | 3300037418 | Bacteria | 1293 |
| 566 | Ga0395900_0488890 | 3300037418 | Bacteria | 1182 |
| 567 | Ga0395900_0547656 | 3300037418 | Bacteria | 1102 |
| 568 | Ga0395900_0686531 | 3300037418 | Bacteria | 958 |
| 569 | Ga0395900_0711208 | 3300037418 | Unclassified | 937 |
| 570 | Ga0395898_0370582 | 3300037466 | Bacteria | 1366 |
| 571 | Ga0395898_0428129 | 3300037466 | Bacteria | 1261 |
| 572 | Ga0395898_1861026 | 3300037466 | Unclassified | 522 |
| 573 | Ga0395905_0011255 | 3300037471 | Bacteria | 8650 |
| 574 | Ga0395905_0016471 | 3300037471 | Bacteria | 7027 |
| 575 | Ga0395905_0037948 | 3300037471 | Bacteria | 4521 |
| 576 | Ga0395905_0038845 | 3300037471 | Bacteria | 4465 |
| 577 | Ga0395905_0072518 | 3300037471 | Bacteria | 3228 |
| 578 | Ga0395905_0117794 | 3300037471 | Bacteria | 2496 |
| 579 | Ga0395905_0127390 | 3300037471 | Bacteria | 2394 |
| 580 | Ga0395905_0229896 | 3300037471 | Bacteria | 1734 |
| 581 | Ga0395905_0308781 | 3300037471 | Bacteria | 1470 |
| 582 | Ga0395905_0649003 | 3300037471 | Bacteria | 957 |
| 583 | Ga0395905_0769264 | 3300037471 | Bacteria | 866 |
| 584 | Ga0395905_0819994 | 3300037471 | Unclassified | 833 |
| 585 | Ga0395905_1642610 | 3300037471 | Unclassified | 547 |
| 586 | Ga0395905_1786205 | 3300037471 | Unclassified | 520 |
| 587 | Ga0395901_0055360 | 3300038443 | Bacteria | 4125 |
| 588 | Ga0395901_0087707 | 3300038443 | Bacteria | 3254 |
| 589 | Ga0395901_0094734 | 3300038443 | Bacteria | 3128 |
| 590 | Ga0395901_0133521 | 3300038443 | Bacteria | 2609 |
| 591 | Ga0395901_0144456 | 3300038443 | Bacteria | 2501 |
| 592 | Ga0395901_0145798 | 3300038443 | Bacteria | 2488 |
| 593 | Ga0395901_0233924 | 3300038443 | Bacteria | 1918 |
| 594 | Ga0395901_0563040 | 3300038443 | Bacteria | 1154 |
| 595 | Ga0395901_0723868 | 3300038443 | Bacteria | 990 |
| 596 | Ga0395901_1049794 | 3300038443 | Bacteria | 788 |
| 597 | Ga0436365_0615625 | 3300039437 | Bacteria | 10749 |
| 598 | Ga0439449_0112669 | 3300042007 | Bacteria | 1008 |
| 599 | Ga0466969_0214982 | 3300044656 | Bacteria | 875 |
| 600 | Ga0466972_0195020 | 3300044658 | Bacteria | 949 |
| 601 | Ga0466966_0159427 | 3300044684 | Bacteria | 1374 |
| 602 | Ga0466961_0240679 | 3300044693 | Bacteria | 1112 |
| 603 | Ga0466963_0131466 | 3300044694 | Bacteria | 1729 |
| 604 | Ga0466964_0009075 | 3300044706 | Bacteria | 3740 |
| 605 | Ga0466964_0049800 | 3300044706 | Bacteria | 1716 |
| 606 | Ga0466970_0006659 | 3300044765 | Bacteria | 5777 |
| 607 | Ga0466970_0206476 | 3300044765 | Bacteria | 1094 |
| 608 | Ga0466957_0023627 | 3300044842 | Bacteria | 3635 |
| 609 | Ga0466958_0070961 | 3300045836 | Bacteria | 2132 |
| 610 | Ga0466958_0163225 | 3300045836 | Bacteria | 1408 |
| 611 | Ga0466967_0026767 | 3300045976 | Bacteria | 4784 |
| 612 | Ga0495629_0348390 | 3300046459 | Bacteria | 1011 |
| 613 | Ga0495621_0000183 | 3300046539 | Bacteria | 14351 |
| 614 | Ga0495621_0063417 | 3300046539 | Bacteria | 1346 |
| 615 | Ga0495668_0239633 | 3300046616 | Bacteria | 993 |
| 616 | Ga0495669_0100617 | 3300046684 | Bacteria | 1342 |
| 617 | Ga0495669_0255306 | 3300046684 | Bacteria | 842 |
| 618 | Ga0495670_0005394 | 3300046691 | Bacteria | 6283 |
| 619 | Ga0495670_0136025 | 3300046691 | Bacteria | 1283 |
| 620 | Ga0496100_0459970 | 3300048903 | Bacteria | 976 |
| 621 | Ga0496101_0015261 | 3300048904 | Bacteria | 5172 |
| 622 | Ga0496101_0044620 | 3300048904 | Bacteria | 3172 |
| 623 | Ga0496101_0111094 | 3300048904 | Bacteria | 2063 |
| 624 | Ga0496101_0234621 | 3300048904 | Bacteria | 1427 |
| 625 | Ga0496101_0321892 | 3300048904 | Bacteria | 1213 |
| 626 | Ga0496101_0982892 | 3300048904 | Unclassified | 664 |
| 627 | Ga0496102_0085007 | 3300048905 | Bacteria | 2921 |
| 628 | Ga0496102_0275531 | 3300048905 | Bacteria | 1586 |
| 629 | Ga0496102_0602910 | 3300048905 | Bacteria | 1021 |
| 630 | Ga0496103_0130767 | 3300048906 | Bacteria | 1603 |
| 631 | Ga0496103_0132032 | 3300048906 | Bacteria | 1595 |
| 632 | Ga0496103_0543422 | 3300048906 | Bacteria | 742 |
| 633 | Ga0496104_0081963 | 3300048907 | Bacteria | 3077 |
| 634 | Ga0496106_0075995 | 3300048909 | Bacteria | 2574 |
| 635 | Ga0496106_0683910 | 3300048909 | Bacteria | 818 |
| 636 | Ga0496107_0002167 | 3300048910 | Bacteria | 12611 |
| 637 | Ga0496107_0020747 | 3300048910 | Bacteria | 4643 |
| 638 | Ga0496107_0051032 | 3300048910 | Bacteria | 2983 |
| 639 | Ga0496107_0084173 | 3300048910 | Bacteria | 2320 |
| 640 | Ga0496107_0432227 | 3300048910 | Bacteria | 979 |
| 641 | Ga0496108_0001354 | 3300048911 | Bacteria | 19266 |
| 642 | Ga0496108_0002739 | 3300048911 | Bacteria | 14094 |
| 643 | Ga0496108_0064742 | 3300048911 | Bacteria | 3080 |
| 644 | Ga0496108_0354992 | 3300048911 | Bacteria | 1279 |
| 645 | Ga0496109_0003600 | 3300048912 | Bacteria | 12942 |
| 646 | Ga0496109_0033166 | 3300048912 | Bacteria | 4644 |
| 647 | Ga0496109_0326458 | 3300048912 | Bacteria | 1448 |
| 648 | Ga0496110_0010292 | 3300048913 | Bacteria | 7601 |
| 649 | Ga0496111_0006954 | 3300048914 | Bacteria | 7384 |
| 650 | Ga0496111_0077057 | 3300048914 | Bacteria | 2430 |
| 651 | Ga0496111_0097256 | 3300048914 | Bacteria | 2161 |
| 652 | Ga0496111_0273357 | 3300048914 | Bacteria | 1253 |
| 653 | Ga0496111_0390642 | 3300048914 | Bacteria | 1029 |
| 654 | Ga0496111_0579275 | 3300048914 | Bacteria | 822 |
| 655 | Ga0496112_0024097 | 3300048915 | Bacteria | 5824 |
| 656 | Ga0496112_0044416 | 3300048915 | Bacteria | 4353 |
| 657 | Ga0496112_0143243 | 3300048915 | Bacteria | 2359 |
| 658 | Ga0496112_0324766 | 3300048915 | Bacteria | 1483 |
| 659 | Ga0496112_1108265 | 3300048915 | Unclassified | 710 |
| 660 | Ga0496113_0038849 | 3300048916 | Bacteria | 3501 |
| 661 | Ga0496113_0105347 | 3300048916 | Bacteria | 2189 |
| 662 | Ga0496113_0291569 | 3300048916 | Bacteria | 1305 |
| 663 | Ga0496114_0131015 | 3300048917 | Bacteria | 2165 |
| 664 | Ga0496115_0036712 | 3300048918 | Bacteria | 3881 |
| 665 | Ga0501217_105821 | 3300049661 | Bacteria | 804 |
| 666 | Ga0501230_010693 | 3300049667 | Bacteria | 1439 |
| 667 | Ga0501235_085822 | 3300049669 | Bacteria | 756 |
| 668 | Ga0501249_027203 | 3300049679 | Bacteria | 1265 |
| 669 | nmdc:mga0n895_270595_c1 | 3300050512 | Bacteria | 1723 |
| 670 | nmdc:mga0rr50_540501_c1 | 3300050513 | Bacteria | 992 |
| 671 | nmdc:mga0a205_822_c1 | 3300050515 | Bacteria | 25262 |
| 672 | Ga0466962_0007379 | 3300061719 | Bacteria | 5275 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037418 | Ga0395900_0488890 | Ga0395900_0488890_52_528 | 150 |
| 2 | 3300037466 | Ga0395898_1861026 | Ga0395898_1861026_12_479 | 155 |
| 3 | 3300037471 | Ga0395905_1642610 | Ga0395905_1642610_66_533 | 155 |
| 4 | 3300037471 | Ga0395905_1786205 | Ga0395905_1786205_41_508 | 155 |
| 5 | 3300013307 | Ga0157372_11925914 | Ga0157372_119259141 | 158 |
| 6 | 3300050512 | nmdc:mga0n895_270595_c1 | nmdc:mga0n895_270595_c1_30_515 | 161 |
| 7 | 3300050513 | nmdc:mga0rr50_540501_c1 | nmdc:mga0rr50_540501_c1_487_972 | 161 |
| 8 | 3300013296 | Ga0157374_10341455 | Ga0157374_103414552 | 163 |
| 9 | 3300035116 | Ga0373945_0069172 | Ga0373945_0069172_469_987 | 169 |
| 10 | 3300005329 | Ga0070683_100148560 | Ga0070683_1001485602 | 170 |
| 11 | 3300005457 | Ga0070662_100055180 | Ga0070662_1000551803 | 170 |
| 12 | 3300009551 | Ga0105238_10619968 | Ga0105238_106199682 | 170 |
| 13 | 3300011119 | Ga0105246_10159299 | Ga0105246_101592992 | 170 |
| 14 | 3300025932 | Ga0207690_10008141 | Ga0207690_100081417 | 170 |
| 15 | 3300025933 | Ga0207706_10018841 | Ga0207706_100188414 | 170 |
| 16 | 3300026041 | Ga0207639_10518794 | Ga0207639_105187941 | 170 |
| 17 | 3300026142 | Ga0207698_10220108 | Ga0207698_102201082 | 170 |
| 18 | 3300037312 | Ga0395899_0368419 | Ga0395899_0368419_163_702 | 170 |
| 19 | 3300037418 | Ga0395900_0244574 | Ga0395900_0244574_106_645 | 170 |
| 20 | 3300037418 | Ga0395900_0422899 | Ga0395900_0422899_337_876 | 170 |
| 21 | 3300037418 | Ga0395900_0711208 | Ga0395900_0711208_351_914 | 170 |
| 22 | 3300037466 | Ga0395898_0428129 | Ga0395898_0428129_400_939 | 170 |
| 23 | 3300037471 | Ga0395905_0011255 | Ga0395905_0011255_3248_3787 | 170 |
| 24 | 3300037471 | Ga0395905_0117794 | Ga0395905_0117794_1531_2070 | 170 |
| 25 | 3300037471 | Ga0395905_0229896 | Ga0395905_0229896_229_768 | 170 |
| 26 | 3300037471 | Ga0395905_0649003 | Ga0395905_0649003_397_936 | 170 |
| 27 | 3300038443 | Ga0395901_0055360 | Ga0395901_0055360_87_626 | 170 |
| 28 | 3300038443 | Ga0395901_0144456 | Ga0395901_0144456_795_1334 | 170 |
| 29 | 3300038443 | Ga0395901_0145798 | Ga0395901_0145798_114_677 | 170 |
| 30 | 3300038443 | Ga0395901_0723868 | Ga0395901_0723868_73_612 | 170 |
| 31 | 3300005367 | Ga0070667_100002154 | Ga0070667_1000021546 | 171 |
| 32 | 3300005843 | Ga0068860_100148559 | Ga0068860_1001485593 | 171 |
| 33 | 3300009177 | Ga0105248_10003908 | Ga0105248_100039086 | 171 |
| 34 | 3300014968 | Ga0157379_10026764 | Ga0157379_100267643 | 171 |
| 35 | 3300017792 | Ga0163161_10367571 | Ga0163161_103675711 | 171 |
| 36 | 3300025941 | Ga0207711_10004315 | Ga0207711_100043154 | 171 |
| 37 | 3300025986 | Ga0207658_10007523 | Ga0207658_100075235 | 171 |
| 38 | 3300026035 | Ga0207703_10255557 | Ga0207703_102555572 | 171 |
| 39 | 3300048914 | Ga0496111_0390642 | Ga0496111_0390642_194_733 | 171 |
| 40 | 3300035171 | Ga0373946_0279511 | Ga0373946_0279511_51_578 | 173 |
| 41 | 3300005293 | Ga0065715_10445978 | Ga0065715_104459781 | 175 |
| 42 | 3300005331 | Ga0070670_100037311 | Ga0070670_1000373113 | 175 |
| 43 | 3300005331 | Ga0070670_100231757 | Ga0070670_1002317572 | 175 |
| 44 | 3300005339 | Ga0070660_100196915 | Ga0070660_1001969152 | 175 |
| 45 | 3300005367 | Ga0070667_101407426 | Ga0070667_1014074261 | 175 |
| 46 | 3300005435 | Ga0070714_100038119 | Ga0070714_1000381194 | 175 |
| 47 | 3300005457 | Ga0070662_101190864 | Ga0070662_1011908641 | 175 |
| 48 | 3300005548 | Ga0070665_100485298 | Ga0070665_1004852982 | 175 |
| 49 | 3300005564 | Ga0070664_100495612 | Ga0070664_1004956122 | 175 |
| 50 | 3300005577 | Ga0068857_100225298 | Ga0068857_1002252982 | 175 |
| 51 | 3300025925 | Ga0207650_10018523 | Ga0207650_100185233 | 175 |
| 52 | 3300025925 | Ga0207650_10954520 | Ga0207650_109545201 | 175 |
| 53 | 3300026116 | Ga0207674_10019167 | Ga0207674_100191673 | 175 |
| 54 | 3300037418 | Ga0395900_0098248 | Ga0395900_0098248_571_1113 | 175 |
| 55 | 3300037471 | Ga0395905_0037948 | Ga0395905_0037948_3812_4345 | 175 |
| 56 | 3300037471 | Ga0395905_0769264 | Ga0395905_0769264_18_551 | 175 |
| 57 | 3300038443 | Ga0395901_0233924 | Ga0395901_0233924_361_903 | 175 |
| 58 | 3300048911 | Ga0496108_0002739 | Ga0496108_0002739_10599_11132 | 175 |
| 59 | 3300001989 | JGI24739J22299_10001515 | JGI24739J22299_100015155 | 176 |
| 60 | 3300001989 | JGI24739J22299_10046778 | JGI24739J22299_100467782 | 176 |
| 61 | 3300001990 | JGI24737J22298_10114970 | JGI24737J22298_101149701 | 176 |
| 62 | 3300002075 | JGI24738J21930_10063765 | JGI24738J21930_100637652 | 176 |
| 63 | 3300002077 | JGI24744J21845_10003924 | JGI24744J21845_100039242 | 176 |
| 64 | 3300005293 | Ga0065715_10222191 | Ga0065715_102221912 | 176 |
| 65 | 3300005327 | Ga0070658_10097808 | Ga0070658_100978082 | 176 |
| 66 | 3300005327 | Ga0070658_10263399 | Ga0070658_102633992 | 176 |
| 67 | 3300005327 | Ga0070658_10322390 | Ga0070658_103223902 | 176 |
| 68 | 3300005327 | Ga0070658_10433439 | Ga0070658_104334392 | 176 |
| 69 | 3300005327 | Ga0070658_10863229 | Ga0070658_108632291 | 176 |
| 70 | 3300005327 | Ga0070658_11042174 | Ga0070658_110421741 | 176 |
| 71 | 3300005328 | Ga0070676_10181641 | Ga0070676_101816412 | 176 |
| 72 | 3300005328 | Ga0070676_10334284 | Ga0070676_103342842 | 176 |
| 73 | 3300005329 | Ga0070683_100594518 | Ga0070683_1005945182 | 176 |
| 74 | 3300005330 | Ga0070690_100025707 | Ga0070690_1000257074 | 176 |
| 75 | 3300005330 | Ga0070690_100059041 | Ga0070690_1000590413 | 176 |
| 76 | 3300005331 | Ga0070670_100038135 | Ga0070670_1000381351 | 176 |
| 77 | 3300005331 | Ga0070670_100273793 | Ga0070670_1002737932 | 176 |
| 78 | 3300005334 | Ga0068869_100612305 | Ga0068869_1006123052 | 176 |
| 79 | 3300005335 | Ga0070666_10001646 | Ga0070666_100016464 | 176 |
| 80 | 3300005335 | Ga0070666_10019786 | Ga0070666_100197863 | 176 |
| 81 | 3300005335 | Ga0070666_10025241 | Ga0070666_100252412 | 176 |
| 82 | 3300005335 | Ga0070666_10047624 | Ga0070666_100476242 | 176 |
| 83 | 3300005335 | Ga0070666_10134351 | Ga0070666_101343512 | 176 |
| 84 | 3300005338 | Ga0068868_100001374 | Ga0068868_1000013748 | 176 |
| 85 | 3300005338 | Ga0068868_100018524 | Ga0068868_1000185245 | 176 |
| 86 | 3300005338 | Ga0068868_100027559 | Ga0068868_1000275595 | 176 |
| 87 | 3300005338 | Ga0068868_100347962 | Ga0068868_1003479622 | 176 |
| 88 | 3300005338 | Ga0068868_100824753 | Ga0068868_1008247532 | 176 |
| 89 | 3300005339 | Ga0070660_100014609 | Ga0070660_1000146092 | 176 |
| 90 | 3300005339 | Ga0070660_100153338 | Ga0070660_1001533382 | 176 |
| 91 | 3300005339 | Ga0070660_100593668 | Ga0070660_1005936682 | 176 |
| 92 | 3300005340 | Ga0070689_100792404 | Ga0070689_1007924041 | 176 |
| 93 | 3300005343 | Ga0070687_100351234 | Ga0070687_1003512341 | 176 |
| 94 | 3300005343 | Ga0070687_100394410 | Ga0070687_1003944101 | 176 |
| 95 | 3300005344 | Ga0070661_100077229 | Ga0070661_1000772292 | 176 |
| 96 | 3300005344 | Ga0070661_101177320 | Ga0070661_1011773201 | 176 |
| 97 | 3300005347 | Ga0070668_100474401 | Ga0070668_1004744012 | 176 |
| 98 | 3300005353 | Ga0070669_100203467 | Ga0070669_1002034672 | 176 |
| 99 | 3300005353 | Ga0070669_100448159 | Ga0070669_1004481592 | 176 |
| 100 | 3300005354 | Ga0070675_100035449 | Ga0070675_1000354492 | 176 |
| 101 | 3300005355 | Ga0070671_100083872 | Ga0070671_1000838722 | 176 |
| 102 | 3300005355 | Ga0070671_100142406 | Ga0070671_1001424062 | 176 |
| 103 | 3300005355 | Ga0070671_100248616 | Ga0070671_1002486162 | 176 |
| 104 | 3300005355 | Ga0070671_100260286 | Ga0070671_1002602862 | 176 |
| 105 | 3300005355 | Ga0070671_100874413 | Ga0070671_1008744131 | 176 |
| 106 | 3300005355 | Ga0070671_100915330 | Ga0070671_1009153302 | 176 |
| 107 | 3300005356 | Ga0070674_100044341 | Ga0070674_1000443413 | 176 |
| 108 | 3300005356 | Ga0070674_100473902 | Ga0070674_1004739022 | 176 |
| 109 | 3300005356 | Ga0070674_100615085 | Ga0070674_1006150852 | 176 |
| 110 | 3300005364 | Ga0070673_100121514 | Ga0070673_1001215141 | 176 |
| 111 | 3300005364 | Ga0070673_100243170 | Ga0070673_1002431702 | 176 |
| 112 | 3300005364 | Ga0070673_100352350 | Ga0070673_1003523501 | 176 |
| 113 | 3300005364 | Ga0070673_100485717 | Ga0070673_1004857171 | 176 |
| 114 | 3300005364 | Ga0070673_101328256 | Ga0070673_1013282561 | 176 |
| 115 | 3300005365 | Ga0070688_100847579 | Ga0070688_1008475791 | 176 |
| 116 | 3300005366 | Ga0070659_100025309 | Ga0070659_1000253092 | 176 |
| 117 | 3300005366 | Ga0070659_100036446 | Ga0070659_1000364464 | 176 |
| 118 | 3300005366 | Ga0070659_100090911 | Ga0070659_1000909113 | 176 |
| 119 | 3300005366 | Ga0070659_100339314 | Ga0070659_1003393142 | 176 |
| 120 | 3300005366 | Ga0070659_100463260 | Ga0070659_1004632602 | 176 |
| 121 | 3300005366 | Ga0070659_100623253 | Ga0070659_1006232531 | 176 |
| 122 | 3300005367 | Ga0070667_100002025 | Ga0070667_1000020253 | 176 |
| 123 | 3300005367 | Ga0070667_100254506 | Ga0070667_1002545062 | 176 |
| 124 | 3300005367 | Ga0070667_100432757 | Ga0070667_1004327572 | 176 |
| 125 | 3300005367 | Ga0070667_100501407 | Ga0070667_1005014072 | 176 |
| 126 | 3300005438 | Ga0070701_10384826 | Ga0070701_103848261 | 176 |
| 127 | 3300005455 | Ga0070663_100051594 | Ga0070663_1000515943 | 176 |
| 128 | 3300005455 | Ga0070663_100136288 | Ga0070663_1001362882 | 176 |
| 129 | 3300005455 | Ga0070663_100159869 | Ga0070663_1001598692 | 176 |
| 130 | 3300005455 | Ga0070663_100220927 | Ga0070663_1002209272 | 176 |
| 131 | 3300005455 | Ga0070663_100335743 | Ga0070663_1003357432 | 176 |
| 132 | 3300005455 | Ga0070663_100442434 | Ga0070663_1004424342 | 176 |
| 133 | 3300005456 | Ga0070678_100073959 | Ga0070678_1000739593 | 176 |
| 134 | 3300005456 | Ga0070678_100081233 | Ga0070678_1000812333 | 176 |
| 135 | 3300005457 | Ga0070662_100009105 | Ga0070662_1000091055 | 176 |
| 136 | 3300005457 | Ga0070662_100068687 | Ga0070662_1000686872 | 176 |
| 137 | 3300005457 | Ga0070662_100152695 | Ga0070662_1001526952 | 176 |
| 138 | 3300005457 | Ga0070662_100274369 | Ga0070662_1002743692 | 176 |
| 139 | 3300005458 | Ga0070681_10623849 | Ga0070681_106238492 | 176 |
| 140 | 3300005459 | Ga0068867_100066622 | Ga0068867_1000666223 | 176 |
| 141 | 3300005466 | Ga0070685_10071423 | Ga0070685_100714232 | 176 |
| 142 | 3300005539 | Ga0068853_100250976 | Ga0068853_1002509761 | 176 |
| 143 | 3300005539 | Ga0068853_100329120 | Ga0068853_1003291202 | 176 |
| 144 | 3300005539 | Ga0068853_100376770 | Ga0068853_1003767702 | 176 |
| 145 | 3300005539 | Ga0068853_100404906 | Ga0068853_1004049062 | 176 |
| 146 | 3300005543 | Ga0070672_100069279 | Ga0070672_1000692794 | 176 |
| 147 | 3300005543 | Ga0070672_100144676 | Ga0070672_1001446762 | 176 |
| 148 | 3300005545 | Ga0070695_100847516 | Ga0070695_1008475162 | 176 |
| 149 | 3300005547 | Ga0070693_100035832 | Ga0070693_1000358322 | 176 |
| 150 | 3300005548 | Ga0070665_100012511 | Ga0070665_1000125114 | 176 |
| 151 | 3300005548 | Ga0070665_100547973 | Ga0070665_1005479732 | 176 |
| 152 | 3300005548 | Ga0070665_100700161 | Ga0070665_1007001611 | 176 |
| 153 | 3300005563 | Ga0068855_100424104 | Ga0068855_1004241042 | 176 |
| 154 | 3300005564 | Ga0070664_100002277 | Ga0070664_1000022776 | 176 |
| 155 | 3300005564 | Ga0070664_100016176 | Ga0070664_1000161764 | 176 |
| 156 | 3300005564 | Ga0070664_100047762 | Ga0070664_1000477623 | 176 |
| 157 | 3300005564 | Ga0070664_100139937 | Ga0070664_1001399372 | 176 |
| 158 | 3300005577 | Ga0068857_100015547 | Ga0068857_1000155472 | 176 |
| 159 | 3300005577 | Ga0068857_100233169 | Ga0068857_1002331693 | 176 |
| 160 | 3300005578 | Ga0068854_100051213 | Ga0068854_1000512133 | 176 |
| 161 | 3300005578 | Ga0068854_100185115 | Ga0068854_1001851152 | 176 |
| 162 | 3300005578 | Ga0068854_100714372 | Ga0068854_1007143722 | 176 |
| 163 | 3300005578 | Ga0068854_100771845 | Ga0068854_1007718451 | 176 |
| 164 | 3300005614 | Ga0068856_100984857 | Ga0068856_1009848571 | 176 |
| 165 | 3300005615 | Ga0070702_100282860 | Ga0070702_1002828602 | 176 |
| 166 | 3300005616 | Ga0068852_100235400 | Ga0068852_1002354002 | 176 |
| 167 | 3300005616 | Ga0068852_100311921 | Ga0068852_1003119212 | 176 |
| 168 | 3300005616 | Ga0068852_100411859 | Ga0068852_1004118592 | 176 |
| 169 | 3300005616 | Ga0068852_100575719 | Ga0068852_1005757192 | 176 |
| 170 | 3300005616 | Ga0068852_101029463 | Ga0068852_1010294632 | 176 |
| 171 | 3300005616 | Ga0068852_101090496 | Ga0068852_1010904962 | 176 |
| 172 | 3300005617 | Ga0068859_100045775 | Ga0068859_1000457754 | 176 |
| 173 | 3300005617 | Ga0068859_100088510 | Ga0068859_1000885103 | 176 |
| 174 | 3300005617 | Ga0068859_100266898 | Ga0068859_1002668982 | 176 |
| 175 | 3300005618 | Ga0068864_100066231 | Ga0068864_1000662312 | 176 |
| 176 | 3300005618 | Ga0068864_100306639 | Ga0068864_1003066392 | 176 |
| 177 | 3300005618 | Ga0068864_100458777 | Ga0068864_1004587772 | 176 |
| 178 | 3300005618 | Ga0068864_100684424 | Ga0068864_1006844242 | 176 |
| 179 | 3300005718 | Ga0068866_10006749 | Ga0068866_100067495 | 176 |
| 180 | 3300005718 | Ga0068866_10391689 | Ga0068866_103916891 | 176 |
| 181 | 3300005719 | Ga0068861_100299232 | Ga0068861_1002992322 | 176 |
| 182 | 3300005834 | Ga0068851_10002715 | Ga0068851_100027151 | 176 |
| 183 | 3300005834 | Ga0068851_10114074 | Ga0068851_101140743 | 176 |
| 184 | 3300005834 | Ga0068851_10265089 | Ga0068851_102650892 | 176 |
| 185 | 3300005834 | Ga0068851_10308308 | Ga0068851_103083082 | 176 |
| 186 | 3300005841 | Ga0068863_100006484 | Ga0068863_10000648415 | 176 |
| 187 | 3300005842 | Ga0068858_100007187 | Ga0068858_1000071878 | 176 |
| 188 | 3300005842 | Ga0068858_100063635 | Ga0068858_1000636354 | 176 |
| 189 | 3300005842 | Ga0068858_100320673 | Ga0068858_1003206732 | 176 |
| 190 | 3300005842 | Ga0068858_100708757 | Ga0068858_1007087571 | 176 |
| 191 | 3300005843 | Ga0068860_100195121 | Ga0068860_1001951212 | 176 |
| 192 | 3300005843 | Ga0068860_100635252 | Ga0068860_1006352522 | 176 |
| 193 | 3300006237 | Ga0097621_100244088 | Ga0097621_1002440883 | 176 |
| 194 | 3300006237 | Ga0097621_100499238 | Ga0097621_1004992382 | 176 |
| 195 | 3300006358 | Ga0068871_101088954 | Ga0068871_1010889541 | 176 |
| 196 | 3300006881 | Ga0068865_100044991 | Ga0068865_1000449912 | 176 |
| 197 | 3300006881 | Ga0068865_100133430 | Ga0068865_1001334302 | 176 |
| 198 | 3300006881 | Ga0068865_100325691 | Ga0068865_1003256912 | 176 |
| 199 | 3300006931 | Ga0097620_100045772 | Ga0097620_1000457724 | 176 |
| 200 | 3300006931 | Ga0097620_100088518 | Ga0097620_1000885183 | 176 |
| 201 | 3300006931 | Ga0097620_100266897 | Ga0097620_1002668972 | 176 |
| 202 | 3300009011 | Ga0105251_10101150 | Ga0105251_101011502 | 176 |
| 203 | 3300009098 | Ga0105245_10048004 | Ga0105245_100480043 | 176 |
| 204 | 3300009098 | Ga0105245_10068217 | Ga0105245_100682173 | 176 |
| 205 | 3300009098 | Ga0105245_10654205 | Ga0105245_106542052 | 176 |
| 206 | 3300009148 | Ga0105243_10246758 | Ga0105243_102467582 | 176 |
| 207 | 3300009174 | Ga0105241_10707824 | Ga0105241_107078241 | 176 |
| 208 | 3300009176 | Ga0105242_10896806 | Ga0105242_108968062 | 176 |
| 209 | 3300009177 | Ga0105248_10001411 | Ga0105248_1000141110 | 176 |
| 210 | 3300009177 | Ga0105248_10374413 | Ga0105248_103744132 | 176 |
| 211 | 3300009177 | Ga0105248_10377469 | Ga0105248_103774692 | 176 |
| 212 | 3300009545 | Ga0105237_10630500 | Ga0105237_106305002 | 176 |
| 213 | 3300009551 | Ga0105238_10207749 | Ga0105238_102077492 | 176 |
| 214 | 3300011119 | Ga0105246_10142976 | Ga0105246_101429763 | 176 |
| 215 | 3300011119 | Ga0105246_10421760 | Ga0105246_104217602 | 176 |
| 216 | 3300013100 | Ga0157373_10043020 | Ga0157373_100430202 | 176 |
| 217 | 3300013100 | Ga0157373_10122337 | Ga0157373_101223372 | 176 |
| 218 | 3300013100 | Ga0157373_10174005 | Ga0157373_101740052 | 176 |
| 219 | 3300013102 | Ga0157371_10028899 | Ga0157371_100288993 | 176 |
| 220 | 3300013102 | Ga0157371_10081105 | Ga0157371_100811052 | 176 |
| 221 | 3300013102 | Ga0157371_10335148 | Ga0157371_103351482 | 176 |
| 222 | 3300013105 | Ga0157369_10522132 | Ga0157369_105221322 | 176 |
| 223 | 3300013296 | Ga0157374_10030163 | Ga0157374_100301633 | 176 |
| 224 | 3300013296 | Ga0157374_10277662 | Ga0157374_102776622 | 176 |
| 225 | 3300013296 | Ga0157374_10382466 | Ga0157374_103824662 | 176 |
| 226 | 3300013296 | Ga0157374_11835200 | Ga0157374_118352001 | 176 |
| 227 | 3300013297 | Ga0157378_10288740 | Ga0157378_102887401 | 176 |
| 228 | 3300013297 | Ga0157378_10366194 | Ga0157378_103661942 | 176 |
| 229 | 3300013297 | Ga0157378_10499479 | Ga0157378_104994792 | 176 |
| 230 | 3300013306 | Ga0163162_11391322 | Ga0163162_113913221 | 176 |
| 231 | 3300013306 | Ga0163162_12295873 | Ga0163162_122958731 | 176 |
| 232 | 3300013307 | Ga0157372_10023759 | Ga0157372_100237595 | 176 |
| 233 | 3300013308 | Ga0157375_10021664 | Ga0157375_100216644 | 176 |
| 234 | 3300013308 | Ga0157375_10537932 | Ga0157375_105379322 | 176 |
| 235 | 3300013308 | Ga0157375_10587329 | Ga0157375_105873292 | 176 |
| 236 | 3300013308 | Ga0157375_11378080 | Ga0157375_113780802 | 176 |
| 237 | 3300014325 | Ga0163163_10071584 | Ga0163163_100715842 | 176 |
| 238 | 3300014325 | Ga0163163_10083214 | Ga0163163_100832144 | 176 |
| 239 | 3300014968 | Ga0157379_10001782 | Ga0157379_1000178214 | 176 |
| 240 | 3300014968 | Ga0157379_10057142 | Ga0157379_100571423 | 176 |
| 241 | 3300014968 | Ga0157379_10909005 | Ga0157379_109090052 | 176 |
| 242 | 3300025315 | Ga0207697_10021713 | Ga0207697_100217132 | 176 |
| 243 | 3300025315 | Ga0207697_10219700 | Ga0207697_102197002 | 176 |
| 244 | 3300025321 | Ga0207656_10013560 | Ga0207656_100135602 | 176 |
| 245 | 3300025893 | Ga0207682_10008218 | Ga0207682_100082183 | 176 |
| 246 | 3300025899 | Ga0207642_10040110 | Ga0207642_100401102 | 176 |
| 247 | 3300025901 | Ga0207688_10041320 | Ga0207688_100413203 | 176 |
| 248 | 3300025903 | Ga0207680_10005472 | Ga0207680_100054726 | 176 |
| 249 | 3300025903 | Ga0207680_10013886 | Ga0207680_100138864 | 176 |
| 250 | 3300025903 | Ga0207680_10025541 | Ga0207680_100255412 | 176 |
| 251 | 3300025903 | Ga0207680_10122207 | Ga0207680_101222072 | 176 |
| 252 | 3300025903 | Ga0207680_10444685 | Ga0207680_104446851 | 176 |
| 253 | 3300025904 | Ga0207647_10003939 | Ga0207647_1000393911 | 176 |
| 254 | 3300025907 | Ga0207645_10036726 | Ga0207645_100367263 | 176 |
| 255 | 3300025907 | Ga0207645_10109045 | Ga0207645_101090452 | 176 |
| 256 | 3300025907 | Ga0207645_10174139 | Ga0207645_101741392 | 176 |
| 257 | 3300025907 | Ga0207645_10178160 | Ga0207645_101781602 | 176 |
| 258 | 3300025908 | Ga0207643_10122743 | Ga0207643_101227432 | 176 |
| 259 | 3300025909 | Ga0207705_10003103 | Ga0207705_100031032 | 176 |
| 260 | 3300025909 | Ga0207705_10004954 | Ga0207705_100049542 | 176 |
| 261 | 3300025909 | Ga0207705_10130873 | Ga0207705_101308732 | 176 |
| 262 | 3300025909 | Ga0207705_10218103 | Ga0207705_102181032 | 176 |
| 263 | 3300025909 | Ga0207705_10428860 | Ga0207705_104288602 | 176 |
| 264 | 3300025918 | Ga0207662_10160306 | Ga0207662_101603062 | 176 |
| 265 | 3300025918 | Ga0207662_10203519 | Ga0207662_102035192 | 176 |
| 266 | 3300025919 | Ga0207657_10008170 | Ga0207657_1000817014 | 176 |
| 267 | 3300025919 | Ga0207657_10200823 | Ga0207657_102008232 | 176 |
| 268 | 3300025919 | Ga0207657_10514929 | Ga0207657_105149291 | 176 |
| 269 | 3300025919 | Ga0207657_10564964 | Ga0207657_105649642 | 176 |
| 270 | 3300025919 | Ga0207657_10940270 | Ga0207657_109402701 | 176 |
| 271 | 3300025920 | Ga0207649_10025348 | Ga0207649_100253483 | 176 |
| 272 | 3300025920 | Ga0207649_10041227 | Ga0207649_100412272 | 176 |
| 273 | 3300025920 | Ga0207649_10071522 | Ga0207649_100715222 | 176 |
| 274 | 3300025920 | Ga0207649_10109523 | Ga0207649_101095232 | 176 |
| 275 | 3300025920 | Ga0207649_10211799 | Ga0207649_102117991 | 176 |
| 276 | 3300025920 | Ga0207649_10619719 | Ga0207649_106197191 | 176 |
| 277 | 3300025920 | Ga0207649_10632779 | Ga0207649_106327791 | 176 |
| 278 | 3300025923 | Ga0207681_10182457 | Ga0207681_101824572 | 176 |
| 279 | 3300025924 | Ga0207694_10239640 | Ga0207694_102396402 | 176 |
| 280 | 3300025925 | Ga0207650_10040083 | Ga0207650_100400832 | 176 |
| 281 | 3300025925 | Ga0207650_10138955 | Ga0207650_101389552 | 176 |
| 282 | 3300025925 | Ga0207650_10650950 | Ga0207650_106509502 | 176 |
| 283 | 3300025926 | Ga0207659_10052602 | Ga0207659_100526023 | 176 |
| 284 | 3300025927 | Ga0207687_10017705 | Ga0207687_100177053 | 176 |
| 285 | 3300025927 | Ga0207687_10109576 | Ga0207687_101095762 | 176 |
| 286 | 3300025927 | Ga0207687_10324423 | Ga0207687_103244232 | 176 |
| 287 | 3300025931 | Ga0207644_10004377 | Ga0207644_100043777 | 176 |
| 288 | 3300025931 | Ga0207644_10010174 | Ga0207644_100101744 | 176 |
| 289 | 3300025931 | Ga0207644_10076393 | Ga0207644_100763932 | 176 |
| 290 | 3300025931 | Ga0207644_10308873 | Ga0207644_103088731 | 176 |
| 291 | 3300025931 | Ga0207644_10945355 | Ga0207644_109453552 | 176 |
| 292 | 3300025932 | Ga0207690_10039855 | Ga0207690_100398552 | 176 |
| 293 | 3300025932 | Ga0207690_10117963 | Ga0207690_101179632 | 176 |
| 294 | 3300025932 | Ga0207690_10405984 | Ga0207690_104059842 | 176 |
| 295 | 3300025933 | Ga0207706_10000742 | Ga0207706_1000074217 | 176 |
| 296 | 3300025933 | Ga0207706_10011556 | Ga0207706_100115565 | 176 |
| 297 | 3300025933 | Ga0207706_10036685 | Ga0207706_100366855 | 176 |
| 298 | 3300025933 | Ga0207706_10072603 | Ga0207706_100726033 | 176 |
| 299 | 3300025933 | Ga0207706_10114309 | Ga0207706_101143092 | 176 |
| 300 | 3300025933 | Ga0207706_10264113 | Ga0207706_102641132 | 176 |
| 301 | 3300025935 | Ga0207709_10068490 | Ga0207709_100684902 | 176 |
| 302 | 3300025937 | Ga0207669_10483542 | Ga0207669_104835422 | 176 |
| 303 | 3300025937 | Ga0207669_10596151 | Ga0207669_105961511 | 176 |
| 304 | 3300025938 | Ga0207704_10007623 | Ga0207704_100076235 | 176 |
| 305 | 3300025938 | Ga0207704_10241090 | Ga0207704_102410901 | 176 |
| 306 | 3300025940 | Ga0207691_10005345 | Ga0207691_100053452 | 176 |
| 307 | 3300025940 | Ga0207691_10066301 | Ga0207691_100663012 | 176 |
| 308 | 3300025940 | Ga0207691_10105143 | Ga0207691_101051433 | 176 |
| 309 | 3300025941 | Ga0207711_10007890 | Ga0207711_100078906 | 176 |
| 310 | 3300025941 | Ga0207711_10015675 | Ga0207711_100156753 | 176 |
| 311 | 3300025941 | Ga0207711_10125118 | Ga0207711_101251182 | 176 |
| 312 | 3300025941 | Ga0207711_10557334 | Ga0207711_105573342 | 176 |
| 313 | 3300025942 | Ga0207689_10035485 | Ga0207689_100354852 | 176 |
| 314 | 3300025942 | Ga0207689_10279293 | Ga0207689_102792932 | 176 |
| 315 | 3300025944 | Ga0207661_10095297 | Ga0207661_100952972 | 176 |
| 316 | 3300025945 | Ga0207679_10004636 | Ga0207679_100046365 | 176 |
| 317 | 3300025945 | Ga0207679_10106452 | Ga0207679_101064523 | 176 |
| 318 | 3300025945 | Ga0207679_10143780 | Ga0207679_101437802 | 176 |
| 319 | 3300025945 | Ga0207679_10153164 | Ga0207679_101531642 | 176 |
| 320 | 3300025945 | Ga0207679_10158306 | Ga0207679_101583062 | 176 |
| 321 | 3300025945 | Ga0207679_10570475 | Ga0207679_105704751 | 176 |
| 322 | 3300025949 | Ga0207667_10679885 | Ga0207667_106798852 | 176 |
| 323 | 3300025960 | Ga0207651_10020635 | Ga0207651_100206352 | 176 |
| 324 | 3300025960 | Ga0207651_10025830 | Ga0207651_100258304 | 176 |
| 325 | 3300025960 | Ga0207651_10166768 | Ga0207651_101667682 | 176 |
| 326 | 3300025960 | Ga0207651_10265791 | Ga0207651_102657912 | 176 |
| 327 | 3300025960 | Ga0207651_10309706 | Ga0207651_103097062 | 176 |
| 328 | 3300025972 | Ga0207668_10140995 | Ga0207668_101409952 | 176 |
| 329 | 3300025981 | Ga0207640_10051244 | Ga0207640_100512443 | 176 |
| 330 | 3300025981 | Ga0207640_10064855 | Ga0207640_100648552 | 176 |
| 331 | 3300025981 | Ga0207640_10232852 | Ga0207640_102328522 | 176 |
| 332 | 3300025981 | Ga0207640_10493687 | Ga0207640_104936872 | 176 |
| 333 | 3300025986 | Ga0207658_10001885 | Ga0207658_1000188511 | 176 |
| 334 | 3300025986 | Ga0207658_10017392 | Ga0207658_100173922 | 176 |
| 335 | 3300025986 | Ga0207658_10071299 | Ga0207658_100712993 | 176 |
| 336 | 3300025986 | Ga0207658_10117946 | Ga0207658_101179462 | 176 |
| 337 | 3300025986 | Ga0207658_10326170 | Ga0207658_103261703 | 176 |
| 338 | 3300025986 | Ga0207658_10438386 | Ga0207658_104383862 | 176 |
| 339 | 3300025986 | Ga0207658_10569889 | Ga0207658_105698892 | 176 |
| 340 | 3300026023 | Ga0207677_10000890 | Ga0207677_1000089012 | 176 |
| 341 | 3300026023 | Ga0207677_10064764 | Ga0207677_100647641 | 176 |
| 342 | 3300026023 | Ga0207677_10318573 | Ga0207677_103185732 | 176 |
| 343 | 3300026023 | Ga0207677_10597282 | Ga0207677_105972822 | 176 |
| 344 | 3300026035 | Ga0207703_10003017 | Ga0207703_1000301711 | 176 |
| 345 | 3300026035 | Ga0207703_10415808 | Ga0207703_104158082 | 176 |
| 346 | 3300026041 | Ga0207639_10144631 | Ga0207639_101446312 | 176 |
| 347 | 3300026041 | Ga0207639_10362512 | Ga0207639_103625123 | 176 |
| 348 | 3300026041 | Ga0207639_10796789 | Ga0207639_107967892 | 176 |
| 349 | 3300026067 | Ga0207678_10000558 | Ga0207678_1000055844 | 176 |
| 350 | 3300026067 | Ga0207678_10001651 | Ga0207678_1000165111 | 176 |
| 351 | 3300026067 | Ga0207678_10115782 | Ga0207678_101157822 | 176 |
| 352 | 3300026067 | Ga0207678_10302667 | Ga0207678_103026672 | 176 |
| 353 | 3300026067 | Ga0207678_10513188 | Ga0207678_105131882 | 176 |
| 354 | 3300026078 | Ga0207702_10497558 | Ga0207702_104975581 | 176 |
| 355 | 3300026078 | Ga0207702_10624504 | Ga0207702_106245042 | 176 |
| 356 | 3300026088 | Ga0207641_10013048 | Ga0207641_100130484 | 176 |
| 357 | 3300026089 | Ga0207648_10005192 | Ga0207648_1000519217 | 176 |
| 358 | 3300026089 | Ga0207648_10005560 | Ga0207648_100055602 | 176 |
| 359 | 3300026089 | Ga0207648_10087242 | Ga0207648_100872423 | 176 |
| 360 | 3300026095 | Ga0207676_10059822 | Ga0207676_100598224 | 176 |
| 361 | 3300026095 | Ga0207676_10496341 | Ga0207676_104963412 | 176 |
| 362 | 3300026095 | Ga0207676_10507507 | Ga0207676_105075072 | 176 |
| 363 | 3300026116 | Ga0207674_10002680 | Ga0207674_1000268012 | 176 |
| 364 | 3300026116 | Ga0207674_10007257 | Ga0207674_100072574 | 176 |
| 365 | 3300026116 | Ga0207674_11255945 | Ga0207674_112559451 | 176 |
| 366 | 3300026118 | Ga0207675_100157398 | Ga0207675_1001573982 | 176 |
| 367 | 3300026121 | Ga0207683_10019662 | Ga0207683_100196626 | 176 |
| 368 | 3300026121 | Ga0207683_10046328 | Ga0207683_100463283 | 176 |
| 369 | 3300026121 | Ga0207683_10133954 | Ga0207683_101339543 | 176 |
| 370 | 3300026142 | Ga0207698_10121945 | Ga0207698_101219453 | 176 |
| 371 | 3300026142 | Ga0207698_10157645 | Ga0207698_101576452 | 176 |
| 372 | 3300026142 | Ga0207698_10166044 | Ga0207698_101660442 | 176 |
| 373 | 3300026142 | Ga0207698_10174346 | Ga0207698_101743462 | 176 |
| 374 | 3300026142 | Ga0207698_10188095 | Ga0207698_101880952 | 176 |
| 375 | 3300026142 | Ga0207698_10432273 | Ga0207698_104322732 | 176 |
| 376 | 3300028379 | Ga0268266_10150624 | Ga0268266_101506242 | 176 |
| 377 | 3300028381 | Ga0268264_10433370 | Ga0268264_104333702 | 176 |
| 378 | 3300028381 | Ga0268264_10440128 | Ga0268264_104401282 | 176 |
| 379 | 3300037418 | Ga0395900_0122741 | Ga0395900_0122741_1193_1726 | 176 |
| 380 | 3300037471 | Ga0395905_0072518 | Ga0395905_0072518_1375_1908 | 176 |
| 381 | 3300037471 | Ga0395905_0308781 | Ga0395905_0308781_212_745 | 176 |
| 382 | 3300038443 | Ga0395901_0094734 | Ga0395901_0094734_1120_1653 | 176 |
| 383 | 3300038443 | Ga0395901_0133521 | Ga0395901_0133521_1265_1798 | 176 |
| 384 | 3300038443 | Ga0395901_1049794 | Ga0395901_1049794_122_655 | 176 |
| 385 | 3300046539 | Ga0495621_0000183 | Ga0495621_0000183_11268_11801 | 176 |
| 386 | 3300046539 | Ga0495621_0063417 | Ga0495621_0063417_596_1129 | 176 |
| 387 | 3300046616 | Ga0495668_0239633 | Ga0495668_0239633_18_551 | 176 |
| 388 | 3300046684 | Ga0495669_0100617 | Ga0495669_0100617_396_929 | 176 |
| 389 | 3300046684 | Ga0495669_0255306 | Ga0495669_0255306_141_674 | 176 |
| 390 | 3300046691 | Ga0495670_0005394 | Ga0495670_0005394_2218_2751 | 176 |
| 391 | 3300046691 | Ga0495670_0136025 | Ga0495670_0136025_555_1088 | 176 |
| 392 | 3300048904 | Ga0496101_0015261 | Ga0496101_0015261_4321_4854 | 176 |
| 393 | 3300048904 | Ga0496101_0234621 | Ga0496101_0234621_751_1284 | 176 |
| 394 | 3300048904 | Ga0496101_0982892 | Ga0496101_0982892_22_555 | 176 |
| 395 | 3300048905 | Ga0496102_0275531 | Ga0496102_0275531_751_1284 | 176 |
| 396 | 3300048905 | Ga0496102_0602910 | Ga0496102_0602910_356_889 | 176 |
| 397 | 3300048906 | Ga0496103_0130767 | Ga0496103_0130767_238_771 | 176 |
| 398 | 3300048906 | Ga0496103_0543422 | Ga0496103_0543422_136_669 | 176 |
| 399 | 3300048907 | Ga0496104_0081963 | Ga0496104_0081963_2217_2750 | 176 |
| 400 | 3300048909 | Ga0496106_0075995 | Ga0496106_0075995_149_682 | 176 |
| 401 | 3300048910 | Ga0496107_0002167 | Ga0496107_0002167_11998_12531 | 176 |
| 402 | 3300048910 | Ga0496107_0020747 | Ga0496107_0020747_3379_3912 | 176 |
| 403 | 3300048910 | Ga0496107_0051032 | Ga0496107_0051032_1475_2008 | 176 |
| 404 | 3300048910 | Ga0496107_0432227 | Ga0496107_0432227_50_583 | 176 |
| 405 | 3300048911 | Ga0496108_0001354 | Ga0496108_0001354_2237_2770 | 176 |
| 406 | 3300048911 | Ga0496108_0354992 | Ga0496108_0354992_697_1230 | 176 |
| 407 | 3300048912 | Ga0496109_0033166 | Ga0496109_0033166_145_678 | 176 |
| 408 | 3300048912 | Ga0496109_0326458 | Ga0496109_0326458_218_751 | 176 |
| 409 | 3300048914 | Ga0496111_0077057 | Ga0496111_0077057_1318_1851 | 176 |
| 410 | 3300048914 | Ga0496111_0097256 | Ga0496111_0097256_664_1197 | 176 |
| 411 | 3300048914 | Ga0496111_0273357 | Ga0496111_0273357_51_584 | 176 |
| 412 | 3300048914 | Ga0496111_0579275 | Ga0496111_0579275_239_772 | 176 |
| 413 | 3300048915 | Ga0496112_0024097 | Ga0496112_0024097_837_1370 | 176 |
| 414 | 3300048915 | Ga0496112_0143243 | Ga0496112_0143243_1227_1760 | 176 |
| 415 | 3300048915 | Ga0496112_0324766 | Ga0496112_0324766_64_597 | 176 |
| 416 | 3300048915 | Ga0496112_1108265 | Ga0496112_1108265_101_634 | 176 |
| 417 | 3300048916 | Ga0496113_0105347 | Ga0496113_0105347_1065_1598 | 176 |
| 418 | 3300048916 | Ga0496113_0291569 | Ga0496113_0291569_212_745 | 176 |
| 419 | 3300005339 | Ga0070660_100010347 | Ga0070660_1000103474 | 177 |
| 420 | 3300005344 | Ga0070661_100914795 | Ga0070661_1009147951 | 177 |
| 421 | 3300005345 | Ga0070692_10003915 | Ga0070692_100039155 | 177 |
| 422 | 3300005347 | Ga0070668_100053350 | Ga0070668_1000533502 | 177 |
| 423 | 3300005353 | Ga0070669_100185962 | Ga0070669_1001859622 | 177 |
| 424 | 3300005353 | Ga0070669_100355195 | Ga0070669_1003551951 | 177 |
| 425 | 3300005366 | Ga0070659_100005873 | Ga0070659_1000058735 | 177 |
| 426 | 3300005367 | Ga0070667_100523350 | Ga0070667_1005233501 | 177 |
| 427 | 3300005444 | Ga0070694_100005140 | Ga0070694_1000051405 | 177 |
| 428 | 3300005455 | Ga0070663_100374509 | Ga0070663_1003745092 | 177 |
| 429 | 3300005457 | Ga0070662_100075828 | Ga0070662_1000758283 | 177 |
| 430 | 3300005539 | Ga0068853_100066823 | Ga0068853_1000668232 | 177 |
| 431 | 3300005545 | Ga0070695_100325650 | Ga0070695_1003256502 | 177 |
| 432 | 3300005548 | Ga0070665_100008473 | Ga0070665_1000084732 | 177 |
| 433 | 3300005563 | Ga0068855_100148527 | Ga0068855_1001485272 | 177 |
| 434 | 3300005577 | Ga0068857_100133252 | Ga0068857_1001332521 | 177 |
| 435 | 3300005578 | Ga0068854_100742551 | Ga0068854_1007425511 | 177 |
| 436 | 3300005616 | Ga0068852_100121904 | Ga0068852_1001219042 | 177 |
| 437 | 3300005617 | Ga0068859_100742780 | Ga0068859_1007427802 | 177 |
| 438 | 3300005841 | Ga0068863_100144044 | Ga0068863_1001440442 | 177 |
| 439 | 3300005842 | Ga0068858_101484133 | Ga0068858_1014841331 | 177 |
| 440 | 3300005843 | Ga0068860_100061719 | Ga0068860_1000617192 | 177 |
| 441 | 3300005843 | Ga0068860_100066587 | Ga0068860_1000665873 | 177 |
| 442 | 3300005844 | Ga0068862_100382267 | Ga0068862_1003822672 | 177 |
| 443 | 3300005844 | Ga0068862_100729128 | Ga0068862_1007291281 | 177 |
| 444 | 3300005844 | Ga0068862_100730753 | Ga0068862_1007307532 | 177 |
| 445 | 3300006358 | Ga0068871_101433663 | Ga0068871_1014336631 | 177 |
| 446 | 3300006881 | Ga0068865_100040177 | Ga0068865_1000401772 | 177 |
| 447 | 3300006931 | Ga0097620_100742800 | Ga0097620_1007428002 | 177 |
| 448 | 3300007076 | Ga0075435_100510190 | Ga0075435_1005101902 | 177 |
| 449 | 3300009092 | Ga0105250_10272567 | Ga0105250_102725672 | 177 |
| 450 | 3300009098 | Ga0105245_10197442 | Ga0105245_101974422 | 177 |
| 451 | 3300009148 | Ga0105243_10156449 | Ga0105243_101564492 | 177 |
| 452 | 3300009553 | Ga0105249_10013895 | Ga0105249_100138952 | 177 |
| 453 | 3300010375 | Ga0105239_10085530 | Ga0105239_100855302 | 177 |
| 454 | 3300013306 | Ga0163162_10050129 | Ga0163162_100501292 | 177 |
| 455 | 3300014745 | Ga0157377_10008557 | Ga0157377_100085572 | 177 |
| 456 | 3300025901 | Ga0207688_10025327 | Ga0207688_100253272 | 177 |
| 457 | 3300025919 | Ga0207657_10019353 | Ga0207657_100193534 | 177 |
| 458 | 3300025923 | Ga0207681_10169137 | Ga0207681_101691372 | 177 |
| 459 | 3300025925 | Ga0207650_10293004 | Ga0207650_102930042 | 177 |
| 460 | 3300025932 | Ga0207690_10007764 | Ga0207690_100077645 | 177 |
| 461 | 3300025933 | Ga0207706_10004043 | Ga0207706_100040435 | 177 |
| 462 | 3300025938 | Ga0207704_10109742 | Ga0207704_101097422 | 177 |
| 463 | 3300025938 | Ga0207704_10268910 | Ga0207704_102689101 | 177 |
| 464 | 3300025940 | Ga0207691_10013135 | Ga0207691_100131352 | 177 |
| 465 | 3300025942 | Ga0207689_10023182 | Ga0207689_100231822 | 177 |
| 466 | 3300025942 | Ga0207689_10420103 | Ga0207689_104201032 | 177 |
| 467 | 3300025944 | Ga0207661_11185691 | Ga0207661_111856911 | 177 |
| 468 | 3300025949 | Ga0207667_10022584 | Ga0207667_100225844 | 177 |
| 469 | 3300025961 | Ga0207712_10002542 | Ga0207712_100025422 | 177 |
| 470 | 3300025972 | Ga0207668_10336687 | Ga0207668_103366872 | 177 |
| 471 | 3300025981 | Ga0207640_10257496 | Ga0207640_102574962 | 177 |
| 472 | 3300025986 | Ga0207658_10321305 | Ga0207658_103213052 | 177 |
| 473 | 3300026023 | Ga0207677_10143124 | Ga0207677_101431242 | 177 |
| 474 | 3300026041 | Ga0207639_10313157 | Ga0207639_103131572 | 177 |
| 475 | 3300026067 | Ga0207678_10228086 | Ga0207678_102280862 | 177 |
| 476 | 3300026088 | Ga0207641_10051781 | Ga0207641_100517813 | 177 |
| 477 | 3300026095 | Ga0207676_10495068 | Ga0207676_104950682 | 177 |
| 478 | 3300026116 | Ga0207674_10039628 | Ga0207674_100396282 | 177 |
| 479 | 3300026142 | Ga0207698_10140337 | Ga0207698_101403372 | 177 |
| 480 | 3300028380 | Ga0268265_10291751 | Ga0268265_102917512 | 177 |
| 481 | 3300028380 | Ga0268265_10632620 | Ga0268265_106326201 | 177 |
| 482 | 3300028381 | Ga0268264_10007642 | Ga0268264_1000764211 | 177 |
| 483 | 3300028381 | Ga0268264_10029770 | Ga0268264_100297705 | 177 |
| 484 | 3300031548 | Ga0307408_100121665 | Ga0307408_1001216652 | 177 |
| 485 | 3300031852 | Ga0307410_10670604 | Ga0307410_106706042 | 177 |
| 486 | 3300031995 | Ga0307409_100108393 | Ga0307409_1001083932 | 177 |
| 487 | 3300032002 | Ga0307416_101845024 | Ga0307416_1018450241 | 177 |
| 488 | 3300032005 | Ga0307411_10186562 | Ga0307411_101865622 | 177 |
| 489 | 3300035242 | Ga0373962_0222350 | Ga0373962_0222350_74_610 | 177 |
| 490 | 3300037418 | Ga0395900_0547656 | Ga0395900_0547656_152_688 | 177 |
| 491 | 3300037418 | Ga0395900_0686531 | Ga0395900_0686531_327_863 | 177 |
| 492 | 3300037471 | Ga0395905_0819994 | Ga0395905_0819994_176_712 | 177 |
| 493 | 3300038443 | Ga0395901_0563040 | Ga0395901_0563040_375_911 | 177 |
| 494 | 3300049661 | Ga0501217_105821 | Ga0501217_105821_214_783 | 177 |
| 495 | 3300049667 | Ga0501230_010693 | Ga0501230_010693_697_1266 | 177 |
| 496 | 3300049669 | Ga0501235_085822 | Ga0501235_085822_44_613 | 177 |
| 497 | 3300049679 | Ga0501249_027203 | Ga0501249_027203_543_1112 | 177 |
| 498 | 3300050515 | nmdc:mga0a205_822_c1 | nmdc:mga0a205_822_c1_8703_9239 | 177 |
| 499 | 3300001979 | JGI24740J21852_10044166 | JGI24740J21852_100441662 | 178 |
| 500 | 3300002239 | JGI24034J26672_10021898 | JGI24034J26672_100218982 | 178 |
| 501 | 3300005327 | Ga0070658_11211751 | Ga0070658_112117511 | 178 |
| 502 | 3300005328 | Ga0070676_10098830 | Ga0070676_100988301 | 178 |
| 503 | 3300005328 | Ga0070676_10223414 | Ga0070676_102234142 | 178 |
| 504 | 3300005329 | Ga0070683_100560315 | Ga0070683_1005603152 | 178 |
| 505 | 3300005329 | Ga0070683_101172081 | Ga0070683_1011720811 | 178 |
| 506 | 3300005330 | Ga0070690_100846723 | Ga0070690_1008467231 | 178 |
| 507 | 3300005331 | Ga0070670_100004708 | Ga0070670_1000047085 | 178 |
| 508 | 3300005333 | Ga0070677_10041020 | Ga0070677_100410202 | 178 |
| 509 | 3300005335 | Ga0070666_10001840 | Ga0070666_1000184010 | 178 |
| 510 | 3300005335 | Ga0070666_10234356 | Ga0070666_102343562 | 178 |
| 511 | 3300005338 | Ga0068868_100064966 | Ga0068868_1000649663 | 178 |
| 512 | 3300005338 | Ga0068868_100297182 | Ga0068868_1002971822 | 178 |
| 513 | 3300005343 | Ga0070687_100438231 | Ga0070687_1004382312 | 178 |
| 514 | 3300005344 | Ga0070661_100127405 | Ga0070661_1001274052 | 178 |
| 515 | 3300005344 | Ga0070661_100153148 | Ga0070661_1001531481 | 178 |
| 516 | 3300005344 | Ga0070661_100167816 | Ga0070661_1001678162 | 178 |
| 517 | 3300005344 | Ga0070661_100299856 | Ga0070661_1002998561 | 178 |
| 518 | 3300005354 | Ga0070675_100009388 | Ga0070675_1000093885 | 178 |
| 519 | 3300005354 | Ga0070675_100920121 | Ga0070675_1009201212 | 178 |
| 520 | 3300005355 | Ga0070671_100019434 | Ga0070671_1000194343 | 178 |
| 521 | 3300005355 | Ga0070671_100045542 | Ga0070671_1000455424 | 178 |
| 522 | 3300005355 | Ga0070671_100141007 | Ga0070671_1001410072 | 178 |
| 523 | 3300005356 | Ga0070674_100045140 | Ga0070674_1000451403 | 178 |
| 524 | 3300005356 | Ga0070674_100135073 | Ga0070674_1001350732 | 178 |
| 525 | 3300005364 | Ga0070673_100000346 | Ga0070673_1000003463 | 178 |
| 526 | 3300005366 | Ga0070659_100554784 | Ga0070659_1005547842 | 178 |
| 527 | 3300005366 | Ga0070659_100568334 | Ga0070659_1005683342 | 178 |
| 528 | 3300005367 | Ga0070667_100002178 | Ga0070667_1000021785 | 178 |
| 529 | 3300005367 | Ga0070667_100199767 | Ga0070667_1001997672 | 178 |
| 530 | 3300005455 | Ga0070663_100263044 | Ga0070663_1002630442 | 178 |
| 531 | 3300005456 | Ga0070678_100003221 | Ga0070678_1000032215 | 178 |
| 532 | 3300005456 | Ga0070678_100755229 | Ga0070678_1007552292 | 178 |
| 533 | 3300005457 | Ga0070662_100032279 | Ga0070662_1000322793 | 178 |
| 534 | 3300005457 | Ga0070662_100203686 | Ga0070662_1002036862 | 178 |
| 535 | 3300005457 | Ga0070662_100235049 | Ga0070662_1002350492 | 178 |
| 536 | 3300005459 | Ga0068867_100065520 | Ga0068867_1000655202 | 178 |
| 537 | 3300005459 | Ga0068867_101068544 | Ga0068867_1010685441 | 178 |
| 538 | 3300005543 | Ga0070672_100002995 | Ga0070672_10000299511 | 178 |
| 539 | 3300005543 | Ga0070672_100130574 | Ga0070672_1001305742 | 178 |
| 540 | 3300005543 | Ga0070672_100305875 | Ga0070672_1003058752 | 178 |
| 541 | 3300005548 | Ga0070665_100015258 | Ga0070665_1000152582 | 178 |
| 542 | 3300005564 | Ga0070664_100152958 | Ga0070664_1001529582 | 178 |
| 543 | 3300005564 | Ga0070664_100203028 | Ga0070664_1002030282 | 178 |
| 544 | 3300005564 | Ga0070664_100770046 | Ga0070664_1007700462 | 178 |
| 545 | 3300005578 | Ga0068854_100017334 | Ga0068854_1000173343 | 178 |
| 546 | 3300005616 | Ga0068852_100088342 | Ga0068852_1000883422 | 178 |
| 547 | 3300005616 | Ga0068852_100396906 | Ga0068852_1003969062 | 178 |
| 548 | 3300005617 | Ga0068859_100551423 | Ga0068859_1005514232 | 178 |
| 549 | 3300005618 | Ga0068864_100010084 | Ga0068864_1000100845 | 178 |
| 550 | 3300005618 | Ga0068864_100711254 | Ga0068864_1007112542 | 178 |
| 551 | 3300005834 | Ga0068851_10187922 | Ga0068851_101879222 | 178 |
| 552 | 3300005841 | Ga0068863_100000616 | Ga0068863_10000061620 | 178 |
| 553 | 3300005841 | Ga0068863_100092085 | Ga0068863_1000920852 | 178 |
| 554 | 3300005842 | Ga0068858_100004194 | Ga0068858_1000041946 | 178 |
| 555 | 3300005844 | Ga0068862_100081634 | Ga0068862_1000816342 | 178 |
| 556 | 3300005985 | Ga0081539_10062552 | Ga0081539_100625522 | 178 |
| 557 | 3300006237 | Ga0097621_100022615 | Ga0097621_1000226155 | 178 |
| 558 | 3300006237 | Ga0097621_101051707 | Ga0097621_1010517072 | 178 |
| 559 | 3300006358 | Ga0068871_100208915 | Ga0068871_1002089152 | 178 |
| 560 | 3300006931 | Ga0097620_100551404 | Ga0097620_1005514042 | 178 |
| 561 | 3300009177 | Ga0105248_10018999 | Ga0105248_100189996 | 178 |
| 562 | 3300009177 | Ga0105248_10105359 | Ga0105248_101053593 | 178 |
| 563 | 3300009177 | Ga0105248_10816550 | Ga0105248_108165502 | 178 |
| 564 | 3300009177 | Ga0105248_11214028 | Ga0105248_112140281 | 178 |
| 565 | 3300009553 | Ga0105249_10603575 | Ga0105249_106035752 | 178 |
| 566 | 3300013296 | Ga0157374_10004257 | Ga0157374_100042577 | 178 |
| 567 | 3300013306 | Ga0163162_10000645 | Ga0163162_1000064516 | 178 |
| 568 | 3300013308 | Ga0157375_10013824 | Ga0157375_100138247 | 178 |
| 569 | 3300014325 | Ga0163163_10014438 | Ga0163163_100144385 | 178 |
| 570 | 3300014325 | Ga0163163_10124736 | Ga0163163_101247362 | 178 |
| 571 | 3300021384 | Ga0213876_10039897 | Ga0213876_100398972 | 178 |
| 572 | 3300025321 | Ga0207656_10216066 | Ga0207656_102160662 | 178 |
| 573 | 3300025901 | Ga0207688_10141012 | Ga0207688_101410122 | 178 |
| 574 | 3300025903 | Ga0207680_10005316 | Ga0207680_100053165 | 178 |
| 575 | 3300025903 | Ga0207680_10160456 | Ga0207680_101604562 | 178 |
| 576 | 3300025904 | Ga0207647_10014370 | Ga0207647_100143705 | 178 |
| 577 | 3300025907 | Ga0207645_10102840 | Ga0207645_101028402 | 178 |
| 578 | 3300025920 | Ga0207649_10057363 | Ga0207649_100573631 | 178 |
| 579 | 3300025920 | Ga0207649_10840760 | Ga0207649_108407602 | 178 |
| 580 | 3300025925 | Ga0207650_10016148 | Ga0207650_100161483 | 178 |
| 581 | 3300025925 | Ga0207650_10025993 | Ga0207650_100259932 | 178 |
| 582 | 3300025926 | Ga0207659_10101363 | Ga0207659_101013632 | 178 |
| 583 | 3300025931 | Ga0207644_10008224 | Ga0207644_100082244 | 178 |
| 584 | 3300025931 | Ga0207644_10120867 | Ga0207644_101208672 | 178 |
| 585 | 3300025933 | Ga0207706_10000893 | Ga0207706_100008932 | 178 |
| 586 | 3300025933 | Ga0207706_10276530 | Ga0207706_102765302 | 178 |
| 587 | 3300025937 | Ga0207669_10108034 | Ga0207669_101080342 | 178 |
| 588 | 3300025940 | Ga0207691_10000820 | Ga0207691_1000082010 | 178 |
| 589 | 3300025941 | Ga0207711_10001274 | Ga0207711_1000127412 | 178 |
| 590 | 3300025941 | Ga0207711_10579790 | Ga0207711_105797902 | 178 |
| 591 | 3300025944 | Ga0207661_10814020 | Ga0207661_108140201 | 178 |
| 592 | 3300025945 | Ga0207679_10056175 | Ga0207679_100561754 | 178 |
| 593 | 3300025960 | Ga0207651_10015279 | Ga0207651_100152794 | 178 |
| 594 | 3300025961 | Ga0207712_10604818 | Ga0207712_106048181 | 178 |
| 595 | 3300025972 | Ga0207668_10196874 | Ga0207668_101968742 | 178 |
| 596 | 3300025981 | Ga0207640_10006679 | Ga0207640_100066795 | 178 |
| 597 | 3300025981 | Ga0207640_10570229 | Ga0207640_105702292 | 178 |
| 598 | 3300025986 | Ga0207658_10008648 | Ga0207658_100086487 | 178 |
| 599 | 3300026023 | Ga0207677_10125417 | Ga0207677_101254172 | 178 |
| 600 | 3300026023 | Ga0207677_10266324 | Ga0207677_102663242 | 178 |
| 601 | 3300026035 | Ga0207703_10027953 | Ga0207703_100279534 | 178 |
| 602 | 3300026067 | Ga0207678_10005870 | Ga0207678_1000587010 | 178 |
| 603 | 3300026088 | Ga0207641_10003074 | Ga0207641_1000307412 | 178 |
| 604 | 3300026088 | Ga0207641_10250929 | Ga0207641_102509292 | 178 |
| 605 | 3300026088 | Ga0207641_11368771 | Ga0207641_113687711 | 178 |
| 606 | 3300026089 | Ga0207648_10095447 | Ga0207648_100954472 | 178 |
| 607 | 3300026089 | Ga0207648_10947568 | Ga0207648_109475682 | 178 |
| 608 | 3300026095 | Ga0207676_10007129 | Ga0207676_1000712910 | 178 |
| 609 | 3300026116 | Ga0207674_10001601 | Ga0207674_1000160111 | 178 |
| 610 | 3300026121 | Ga0207683_10007896 | Ga0207683_100078962 | 178 |
| 611 | 3300026142 | Ga0207698_10116555 | Ga0207698_101165552 | 178 |
| 612 | 3300028379 | Ga0268266_10010106 | Ga0268266_100101063 | 178 |
| 613 | 3300028380 | Ga0268265_10144046 | Ga0268265_101440462 | 178 |
| 614 | 3300028381 | Ga0268264_10210676 | Ga0268264_102106762 | 178 |
| 615 | 3300031548 | Ga0307408_100200839 | Ga0307408_1002008392 | 178 |
| 616 | 3300031731 | Ga0307405_10204901 | Ga0307405_102049012 | 178 |
| 617 | 3300031731 | Ga0307405_10785965 | Ga0307405_107859651 | 178 |
| 618 | 3300031824 | Ga0307413_10165600 | Ga0307413_101656002 | 178 |
| 619 | 3300031824 | Ga0307413_10306613 | Ga0307413_103066132 | 178 |
| 620 | 3300031901 | Ga0307406_10222113 | Ga0307406_102221131 | 178 |
| 621 | 3300031901 | Ga0307406_10603114 | Ga0307406_106031142 | 178 |
| 622 | 3300031911 | Ga0307412_10500473 | Ga0307412_105004732 | 178 |
| 623 | 3300032002 | Ga0307416_100006146 | Ga0307416_1000061464 | 178 |
| 624 | 3300032002 | Ga0307416_100245785 | Ga0307416_1002457852 | 178 |
| 625 | 3300032005 | Ga0307411_10250357 | Ga0307411_102503572 | 178 |
| 626 | 3300032126 | Ga0307415_100009011 | Ga0307415_1000090115 | 178 |
| 627 | 3300032126 | Ga0307415_100284462 | Ga0307415_1002844622 | 178 |
| 628 | 3300032126 | Ga0307415_100450701 | Ga0307415_1004507012 | 178 |
| 629 | 3300032126 | Ga0307415_101301272 | Ga0307415_1013012721 | 178 |
| 630 | 3300035171 | Ga0373946_0100125 | Ga0373946_0100125_596_1141 | 178 |
| 631 | 3300035692 | Ga0373935_0233231 | Ga0373935_0233231_673_1218 | 178 |
| 632 | 3300035725 | Ga0373947_0095669 | Ga0373947_0095669_928_1473 | 178 |
| 633 | 3300037068 | Ga0373925_0126560 | Ga0373925_0126560_165_710 | 178 |
| 634 | 3300037418 | Ga0395900_0051457 | Ga0395900_0051457_406_945 | 178 |
| 635 | 3300037466 | Ga0395898_0370582 | Ga0395898_0370582_248_787 | 178 |
| 636 | 3300037471 | Ga0395905_0016471 | Ga0395905_0016471_5796_6335 | 178 |
| 637 | 3300037471 | Ga0395905_0038845 | Ga0395905_0038845_1753_2292 | 178 |
| 638 | 3300037471 | Ga0395905_0127390 | Ga0395905_0127390_1180_1716 | 178 |
| 639 | 3300038443 | Ga0395901_0087707 | Ga0395901_0087707_388_927 | 178 |
| 640 | 3300039437 | Ga0436365_0615625 | Ga0436365_0615625_8408_8944 | 178 |
| 641 | 3300042007 | Ga0439449_0112669 | Ga0439449_0112669_73_612 | 178 |
| 642 | 3300044656 | Ga0466969_0214982 | Ga0466969_0214982_24_563 | 178 |
| 643 | 3300044658 | Ga0466972_0195020 | Ga0466972_0195020_162_701 | 178 |
| 644 | 3300044684 | Ga0466966_0159427 | Ga0466966_0159427_39_578 | 178 |
| 645 | 3300044693 | Ga0466961_0240679 | Ga0466961_0240679_496_1035 | 178 |
| 646 | 3300044694 | Ga0466963_0131466 | Ga0466963_0131466_150_689 | 178 |
| 647 | 3300044706 | Ga0466964_0009075 | Ga0466964_0009075_2919_3458 | 178 |
| 648 | 3300044706 | Ga0466964_0049800 | Ga0466964_0049800_1112_1651 | 178 |
| 649 | 3300044765 | Ga0466970_0006659 | Ga0466970_0006659_2705_3244 | 178 |
| 650 | 3300044765 | Ga0466970_0206476 | Ga0466970_0206476_452_991 | 178 |
| 651 | 3300044842 | Ga0466957_0023627 | Ga0466957_0023627_2498_3037 | 178 |
| 652 | 3300045836 | Ga0466958_0070961 | Ga0466958_0070961_13_552 | 178 |
| 653 | 3300045836 | Ga0466958_0163225 | Ga0466958_0163225_281_820 | 178 |
| 654 | 3300045976 | Ga0466967_0026767 | Ga0466967_0026767_557_1096 | 178 |
| 655 | 3300046459 | Ga0495629_0348390 | Ga0495629_0348390_320_859 | 178 |
| 656 | 3300048903 | Ga0496100_0459970 | Ga0496100_0459970_426_965 | 178 |
| 657 | 3300048904 | Ga0496101_0044620 | Ga0496101_0044620_1737_2273 | 178 |
| 658 | 3300048904 | Ga0496101_0111094 | Ga0496101_0111094_1512_2051 | 178 |
| 659 | 3300048904 | Ga0496101_0321892 | Ga0496101_0321892_471_1010 | 178 |
| 660 | 3300048905 | Ga0496102_0085007 | Ga0496102_0085007_2306_2845 | 178 |
| 661 | 3300048906 | Ga0496103_0132032 | Ga0496103_0132032_985_1524 | 178 |
| 662 | 3300048909 | Ga0496106_0683910 | Ga0496106_0683910_257_793 | 178 |
| 663 | 3300048910 | Ga0496107_0084173 | Ga0496107_0084173_253_789 | 178 |
| 664 | 3300048911 | Ga0496108_0064742 | Ga0496108_0064742_1913_2452 | 178 |
| 665 | 3300048912 | Ga0496109_0003600 | Ga0496109_0003600_10300_10839 | 178 |
| 666 | 3300048913 | Ga0496110_0010292 | Ga0496110_0010292_6455_6994 | 178 |
| 667 | 3300048914 | Ga0496111_0006954 | Ga0496111_0006954_4717_5256 | 178 |
| 668 | 3300048915 | Ga0496112_0044416 | Ga0496112_0044416_195_734 | 178 |
| 669 | 3300048916 | Ga0496113_0038849 | Ga0496113_0038849_1668_2207 | 178 |
| 670 | 3300048917 | Ga0496114_0131015 | Ga0496114_0131015_183_719 | 178 |
| 671 | 3300048918 | Ga0496115_0036712 | Ga0496115_0036712_3194_3730 | 178 |
| 672 | 3300061719 | Ga0466962_0007379 | Ga0466962_0007379_4151_4690 | 178 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2kxo-assembly1.cif.gz_B | solution nmr structure of the cell division regulator mine protein from neisseria gonorrhoeae | 0.7023 | 112 | 134 |
| 4jpq-assembly2.cif.gz_B | crystal structure of a putative carbohydrate-binding protein (bacuni_03838) from bacteroides uniformis atcc 8492 at 2.70 a resolution | 0.634 | 1 | 172 |
| 4jpq-assembly2.cif.gz_B | crystal structure of a putative carbohydrate-binding protein (bacuni_03838) from bacteroides uniformis atcc 8492 at 2.70 a resolution | 0.6146 | 1 | 172 |
| 6ilm-assembly1.cif.gz_E | cryo-em structure of echovirus 6 complexed with its uncoating receptor fcrn at ph 7.4 | 0.5877 | 15 | 139 |
| 3tbt-assembly4.cif.gz_J | crystal structure of the murine class i major histocompatibility complex h-2db in complex with the lcmv-derived gp33 altered peptide ligand (v3p, y4s) | 0.581 | 14 | 143 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q18357_79_204_2.60.40.1190 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.7629 | 56 | 178 | 2.60.40.1190 |
| af_Q18357_79_204_2.60.40.1190 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.7421 | 56 | 178 | 2.60.40.1190 |
| 2kxoB01 | Alpha Beta;2-Layer Sandwich;Cell Cycle; Chain A;Cell division topological specificity factor MinE | 0.733 | 112 | 129 | 3.30.1070.10 |
| af_Q54EU8_18_231_2.60.40.1190 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.6549 | 1 | 173 | 2.60.40.1190 |
| af_Q6P2T7_18_176_2.60.40.1190 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.6542 | 21 | 168 | 2.60.40.1190 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6G7YSJ8-F1-model_v4 | DOMON-like domain-containing protein | 0.9797 | 1 | 178 |
|
| AF-A0A7G9SFC7-F1-model_v4 | DOMON-like domain-containing protein | 0.9793 | 47 | 178 |
|
| AF-A0A7X5Y6Z0-F1-model_v4 | DOMON-like domain-containing protein | 0.9757 | 1 | 178 |
|
| AF-A0A6G7YSJ8-F1-model_v4 | DOMON-like domain-containing protein | 0.9743 | 1 | 178 |
|
| AF-A0A7G9SFC7-F1-model_v4 | DOMON-like domain-containing protein | 0.9576 | 47 | 178 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar