F474211

General Info

Members Datasets Scaffolds Average Seq Length
672 202 672 178

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100248616|Ga0070671_1002486162
Length 191
Sequence MDSPFRGNDDTGDCVQFNLIPHPTTPPSKPLKVWAIVDHAASLGSVASTNIWFGVGAPAVGFAIPEAAEPARAEDLWQTTCFEAFLRIPGAEGYREWNFAPSGEWAAYDFESHREGRSDADVAAPYVRIEDNLTWWALGATIPVDADAIWSLALSAILEEKDGTKSYWALAHPPGDKPDFHAADCFAARLP

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
153 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
154 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
165 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
166 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
167 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
168 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
171 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
172 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
179 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
196 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
197 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
198 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.7
Rhizosphere 93.01
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10044166 3300001979 Bacteria 1324
2 JGI24739J22299_10001515 3300001989 Bacteria 8773
3 JGI24739J22299_10046778 3300001989 Bacteria 1415
4 JGI24737J22298_10114970 3300001990 Bacteria 795
5 JGI24738J21930_10063765 3300002075 Unclassified 758
6 JGI24744J21845_10003924 3300002077 Bacteria 3065
7 JGI24034J26672_10021898 3300002239 Bacteria 1007
8 Ga0065715_10222191 3300005293 Bacteria 1267
9 Ga0065715_10445978 3300005293 Bacteria 831
10 Ga0070658_10097808 3300005327 Bacteria 2423
11 Ga0070658_10263399 3300005327 Bacteria 1464
12 Ga0070658_10322390 3300005327 Bacteria 1319
13 Ga0070658_10433439 3300005327 Bacteria 1131
14 Ga0070658_10863229 3300005327 Bacteria 787
15 Ga0070658_11042174 3300005327 Bacteria 711
16 Ga0070658_11211751 3300005327 Bacteria 656
17 Ga0070676_10098830 3300005328 Bacteria 1800
18 Ga0070676_10181641 3300005328 Bacteria 1368
19 Ga0070676_10223414 3300005328 Bacteria 1245
20 Ga0070676_10334284 3300005328 Bacteria 1037
21 Ga0070683_100148560 3300005329 Bacteria 2222
22 Ga0070683_100560315 3300005329 Bacteria 1093
23 Ga0070683_100594518 3300005329 Bacteria 1059
24 Ga0070683_101172081 3300005329 Bacteria 738
25 Ga0070690_100025707 3300005330 Bacteria 3625
26 Ga0070690_100059041 3300005330 Bacteria 2465
27 Ga0070690_100846723 3300005330 Bacteria 712
28 Ga0070670_100004708 3300005331 Bacteria 11450
29 Ga0070670_100037311 3300005331 Bacteria 4181
30 Ga0070670_100038135 3300005331 Bacteria 4132
31 Ga0070670_100231757 3300005331 Bacteria 1607
32 Ga0070670_100273793 3300005331 Bacteria 1473
33 Ga0070677_10041020 3300005333 Bacteria 1825
34 Ga0068869_100612305 3300005334 Bacteria 921
35 Ga0070666_10001646 3300005335 Bacteria 13611
36 Ga0070666_10001840 3300005335 Bacteria 12925
37 Ga0070666_10019786 3300005335 Bacteria 4348
38 Ga0070666_10025241 3300005335 Bacteria 3873
39 Ga0070666_10047624 3300005335 Bacteria 2878
40 Ga0070666_10134351 3300005335 Bacteria 1720
41 Ga0070666_10234356 3300005335 Bacteria 1297
42 Ga0068868_100001374 3300005338 Bacteria 16758
43 Ga0068868_100018524 3300005338 Bacteria 5207
44 Ga0068868_100027559 3300005338 Bacteria 4335
45 Ga0068868_100064966 3300005338 Bacteria 2898
46 Ga0068868_100297182 3300005338 Bacteria 1371
47 Ga0068868_100347962 3300005338 Bacteria 1269
48 Ga0068868_100824753 3300005338 Bacteria 838
49 Ga0070660_100010347 3300005339 Bacteria 6589
50 Ga0070660_100014609 3300005339 Bacteria 5663
51 Ga0070660_100153338 3300005339 Bacteria 1853
52 Ga0070660_100196915 3300005339 Bacteria 1634
53 Ga0070660_100593668 3300005339 Bacteria 926
54 Ga0070689_100792404 3300005340 Bacteria 833
55 Ga0070687_100351234 3300005343 Bacteria 952
56 Ga0070687_100394410 3300005343 Bacteria 906
57 Ga0070687_100438231 3300005343 Bacteria 866
58 Ga0070661_100077229 3300005344 Bacteria 2455
59 Ga0070661_100127405 3300005344 Bacteria 1910
60 Ga0070661_100153148 3300005344 Bacteria 1744
61 Ga0070661_100167816 3300005344 Bacteria 1666
62 Ga0070661_100299856 3300005344 Bacteria 1251
63 Ga0070661_100914795 3300005344 Bacteria 725
64 Ga0070661_101177320 3300005344 Bacteria 640
65 Ga0070692_10003915 3300005345 Bacteria 6138
66 Ga0070668_100053350 3300005347 Bacteria 3118
67 Ga0070668_100474401 3300005347 Bacteria 1079
68 Ga0070669_100185962 3300005353 Bacteria 1627
69 Ga0070669_100203467 3300005353 Bacteria 1559
70 Ga0070669_100355195 3300005353 Bacteria 1190
71 Ga0070669_100448159 3300005353 Bacteria 1063
72 Ga0070675_100009388 3300005354 Bacteria 7611
73 Ga0070675_100035449 3300005354 Bacteria 4054
74 Ga0070675_100920121 3300005354 Bacteria 802
75 Ga0070671_100019434 3300005355 Bacteria 5528
76 Ga0070671_100045542 3300005355 Bacteria 3647
77 Ga0070671_100083872 3300005355 Bacteria 2665
78 Ga0070671_100141007 3300005355 Bacteria 2034
79 Ga0070671_100142406 3300005355 Bacteria 2023
80 Ga0070671_100248616 3300005355 Bacteria 1510
81 Ga0070671_100260286 3300005355 Bacteria 1474
82 Ga0070671_100874413 3300005355 Unclassified 784
83 Ga0070671_100915330 3300005355 Bacteria 766
84 Ga0070674_100044341 3300005356 Bacteria 3031
85 Ga0070674_100045140 3300005356 Bacteria 3010
86 Ga0070674_100135073 3300005356 Bacteria 1844
87 Ga0070674_100473902 3300005356 Bacteria 1038
88 Ga0070674_100615085 3300005356 Bacteria 920
89 Ga0070673_100000346 3300005364 Bacteria 24441
90 Ga0070673_100121514 3300005364 Bacteria 2179
91 Ga0070673_100243170 3300005364 Bacteria 1566
92 Ga0070673_100352350 3300005364 Bacteria 1307
93 Ga0070673_100485717 3300005364 Bacteria 1115
94 Ga0070673_101328256 3300005364 Bacteria 676
95 Ga0070688_100847579 3300005365 Bacteria 718
96 Ga0070659_100005873 3300005366 Bacteria 8844
97 Ga0070659_100025309 3300005366 Bacteria 4556
98 Ga0070659_100036446 3300005366 Bacteria 3835
99 Ga0070659_100090911 3300005366 Bacteria 2446
100 Ga0070659_100339314 3300005366 Bacteria 1258
101 Ga0070659_100463260 3300005366 Bacteria 1076
102 Ga0070659_100554784 3300005366 Bacteria 984
103 Ga0070659_100568334 3300005366 Bacteria 972
104 Ga0070659_100623253 3300005366 Bacteria 928
105 Ga0070667_100002025 3300005367 Bacteria 17950
106 Ga0070667_100002154 3300005367 Bacteria 17347
107 Ga0070667_100002178 3300005367 Bacteria 17241
108 Ga0070667_100199767 3300005367 Bacteria 1774
109 Ga0070667_100254506 3300005367 Bacteria 1571
110 Ga0070667_100432757 3300005367 Bacteria 1200
111 Ga0070667_100501407 3300005367 Bacteria 1113
112 Ga0070667_100523350 3300005367 Bacteria 1088
113 Ga0070667_101407426 3300005367 Unclassified 654
114 Ga0070714_100038119 3300005435 Bacteria 4042
115 Ga0070701_10384826 3300005438 Bacteria 885
116 Ga0070694_100005140 3300005444 Bacteria 7888
117 Ga0070663_100051594 3300005455 Bacteria 2931
118 Ga0070663_100136288 3300005455 Bacteria 1869
119 Ga0070663_100159869 3300005455 Bacteria 1733
120 Ga0070663_100220927 3300005455 Bacteria 1487
121 Ga0070663_100263044 3300005455 Bacteria 1369
122 Ga0070663_100335743 3300005455 Bacteria 1219
123 Ga0070663_100374509 3300005455 Bacteria 1158
124 Ga0070663_100442434 3300005455 Bacteria 1070
125 Ga0070678_100003221 3300005456 Bacteria 9062
126 Ga0070678_100073959 3300005456 Bacteria 2559
127 Ga0070678_100081233 3300005456 Bacteria 2457
128 Ga0070678_100755229 3300005456 Bacteria 880
129 Ga0070662_100009105 3300005457 Bacteria 6481
130 Ga0070662_100032279 3300005457 Bacteria 3680
131 Ga0070662_100055180 3300005457 Bacteria 2882
132 Ga0070662_100068687 3300005457 Bacteria 2606
133 Ga0070662_100075828 3300005457 Bacteria 2491
134 Ga0070662_100152695 3300005457 Bacteria 1799
135 Ga0070662_100203686 3300005457 Bacteria 1571
136 Ga0070662_100235049 3300005457 Bacteria 1468
137 Ga0070662_100274369 3300005457 Bacteria 1362
138 Ga0070662_101190864 3300005457 Bacteria 655
139 Ga0070681_10623849 3300005458 Bacteria 993
140 Ga0068867_100065520 3300005459 Bacteria 2704
141 Ga0068867_100066622 3300005459 Bacteria 2683
142 Ga0068867_101068544 3300005459 Bacteria 735
143 Ga0070685_10071423 3300005466 Bacteria 2058
144 Ga0068853_100066823 3300005539 Bacteria 3123
145 Ga0068853_100250976 3300005539 Bacteria 1623
146 Ga0068853_100329120 3300005539 Bacteria 1417
147 Ga0068853_100376770 3300005539 Bacteria 1325
148 Ga0068853_100404906 3300005539 Bacteria 1277
149 Ga0070672_100002995 3300005543 Bacteria 10885
150 Ga0070672_100069279 3300005543 Bacteria 2800
151 Ga0070672_100130574 3300005543 Bacteria 2064
152 Ga0070672_100144676 3300005543 Bacteria 1964
153 Ga0070672_100305875 3300005543 Bacteria 1349
154 Ga0070695_100325650 3300005545 Bacteria 1144
155 Ga0070695_100847516 3300005545 Bacteria 735
156 Ga0070693_100035832 3300005547 Bacteria 2754
157 Ga0070665_100008473 3300005548 Bacteria 10404
158 Ga0070665_100012511 3300005548 Bacteria 8550
159 Ga0070665_100015258 3300005548 Bacteria 7713
160 Ga0070665_100485298 3300005548 Bacteria 1246
161 Ga0070665_100547973 3300005548 Bacteria 1169
162 Ga0070665_100700161 3300005548 Bacteria 1026
163 Ga0068855_100148527 3300005563 Bacteria 2666
164 Ga0068855_100424104 3300005563 Bacteria 1455
165 Ga0070664_100002277 3300005564 Bacteria 15441
166 Ga0070664_100016176 3300005564 Bacteria 6113
167 Ga0070664_100047762 3300005564 Bacteria 3617
168 Ga0070664_100139937 3300005564 Bacteria 2130
169 Ga0070664_100152958 3300005564 Bacteria 2037
170 Ga0070664_100203028 3300005564 Bacteria 1769
171 Ga0070664_100495612 3300005564 Bacteria 1125
172 Ga0070664_100770046 3300005564 Bacteria 899
173 Ga0068857_100015547 3300005577 Bacteria 6649
174 Ga0068857_100133252 3300005577 Bacteria 2242
175 Ga0068857_100225298 3300005577 Bacteria 1713
176 Ga0068857_100233169 3300005577 Bacteria 1684
177 Ga0068854_100017334 3300005578 Bacteria 4819
178 Ga0068854_100051213 3300005578 Bacteria 2957
179 Ga0068854_100185115 3300005578 Bacteria 1629
180 Ga0068854_100714372 3300005578 Bacteria 866
181 Ga0068854_100742551 3300005578 Bacteria 851
182 Ga0068854_100771845 3300005578 Bacteria 835
183 Ga0068856_100984857 3300005614 Bacteria 862
184 Ga0070702_100282860 3300005615 Bacteria 1140
185 Ga0068852_100088342 3300005616 Bacteria 2768
186 Ga0068852_100121904 3300005616 Bacteria 2389
187 Ga0068852_100235400 3300005616 Bacteria 1748
188 Ga0068852_100311921 3300005616 Bacteria 1525
189 Ga0068852_100396906 3300005616 Bacteria 1356
190 Ga0068852_100411859 3300005616 Bacteria 1332
191 Ga0068852_100575719 3300005616 Bacteria 1128
192 Ga0068852_101029463 3300005616 Bacteria 842
193 Ga0068852_101090496 3300005616 Bacteria 818
194 Ga0068859_100045775 3300005617 Bacteria 4395
195 Ga0068859_100088510 3300005617 Bacteria 3146
196 Ga0068859_100266898 3300005617 Bacteria 1803
197 Ga0068859_100551423 3300005617 Bacteria 1247
198 Ga0068859_100742780 3300005617 Bacteria 1070
199 Ga0068864_100010084 3300005618 Bacteria 7803
200 Ga0068864_100066231 3300005618 Bacteria 3135
201 Ga0068864_100306639 3300005618 Bacteria 1487
202 Ga0068864_100458777 3300005618 Bacteria 1220
203 Ga0068864_100684424 3300005618 Bacteria 1001
204 Ga0068864_100711254 3300005618 Bacteria 982
205 Ga0068866_10006749 3300005718 Bacteria 4786
206 Ga0068866_10391689 3300005718 Bacteria 894
207 Ga0068861_100299232 3300005719 Bacteria 1393
208 Ga0068851_10002715 3300005834 Bacteria 7792
209 Ga0068851_10114074 3300005834 Bacteria 1446
210 Ga0068851_10187922 3300005834 Bacteria 1147
211 Ga0068851_10265089 3300005834 Bacteria 978
212 Ga0068851_10308308 3300005834 Bacteria 912
213 Ga0068863_100000616 3300005841 Bacteria 36095
214 Ga0068863_100006484 3300005841 Bacteria 11474
215 Ga0068863_100092085 3300005841 Bacteria 2875
216 Ga0068863_100144044 3300005841 Bacteria 2279
217 Ga0068858_100004194 3300005842 Bacteria 14189
218 Ga0068858_100007187 3300005842 Bacteria 10794
219 Ga0068858_100063635 3300005842 Bacteria 3413
220 Ga0068858_100320673 3300005842 Bacteria 1481
221 Ga0068858_100708757 3300005842 Bacteria 979
222 Ga0068858_101484133 3300005842 Bacteria 668
223 Ga0068860_100061719 3300005843 Bacteria 3561
224 Ga0068860_100066587 3300005843 Bacteria 3421
225 Ga0068860_100148559 3300005843 Bacteria 2256
226 Ga0068860_100195121 3300005843 Bacteria 1961
227 Ga0068860_100635252 3300005843 Bacteria 1075
228 Ga0068862_100081634 3300005844 Bacteria 2805
229 Ga0068862_100382267 3300005844 Bacteria 1313
230 Ga0068862_100729128 3300005844 Bacteria 962
231 Ga0068862_100730753 3300005844 Bacteria 961
232 Ga0081539_10062552 3300005985 Bacteria 2034
233 Ga0097621_100022615 3300006237 Bacteria 4882
234 Ga0097621_100244088 3300006237 Bacteria 1571
235 Ga0097621_100499238 3300006237 Bacteria 1102
236 Ga0097621_101051707 3300006237 Unclassified 763
237 Ga0068871_100208915 3300006358 Bacteria 1688
238 Ga0068871_101088954 3300006358 Bacteria 747
239 Ga0068871_101433663 3300006358 Unclassified 651
240 Ga0068865_100040177 3300006881 Bacteria 3177
241 Ga0068865_100044991 3300006881 Bacteria 3024
242 Ga0068865_100133430 3300006881 Bacteria 1863
243 Ga0068865_100325691 3300006881 Bacteria 1237
244 Ga0097620_100045772 3300006931 Bacteria 4395
245 Ga0097620_100088518 3300006931 Bacteria 3146
246 Ga0097620_100266897 3300006931 Bacteria 1803
247 Ga0097620_100551404 3300006931 Bacteria 1247
248 Ga0097620_100742800 3300006931 Bacteria 1070
249 Ga0075435_100510190 3300007076 Bacteria 1040
250 Ga0105251_10101150 3300009011 Bacteria 1317
251 Ga0105250_10272567 3300009092 Bacteria 727
252 Ga0105245_10048004 3300009098 Bacteria 3818
253 Ga0105245_10068217 3300009098 Bacteria 3222
254 Ga0105245_10197442 3300009098 Bacteria 1931
255 Ga0105245_10654205 3300009098 Bacteria 1081
256 Ga0105243_10156449 3300009148 Bacteria 1960
257 Ga0105243_10246758 3300009148 Bacteria 1592
258 Ga0105241_10707824 3300009174 Bacteria 920
259 Ga0105242_10896806 3300009176 Bacteria 886
260 Ga0105248_10001411 3300009177 Bacteria 26840
261 Ga0105248_10003908 3300009177 Bacteria 16478
262 Ga0105248_10018999 3300009177 Bacteria 7598
263 Ga0105248_10105359 3300009177 Bacteria 3179
264 Ga0105248_10374413 3300009177 Bacteria 1603
265 Ga0105248_10377469 3300009177 Bacteria 1596
266 Ga0105248_10816550 3300009177 Bacteria 1052
267 Ga0105248_11214028 3300009177 Unclassified 853
268 Ga0105237_10630500 3300009545 Bacteria 1079
269 Ga0105238_10207749 3300009551 Bacteria 1934
270 Ga0105238_10619968 3300009551 Bacteria 1090
271 Ga0105249_10013895 3300009553 Bacteria 7118
272 Ga0105249_10603575 3300009553 Bacteria 1152
273 Ga0105239_10085530 3300010375 Bacteria 3476
274 Ga0105246_10142976 3300011119 Bacteria 1801
275 Ga0105246_10159299 3300011119 Bacteria 1718
276 Ga0105246_10421760 3300011119 Bacteria 1114
277 Ga0157373_10043020 3300013100 Bacteria 3227
278 Ga0157373_10122337 3300013100 Bacteria 1829
279 Ga0157373_10174005 3300013100 Bacteria 1515
280 Ga0157371_10028899 3300013102 Bacteria 4014
281 Ga0157371_10081105 3300013102 Bacteria 2297
282 Ga0157371_10335148 3300013102 Bacteria 1099
283 Ga0157369_10522132 3300013105 Bacteria 1228
284 Ga0157374_10004257 3300013296 Bacteria 12033
285 Ga0157374_10030163 3300013296 Bacteria 4921
286 Ga0157374_10277662 3300013296 Bacteria 1653
287 Ga0157374_10341455 3300013296 Bacteria 1487
288 Ga0157374_10382466 3300013296 Bacteria 1402
289 Ga0157374_11835200 3300013296 Unclassified 632
290 Ga0157378_10288740 3300013297 Bacteria 1583
291 Ga0157378_10366194 3300013297 Bacteria 1412
292 Ga0157378_10499479 3300013297 Bacteria 1215
293 Ga0163162_10000645 3300013306 Bacteria 32309
294 Ga0163162_10050129 3300013306 Bacteria 4187
295 Ga0163162_11391322 3300013306 Bacteria 798
296 Ga0163162_12295873 3300013306 Unclassified 620
297 Ga0157372_10023759 3300013307 Bacteria 6649
298 Ga0157372_11925914 3300013307 Unclassified 679
299 Ga0157375_10013824 3300013308 Bacteria 7194
300 Ga0157375_10021664 3300013308 Bacteria 5899
301 Ga0157375_10537932 3300013308 Bacteria 1331
302 Ga0157375_10587329 3300013308 Bacteria 1274
303 Ga0157375_11378080 3300013308 Bacteria 830
304 Ga0163163_10014438 3300014325 Bacteria 7261
305 Ga0163163_10071584 3300014325 Bacteria 3455
306 Ga0163163_10083214 3300014325 Bacteria 3205
307 Ga0163163_10124736 3300014325 Bacteria 2612
308 Ga0157377_10008557 3300014745 Bacteria 4993
309 Ga0157379_10001782 3300014968 Bacteria 17776
310 Ga0157379_10026764 3300014968 Bacteria 5134
311 Ga0157379_10057142 3300014968 Bacteria 3487
312 Ga0157379_10909005 3300014968 Bacteria 835
313 Ga0163161_10367571 3300017792 Bacteria 1147
314 Ga0213876_10039897 3300021384 Bacteria 2480
315 Ga0207697_10021713 3300025315 Bacteria 2629
316 Ga0207697_10219700 3300025315 Bacteria 838
317 Ga0207656_10013560 3300025321 Bacteria 3119
318 Ga0207656_10216066 3300025321 Bacteria 931
319 Ga0207682_10008218 3300025893 Bacteria 4137
320 Ga0207642_10040110 3300025899 Bacteria 2041
321 Ga0207688_10025327 3300025901 Bacteria 3257
322 Ga0207688_10041320 3300025901 Bacteria 2565
323 Ga0207688_10141012 3300025901 Bacteria 1419
324 Ga0207680_10005316 3300025903 Bacteria 6148
325 Ga0207680_10005472 3300025903 Bacteria 6069
326 Ga0207680_10013886 3300025903 Bacteria 4151
327 Ga0207680_10025541 3300025903 Bacteria 3260
328 Ga0207680_10122207 3300025903 Bacteria 1704
329 Ga0207680_10160456 3300025903 Bacteria 1507
330 Ga0207680_10444685 3300025903 Bacteria 920
331 Ga0207647_10003939 3300025904 Bacteria 11083
332 Ga0207647_10014370 3300025904 Bacteria 5458
333 Ga0207645_10036726 3300025907 Bacteria 3146
334 Ga0207645_10102840 3300025907 Bacteria 1844
335 Ga0207645_10109045 3300025907 Bacteria 1791
336 Ga0207645_10174139 3300025907 Bacteria 1411
337 Ga0207645_10178160 3300025907 Bacteria 1394
338 Ga0207643_10122743 3300025908 Bacteria 1540
339 Ga0207705_10003103 3300025909 Bacteria 12670
340 Ga0207705_10004954 3300025909 Bacteria 9997
341 Ga0207705_10130873 3300025909 Bacteria 1867
342 Ga0207705_10218103 3300025909 Bacteria 1448
343 Ga0207705_10428860 3300025909 Bacteria 1024
344 Ga0207662_10160306 3300025918 Bacteria 1437
345 Ga0207662_10203519 3300025918 Bacteria 1282
346 Ga0207657_10008170 3300025919 Bacteria 10663
347 Ga0207657_10019353 3300025919 Bacteria 6468
348 Ga0207657_10200823 3300025919 Bacteria 1604
349 Ga0207657_10514929 3300025919 Bacteria 937
350 Ga0207657_10564964 3300025919 Bacteria 889
351 Ga0207657_10940270 3300025919 Bacteria 665
352 Ga0207649_10025348 3300025920 Bacteria 3456
353 Ga0207649_10041227 3300025920 Bacteria 2810
354 Ga0207649_10057363 3300025920 Bacteria 2435
355 Ga0207649_10071522 3300025920 Bacteria 2216
356 Ga0207649_10109523 3300025920 Bacteria 1843
357 Ga0207649_10211799 3300025920 Bacteria 1375
358 Ga0207649_10619719 3300025920 Bacteria 834
359 Ga0207649_10632779 3300025920 Bacteria 825
360 Ga0207649_10840760 3300025920 Unclassified 718
361 Ga0207681_10169137 3300025923 Bacteria 1655
362 Ga0207681_10182457 3300025923 Bacteria 1600
363 Ga0207694_10239640 3300025924 Bacteria 1482
364 Ga0207650_10016148 3300025925 Bacteria 5213
365 Ga0207650_10018523 3300025925 Bacteria 4886
366 Ga0207650_10025993 3300025925 Bacteria 4173
367 Ga0207650_10040083 3300025925 Bacteria 3426
368 Ga0207650_10138955 3300025925 Bacteria 1908
369 Ga0207650_10293004 3300025925 Bacteria 1327
370 Ga0207650_10650950 3300025925 Bacteria 888
371 Ga0207650_10954520 3300025925 Bacteria 729
372 Ga0207659_10052602 3300025926 Bacteria 2902
373 Ga0207659_10101363 3300025926 Bacteria 2171
374 Ga0207687_10017705 3300025927 Bacteria 4695
375 Ga0207687_10109576 3300025927 Bacteria 2046
376 Ga0207687_10324423 3300025927 Bacteria 1247
377 Ga0207644_10004377 3300025931 Bacteria 9166
378 Ga0207644_10008224 3300025931 Bacteria 6833
379 Ga0207644_10010174 3300025931 Bacteria 6197
380 Ga0207644_10076393 3300025931 Bacteria 2464
381 Ga0207644_10120867 3300025931 Bacteria 1994
382 Ga0207644_10308873 3300025931 Bacteria 1276
383 Ga0207644_10945355 3300025931 Bacteria 723
384 Ga0207690_10007764 3300025932 Bacteria 6370
385 Ga0207690_10008141 3300025932 Bacteria 6221
386 Ga0207690_10039855 3300025932 Bacteria 3067
387 Ga0207690_10117963 3300025932 Bacteria 1922
388 Ga0207690_10405984 3300025932 Bacteria 1087
389 Ga0207706_10000742 3300025933 Bacteria 33946
390 Ga0207706_10000893 3300025933 Bacteria 30622
391 Ga0207706_10004043 3300025933 Bacteria 13878
392 Ga0207706_10011556 3300025933 Bacteria 8040
393 Ga0207706_10018841 3300025933 Bacteria 6207
394 Ga0207706_10036685 3300025933 Bacteria 4354
395 Ga0207706_10072603 3300025933 Bacteria 3027
396 Ga0207706_10114309 3300025933 Bacteria 2374
397 Ga0207706_10264113 3300025933 Bacteria 1502
398 Ga0207706_10276530 3300025933 Bacteria 1465
399 Ga0207709_10068490 3300025935 Bacteria 2243
400 Ga0207669_10108034 3300025937 Bacteria 1857
401 Ga0207669_10483542 3300025937 Bacteria 987
402 Ga0207669_10596151 3300025937 Bacteria 897
403 Ga0207704_10007623 3300025938 Bacteria 5126
404 Ga0207704_10109742 3300025938 Bacteria 1862
405 Ga0207704_10241090 3300025938 Bacteria 1351
406 Ga0207704_10268910 3300025938 Bacteria 1290
407 Ga0207691_10000820 3300025940 Bacteria 30962
408 Ga0207691_10005345 3300025940 Bacteria 12394
409 Ga0207691_10013135 3300025940 Bacteria 7928
410 Ga0207691_10066301 3300025940 Bacteria 3266
411 Ga0207691_10105143 3300025940 Bacteria 2515
412 Ga0207711_10001274 3300025941 Bacteria 23890
413 Ga0207711_10004315 3300025941 Bacteria 12151
414 Ga0207711_10007890 3300025941 Bacteria 8902
415 Ga0207711_10015675 3300025941 Bacteria 6286
416 Ga0207711_10125118 3300025941 Bacteria 2299
417 Ga0207711_10557334 3300025941 Bacteria 1069
418 Ga0207711_10579790 3300025941 Bacteria 1046
419 Ga0207689_10023182 3300025942 Bacteria 5211
420 Ga0207689_10035485 3300025942 Bacteria 4142
421 Ga0207689_10279293 3300025942 Bacteria 1383
422 Ga0207689_10420103 3300025942 Bacteria 1116
423 Ga0207661_10095297 3300025944 Bacteria 2488
424 Ga0207661_10814020 3300025944 Bacteria 860
425 Ga0207661_11185691 3300025944 Bacteria 703
426 Ga0207679_10004636 3300025945 Bacteria 8556
427 Ga0207679_10056175 3300025945 Bacteria 2905
428 Ga0207679_10106452 3300025945 Bacteria 2204
429 Ga0207679_10143780 3300025945 Bacteria 1932
430 Ga0207679_10153164 3300025945 Bacteria 1879
431 Ga0207679_10158306 3300025945 Bacteria 1851
432 Ga0207679_10570475 3300025945 Bacteria 1017
433 Ga0207667_10022584 3300025949 Bacteria 6944
434 Ga0207667_10679885 3300025949 Bacteria 1033
435 Ga0207651_10015279 3300025960 Bacteria 4456
436 Ga0207651_10020635 3300025960 Bacteria 3982
437 Ga0207651_10025830 3300025960 Bacteria 3657
438 Ga0207651_10166768 3300025960 Bacteria 1732
439 Ga0207651_10265791 3300025960 Bacteria 1410
440 Ga0207651_10309706 3300025960 Bacteria 1316
441 Ga0207712_10002542 3300025961 Bacteria 11728
442 Ga0207712_10604818 3300025961 Bacteria 949
443 Ga0207668_10140995 3300025972 Bacteria 1854
444 Ga0207668_10196874 3300025972 Bacteria 1602
445 Ga0207668_10336687 3300025972 Bacteria 1257
446 Ga0207640_10006679 3300025981 Bacteria 6339
447 Ga0207640_10051244 3300025981 Bacteria 2682
448 Ga0207640_10064855 3300025981 Bacteria 2434
449 Ga0207640_10232852 3300025981 Bacteria 1418
450 Ga0207640_10257496 3300025981 Bacteria 1358
451 Ga0207640_10493687 3300025981 Bacteria 1018
452 Ga0207640_10570229 3300025981 Bacteria 954
453 Ga0207658_10001885 3300025986 Bacteria 15696
454 Ga0207658_10007523 3300025986 Bacteria 7419
455 Ga0207658_10008648 3300025986 Bacteria 6921
456 Ga0207658_10017392 3300025986 Bacteria 4953
457 Ga0207658_10071299 3300025986 Bacteria 2631
458 Ga0207658_10117946 3300025986 Bacteria 2110
459 Ga0207658_10321305 3300025986 Bacteria 1340
460 Ga0207658_10326170 3300025986 Bacteria 1330
461 Ga0207658_10438386 3300025986 Bacteria 1155
462 Ga0207658_10569889 3300025986 Bacteria 1015
463 Ga0207677_10000890 3300026023 Bacteria 16790
464 Ga0207677_10064764 3300026023 Bacteria 2547
465 Ga0207677_10125417 3300026023 Bacteria 1940
466 Ga0207677_10143124 3300026023 Bacteria 1834
467 Ga0207677_10266324 3300026023 Bacteria 1399
468 Ga0207677_10318573 3300026023 Bacteria 1291
469 Ga0207677_10597282 3300026023 Bacteria 968
470 Ga0207703_10003017 3300026035 Bacteria 14263
471 Ga0207703_10027953 3300026035 Bacteria 4441
472 Ga0207703_10255557 3300026035 Bacteria 1582
473 Ga0207703_10415808 3300026035 Bacteria 1250
474 Ga0207639_10144631 3300026041 Bacteria 1985
475 Ga0207639_10313157 3300026041 Bacteria 1391
476 Ga0207639_10362512 3300026041 Bacteria 1297
477 Ga0207639_10518794 3300026041 Bacteria 1091
478 Ga0207639_10796789 3300026041 Bacteria 880
479 Ga0207678_10000558 3300026067 Bacteria 34014
480 Ga0207678_10001651 3300026067 Bacteria 20438
481 Ga0207678_10005870 3300026067 Bacteria 10947
482 Ga0207678_10115782 3300026067 Bacteria 2287
483 Ga0207678_10228086 3300026067 Bacteria 1595
484 Ga0207678_10302667 3300026067 Bacteria 1374
485 Ga0207678_10513188 3300026067 Bacteria 1046
486 Ga0207702_10497558 3300026078 Bacteria 1188
487 Ga0207702_10624504 3300026078 Bacteria 1058
488 Ga0207641_10003074 3300026088 Bacteria 15050
489 Ga0207641_10013048 3300026088 Bacteria 6815
490 Ga0207641_10051781 3300026088 Bacteria 3477
491 Ga0207641_10250929 3300026088 Bacteria 1652
492 Ga0207641_11368771 3300026088 Bacteria 709
493 Ga0207648_10005192 3300026089 Bacteria 13188
494 Ga0207648_10005560 3300026089 Bacteria 12686
495 Ga0207648_10087242 3300026089 Bacteria 2723
496 Ga0207648_10095447 3300026089 Bacteria 2601
497 Ga0207648_10947568 3300026089 Bacteria 805
498 Ga0207676_10007129 3300026095 Bacteria 7918
499 Ga0207676_10059822 3300026095 Bacteria 3010
500 Ga0207676_10495068 3300026095 Bacteria 1160
501 Ga0207676_10496341 3300026095 Bacteria 1158
502 Ga0207676_10507507 3300026095 Bacteria 1146
503 Ga0207674_10001601 3300026116 Bacteria 29155
504 Ga0207674_10002680 3300026116 Bacteria 22216
505 Ga0207674_10007257 3300026116 Bacteria 12920
506 Ga0207674_10019167 3300026116 Bacteria 7418
507 Ga0207674_10039628 3300026116 Bacteria 4883
508 Ga0207674_11255945 3300026116 Bacteria 710
509 Ga0207675_100157398 3300026118 Bacteria 2165
510 Ga0207683_10007896 3300026121 Bacteria 9102
511 Ga0207683_10019662 3300026121 Bacteria 5770
512 Ga0207683_10046328 3300026121 Bacteria 3805
513 Ga0207683_10133954 3300026121 Bacteria 2230
514 Ga0207698_10116555 3300026142 Bacteria 2251
515 Ga0207698_10121945 3300026142 Bacteria 2208
516 Ga0207698_10140337 3300026142 Bacteria 2081
517 Ga0207698_10157645 3300026142 Bacteria 1980
518 Ga0207698_10166044 3300026142 Bacteria 1937
519 Ga0207698_10174346 3300026142 Bacteria 1897
520 Ga0207698_10188095 3300026142 Bacteria 1836
521 Ga0207698_10220108 3300026142 Bacteria 1715
522 Ga0207698_10432273 3300026142 Bacteria 1266
523 Ga0268266_10010106 3300028379 Bacteria 8274
524 Ga0268266_10150624 3300028379 Bacteria 2096
525 Ga0268265_10144046 3300028380 Bacteria 1999
526 Ga0268265_10291751 3300028380 Bacteria 1464
527 Ga0268265_10632620 3300028380 Bacteria 1026
528 Ga0268264_10007642 3300028381 Bacteria 9010
529 Ga0268264_10029770 3300028381 Bacteria 4474
530 Ga0268264_10210676 3300028381 Bacteria 1784
531 Ga0268264_10433370 3300028381 Bacteria 1270
532 Ga0268264_10440128 3300028381 Bacteria 1261
533 Ga0307408_100121665 3300031548 Bacteria 2023
534 Ga0307408_100200839 3300031548 Bacteria 1613
535 Ga0307405_10204901 3300031731 Bacteria 1435
536 Ga0307405_10785965 3300031731 Bacteria 796
537 Ga0307413_10165600 3300031824 Bacteria 1558
538 Ga0307413_10306613 3300031824 Bacteria 1206
539 Ga0307410_10670604 3300031852 Bacteria 871
540 Ga0307406_10222113 3300031901 Bacteria 1405
541 Ga0307406_10603114 3300031901 Bacteria 905
542 Ga0307412_10500473 3300031911 Bacteria 1011
543 Ga0307409_100108393 3300031995 Bacteria 2323
544 Ga0307416_100006146 3300032002 Bacteria 7484
545 Ga0307416_100245785 3300032002 Bacteria 1737
546 Ga0307416_101845024 3300032002 Unclassified 708
547 Ga0307411_10186562 3300032005 Bacteria 1579
548 Ga0307411_10250357 3300032005 Bacteria 1392
549 Ga0307415_100009011 3300032126 Bacteria 5566
550 Ga0307415_100284462 3300032126 Bacteria 1361
551 Ga0307415_100450701 3300032126 Bacteria 1112
552 Ga0307415_101301272 3300032126 Unclassified 688
553 Ga0373945_0069172 3300035116 Bacteria 1333
554 Ga0373946_0100125 3300035171 Bacteria 1298
555 Ga0373946_0279511 3300035171 Bacteria 821
556 Ga0373962_0222350 3300035242 Bacteria 647
557 Ga0373935_0233231 3300035692 Bacteria 1282
558 Ga0373947_0095669 3300035725 Bacteria 1859
559 Ga0373925_0126560 3300037068 Bacteria 1988
560 Ga0395899_0368419 3300037312 Bacteria 957
561 Ga0395900_0051457 3300037418 Bacteria 4243
562 Ga0395900_0098248 3300037418 Bacteria 3008
563 Ga0395900_0122741 3300037418 Bacteria 2664
564 Ga0395900_0244574 3300037418 Bacteria 1798
565 Ga0395900_0422899 3300037418 Bacteria 1293
566 Ga0395900_0488890 3300037418 Bacteria 1182
567 Ga0395900_0547656 3300037418 Bacteria 1102
568 Ga0395900_0686531 3300037418 Bacteria 958
569 Ga0395900_0711208 3300037418 Unclassified 937
570 Ga0395898_0370582 3300037466 Bacteria 1366
571 Ga0395898_0428129 3300037466 Bacteria 1261
572 Ga0395898_1861026 3300037466 Unclassified 522
573 Ga0395905_0011255 3300037471 Bacteria 8650
574 Ga0395905_0016471 3300037471 Bacteria 7027
575 Ga0395905_0037948 3300037471 Bacteria 4521
576 Ga0395905_0038845 3300037471 Bacteria 4465
577 Ga0395905_0072518 3300037471 Bacteria 3228
578 Ga0395905_0117794 3300037471 Bacteria 2496
579 Ga0395905_0127390 3300037471 Bacteria 2394
580 Ga0395905_0229896 3300037471 Bacteria 1734
581 Ga0395905_0308781 3300037471 Bacteria 1470
582 Ga0395905_0649003 3300037471 Bacteria 957
583 Ga0395905_0769264 3300037471 Bacteria 866
584 Ga0395905_0819994 3300037471 Unclassified 833
585 Ga0395905_1642610 3300037471 Unclassified 547
586 Ga0395905_1786205 3300037471 Unclassified 520
587 Ga0395901_0055360 3300038443 Bacteria 4125
588 Ga0395901_0087707 3300038443 Bacteria 3254
589 Ga0395901_0094734 3300038443 Bacteria 3128
590 Ga0395901_0133521 3300038443 Bacteria 2609
591 Ga0395901_0144456 3300038443 Bacteria 2501
592 Ga0395901_0145798 3300038443 Bacteria 2488
593 Ga0395901_0233924 3300038443 Bacteria 1918
594 Ga0395901_0563040 3300038443 Bacteria 1154
595 Ga0395901_0723868 3300038443 Bacteria 990
596 Ga0395901_1049794 3300038443 Bacteria 788
597 Ga0436365_0615625 3300039437 Bacteria 10749
598 Ga0439449_0112669 3300042007 Bacteria 1008
599 Ga0466969_0214982 3300044656 Bacteria 875
600 Ga0466972_0195020 3300044658 Bacteria 949
601 Ga0466966_0159427 3300044684 Bacteria 1374
602 Ga0466961_0240679 3300044693 Bacteria 1112
603 Ga0466963_0131466 3300044694 Bacteria 1729
604 Ga0466964_0009075 3300044706 Bacteria 3740
605 Ga0466964_0049800 3300044706 Bacteria 1716
606 Ga0466970_0006659 3300044765 Bacteria 5777
607 Ga0466970_0206476 3300044765 Bacteria 1094
608 Ga0466957_0023627 3300044842 Bacteria 3635
609 Ga0466958_0070961 3300045836 Bacteria 2132
610 Ga0466958_0163225 3300045836 Bacteria 1408
611 Ga0466967_0026767 3300045976 Bacteria 4784
612 Ga0495629_0348390 3300046459 Bacteria 1011
613 Ga0495621_0000183 3300046539 Bacteria 14351
614 Ga0495621_0063417 3300046539 Bacteria 1346
615 Ga0495668_0239633 3300046616 Bacteria 993
616 Ga0495669_0100617 3300046684 Bacteria 1342
617 Ga0495669_0255306 3300046684 Bacteria 842
618 Ga0495670_0005394 3300046691 Bacteria 6283
619 Ga0495670_0136025 3300046691 Bacteria 1283
620 Ga0496100_0459970 3300048903 Bacteria 976
621 Ga0496101_0015261 3300048904 Bacteria 5172
622 Ga0496101_0044620 3300048904 Bacteria 3172
623 Ga0496101_0111094 3300048904 Bacteria 2063
624 Ga0496101_0234621 3300048904 Bacteria 1427
625 Ga0496101_0321892 3300048904 Bacteria 1213
626 Ga0496101_0982892 3300048904 Unclassified 664
627 Ga0496102_0085007 3300048905 Bacteria 2921
628 Ga0496102_0275531 3300048905 Bacteria 1586
629 Ga0496102_0602910 3300048905 Bacteria 1021
630 Ga0496103_0130767 3300048906 Bacteria 1603
631 Ga0496103_0132032 3300048906 Bacteria 1595
632 Ga0496103_0543422 3300048906 Bacteria 742
633 Ga0496104_0081963 3300048907 Bacteria 3077
634 Ga0496106_0075995 3300048909 Bacteria 2574
635 Ga0496106_0683910 3300048909 Bacteria 818
636 Ga0496107_0002167 3300048910 Bacteria 12611
637 Ga0496107_0020747 3300048910 Bacteria 4643
638 Ga0496107_0051032 3300048910 Bacteria 2983
639 Ga0496107_0084173 3300048910 Bacteria 2320
640 Ga0496107_0432227 3300048910 Bacteria 979
641 Ga0496108_0001354 3300048911 Bacteria 19266
642 Ga0496108_0002739 3300048911 Bacteria 14094
643 Ga0496108_0064742 3300048911 Bacteria 3080
644 Ga0496108_0354992 3300048911 Bacteria 1279
645 Ga0496109_0003600 3300048912 Bacteria 12942
646 Ga0496109_0033166 3300048912 Bacteria 4644
647 Ga0496109_0326458 3300048912 Bacteria 1448
648 Ga0496110_0010292 3300048913 Bacteria 7601
649 Ga0496111_0006954 3300048914 Bacteria 7384
650 Ga0496111_0077057 3300048914 Bacteria 2430
651 Ga0496111_0097256 3300048914 Bacteria 2161
652 Ga0496111_0273357 3300048914 Bacteria 1253
653 Ga0496111_0390642 3300048914 Bacteria 1029
654 Ga0496111_0579275 3300048914 Bacteria 822
655 Ga0496112_0024097 3300048915 Bacteria 5824
656 Ga0496112_0044416 3300048915 Bacteria 4353
657 Ga0496112_0143243 3300048915 Bacteria 2359
658 Ga0496112_0324766 3300048915 Bacteria 1483
659 Ga0496112_1108265 3300048915 Unclassified 710
660 Ga0496113_0038849 3300048916 Bacteria 3501
661 Ga0496113_0105347 3300048916 Bacteria 2189
662 Ga0496113_0291569 3300048916 Bacteria 1305
663 Ga0496114_0131015 3300048917 Bacteria 2165
664 Ga0496115_0036712 3300048918 Bacteria 3881
665 Ga0501217_105821 3300049661 Bacteria 804
666 Ga0501230_010693 3300049667 Bacteria 1439
667 Ga0501235_085822 3300049669 Bacteria 756
668 Ga0501249_027203 3300049679 Bacteria 1265
669 nmdc:mga0n895_270595_c1 3300050512 Bacteria 1723
670 nmdc:mga0rr50_540501_c1 3300050513 Bacteria 992
671 nmdc:mga0a205_822_c1 3300050515 Bacteria 25262
672 Ga0466962_0007379 3300061719 Bacteria 5275

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0488890 Ga0395900_0488890_52_528 150
2 3300037466 Ga0395898_1861026 Ga0395898_1861026_12_479 155
3 3300037471 Ga0395905_1642610 Ga0395905_1642610_66_533 155
4 3300037471 Ga0395905_1786205 Ga0395905_1786205_41_508 155
5 3300013307 Ga0157372_11925914 Ga0157372_119259141 158
6 3300050512 nmdc:mga0n895_270595_c1 nmdc:mga0n895_270595_c1_30_515 161
7 3300050513 nmdc:mga0rr50_540501_c1 nmdc:mga0rr50_540501_c1_487_972 161
8 3300013296 Ga0157374_10341455 Ga0157374_103414552 163
9 3300035116 Ga0373945_0069172 Ga0373945_0069172_469_987 169
10 3300005329 Ga0070683_100148560 Ga0070683_1001485602 170
11 3300005457 Ga0070662_100055180 Ga0070662_1000551803 170
12 3300009551 Ga0105238_10619968 Ga0105238_106199682 170
13 3300011119 Ga0105246_10159299 Ga0105246_101592992 170
14 3300025932 Ga0207690_10008141 Ga0207690_100081417 170
15 3300025933 Ga0207706_10018841 Ga0207706_100188414 170
16 3300026041 Ga0207639_10518794 Ga0207639_105187941 170
17 3300026142 Ga0207698_10220108 Ga0207698_102201082 170
18 3300037312 Ga0395899_0368419 Ga0395899_0368419_163_702 170
19 3300037418 Ga0395900_0244574 Ga0395900_0244574_106_645 170
20 3300037418 Ga0395900_0422899 Ga0395900_0422899_337_876 170
21 3300037418 Ga0395900_0711208 Ga0395900_0711208_351_914 170
22 3300037466 Ga0395898_0428129 Ga0395898_0428129_400_939 170
23 3300037471 Ga0395905_0011255 Ga0395905_0011255_3248_3787 170
24 3300037471 Ga0395905_0117794 Ga0395905_0117794_1531_2070 170
25 3300037471 Ga0395905_0229896 Ga0395905_0229896_229_768 170
26 3300037471 Ga0395905_0649003 Ga0395905_0649003_397_936 170
27 3300038443 Ga0395901_0055360 Ga0395901_0055360_87_626 170
28 3300038443 Ga0395901_0144456 Ga0395901_0144456_795_1334 170
29 3300038443 Ga0395901_0145798 Ga0395901_0145798_114_677 170
30 3300038443 Ga0395901_0723868 Ga0395901_0723868_73_612 170
31 3300005367 Ga0070667_100002154 Ga0070667_1000021546 171
32 3300005843 Ga0068860_100148559 Ga0068860_1001485593 171
33 3300009177 Ga0105248_10003908 Ga0105248_100039086 171
34 3300014968 Ga0157379_10026764 Ga0157379_100267643 171
35 3300017792 Ga0163161_10367571 Ga0163161_103675711 171
36 3300025941 Ga0207711_10004315 Ga0207711_100043154 171
37 3300025986 Ga0207658_10007523 Ga0207658_100075235 171
38 3300026035 Ga0207703_10255557 Ga0207703_102555572 171
39 3300048914 Ga0496111_0390642 Ga0496111_0390642_194_733 171
40 3300035171 Ga0373946_0279511 Ga0373946_0279511_51_578 173
41 3300005293 Ga0065715_10445978 Ga0065715_104459781 175
42 3300005331 Ga0070670_100037311 Ga0070670_1000373113 175
43 3300005331 Ga0070670_100231757 Ga0070670_1002317572 175
44 3300005339 Ga0070660_100196915 Ga0070660_1001969152 175
45 3300005367 Ga0070667_101407426 Ga0070667_1014074261 175
46 3300005435 Ga0070714_100038119 Ga0070714_1000381194 175
47 3300005457 Ga0070662_101190864 Ga0070662_1011908641 175
48 3300005548 Ga0070665_100485298 Ga0070665_1004852982 175
49 3300005564 Ga0070664_100495612 Ga0070664_1004956122 175
50 3300005577 Ga0068857_100225298 Ga0068857_1002252982 175
51 3300025925 Ga0207650_10018523 Ga0207650_100185233 175
52 3300025925 Ga0207650_10954520 Ga0207650_109545201 175
53 3300026116 Ga0207674_10019167 Ga0207674_100191673 175
54 3300037418 Ga0395900_0098248 Ga0395900_0098248_571_1113 175
55 3300037471 Ga0395905_0037948 Ga0395905_0037948_3812_4345 175
56 3300037471 Ga0395905_0769264 Ga0395905_0769264_18_551 175
57 3300038443 Ga0395901_0233924 Ga0395901_0233924_361_903 175
58 3300048911 Ga0496108_0002739 Ga0496108_0002739_10599_11132 175
59 3300001989 JGI24739J22299_10001515 JGI24739J22299_100015155 176
60 3300001989 JGI24739J22299_10046778 JGI24739J22299_100467782 176
61 3300001990 JGI24737J22298_10114970 JGI24737J22298_101149701 176
62 3300002075 JGI24738J21930_10063765 JGI24738J21930_100637652 176
63 3300002077 JGI24744J21845_10003924 JGI24744J21845_100039242 176
64 3300005293 Ga0065715_10222191 Ga0065715_102221912 176
65 3300005327 Ga0070658_10097808 Ga0070658_100978082 176
66 3300005327 Ga0070658_10263399 Ga0070658_102633992 176
67 3300005327 Ga0070658_10322390 Ga0070658_103223902 176
68 3300005327 Ga0070658_10433439 Ga0070658_104334392 176
69 3300005327 Ga0070658_10863229 Ga0070658_108632291 176
70 3300005327 Ga0070658_11042174 Ga0070658_110421741 176
71 3300005328 Ga0070676_10181641 Ga0070676_101816412 176
72 3300005328 Ga0070676_10334284 Ga0070676_103342842 176
73 3300005329 Ga0070683_100594518 Ga0070683_1005945182 176
74 3300005330 Ga0070690_100025707 Ga0070690_1000257074 176
75 3300005330 Ga0070690_100059041 Ga0070690_1000590413 176
76 3300005331 Ga0070670_100038135 Ga0070670_1000381351 176
77 3300005331 Ga0070670_100273793 Ga0070670_1002737932 176
78 3300005334 Ga0068869_100612305 Ga0068869_1006123052 176
79 3300005335 Ga0070666_10001646 Ga0070666_100016464 176
80 3300005335 Ga0070666_10019786 Ga0070666_100197863 176
81 3300005335 Ga0070666_10025241 Ga0070666_100252412 176
82 3300005335 Ga0070666_10047624 Ga0070666_100476242 176
83 3300005335 Ga0070666_10134351 Ga0070666_101343512 176
84 3300005338 Ga0068868_100001374 Ga0068868_1000013748 176
85 3300005338 Ga0068868_100018524 Ga0068868_1000185245 176
86 3300005338 Ga0068868_100027559 Ga0068868_1000275595 176
87 3300005338 Ga0068868_100347962 Ga0068868_1003479622 176
88 3300005338 Ga0068868_100824753 Ga0068868_1008247532 176
89 3300005339 Ga0070660_100014609 Ga0070660_1000146092 176
90 3300005339 Ga0070660_100153338 Ga0070660_1001533382 176
91 3300005339 Ga0070660_100593668 Ga0070660_1005936682 176
92 3300005340 Ga0070689_100792404 Ga0070689_1007924041 176
93 3300005343 Ga0070687_100351234 Ga0070687_1003512341 176
94 3300005343 Ga0070687_100394410 Ga0070687_1003944101 176
95 3300005344 Ga0070661_100077229 Ga0070661_1000772292 176
96 3300005344 Ga0070661_101177320 Ga0070661_1011773201 176
97 3300005347 Ga0070668_100474401 Ga0070668_1004744012 176
98 3300005353 Ga0070669_100203467 Ga0070669_1002034672 176
99 3300005353 Ga0070669_100448159 Ga0070669_1004481592 176
100 3300005354 Ga0070675_100035449 Ga0070675_1000354492 176
101 3300005355 Ga0070671_100083872 Ga0070671_1000838722 176
102 3300005355 Ga0070671_100142406 Ga0070671_1001424062 176
103 3300005355 Ga0070671_100248616 Ga0070671_1002486162 176
104 3300005355 Ga0070671_100260286 Ga0070671_1002602862 176
105 3300005355 Ga0070671_100874413 Ga0070671_1008744131 176
106 3300005355 Ga0070671_100915330 Ga0070671_1009153302 176
107 3300005356 Ga0070674_100044341 Ga0070674_1000443413 176
108 3300005356 Ga0070674_100473902 Ga0070674_1004739022 176
109 3300005356 Ga0070674_100615085 Ga0070674_1006150852 176
110 3300005364 Ga0070673_100121514 Ga0070673_1001215141 176
111 3300005364 Ga0070673_100243170 Ga0070673_1002431702 176
112 3300005364 Ga0070673_100352350 Ga0070673_1003523501 176
113 3300005364 Ga0070673_100485717 Ga0070673_1004857171 176
114 3300005364 Ga0070673_101328256 Ga0070673_1013282561 176
115 3300005365 Ga0070688_100847579 Ga0070688_1008475791 176
116 3300005366 Ga0070659_100025309 Ga0070659_1000253092 176
117 3300005366 Ga0070659_100036446 Ga0070659_1000364464 176
118 3300005366 Ga0070659_100090911 Ga0070659_1000909113 176
119 3300005366 Ga0070659_100339314 Ga0070659_1003393142 176
120 3300005366 Ga0070659_100463260 Ga0070659_1004632602 176
121 3300005366 Ga0070659_100623253 Ga0070659_1006232531 176
122 3300005367 Ga0070667_100002025 Ga0070667_1000020253 176
123 3300005367 Ga0070667_100254506 Ga0070667_1002545062 176
124 3300005367 Ga0070667_100432757 Ga0070667_1004327572 176
125 3300005367 Ga0070667_100501407 Ga0070667_1005014072 176
126 3300005438 Ga0070701_10384826 Ga0070701_103848261 176
127 3300005455 Ga0070663_100051594 Ga0070663_1000515943 176
128 3300005455 Ga0070663_100136288 Ga0070663_1001362882 176
129 3300005455 Ga0070663_100159869 Ga0070663_1001598692 176
130 3300005455 Ga0070663_100220927 Ga0070663_1002209272 176
131 3300005455 Ga0070663_100335743 Ga0070663_1003357432 176
132 3300005455 Ga0070663_100442434 Ga0070663_1004424342 176
133 3300005456 Ga0070678_100073959 Ga0070678_1000739593 176
134 3300005456 Ga0070678_100081233 Ga0070678_1000812333 176
135 3300005457 Ga0070662_100009105 Ga0070662_1000091055 176
136 3300005457 Ga0070662_100068687 Ga0070662_1000686872 176
137 3300005457 Ga0070662_100152695 Ga0070662_1001526952 176
138 3300005457 Ga0070662_100274369 Ga0070662_1002743692 176
139 3300005458 Ga0070681_10623849 Ga0070681_106238492 176
140 3300005459 Ga0068867_100066622 Ga0068867_1000666223 176
141 3300005466 Ga0070685_10071423 Ga0070685_100714232 176
142 3300005539 Ga0068853_100250976 Ga0068853_1002509761 176
143 3300005539 Ga0068853_100329120 Ga0068853_1003291202 176
144 3300005539 Ga0068853_100376770 Ga0068853_1003767702 176
145 3300005539 Ga0068853_100404906 Ga0068853_1004049062 176
146 3300005543 Ga0070672_100069279 Ga0070672_1000692794 176
147 3300005543 Ga0070672_100144676 Ga0070672_1001446762 176
148 3300005545 Ga0070695_100847516 Ga0070695_1008475162 176
149 3300005547 Ga0070693_100035832 Ga0070693_1000358322 176
150 3300005548 Ga0070665_100012511 Ga0070665_1000125114 176
151 3300005548 Ga0070665_100547973 Ga0070665_1005479732 176
152 3300005548 Ga0070665_100700161 Ga0070665_1007001611 176
153 3300005563 Ga0068855_100424104 Ga0068855_1004241042 176
154 3300005564 Ga0070664_100002277 Ga0070664_1000022776 176
155 3300005564 Ga0070664_100016176 Ga0070664_1000161764 176
156 3300005564 Ga0070664_100047762 Ga0070664_1000477623 176
157 3300005564 Ga0070664_100139937 Ga0070664_1001399372 176
158 3300005577 Ga0068857_100015547 Ga0068857_1000155472 176
159 3300005577 Ga0068857_100233169 Ga0068857_1002331693 176
160 3300005578 Ga0068854_100051213 Ga0068854_1000512133 176
161 3300005578 Ga0068854_100185115 Ga0068854_1001851152 176
162 3300005578 Ga0068854_100714372 Ga0068854_1007143722 176
163 3300005578 Ga0068854_100771845 Ga0068854_1007718451 176
164 3300005614 Ga0068856_100984857 Ga0068856_1009848571 176
165 3300005615 Ga0070702_100282860 Ga0070702_1002828602 176
166 3300005616 Ga0068852_100235400 Ga0068852_1002354002 176
167 3300005616 Ga0068852_100311921 Ga0068852_1003119212 176
168 3300005616 Ga0068852_100411859 Ga0068852_1004118592 176
169 3300005616 Ga0068852_100575719 Ga0068852_1005757192 176
170 3300005616 Ga0068852_101029463 Ga0068852_1010294632 176
171 3300005616 Ga0068852_101090496 Ga0068852_1010904962 176
172 3300005617 Ga0068859_100045775 Ga0068859_1000457754 176
173 3300005617 Ga0068859_100088510 Ga0068859_1000885103 176
174 3300005617 Ga0068859_100266898 Ga0068859_1002668982 176
175 3300005618 Ga0068864_100066231 Ga0068864_1000662312 176
176 3300005618 Ga0068864_100306639 Ga0068864_1003066392 176
177 3300005618 Ga0068864_100458777 Ga0068864_1004587772 176
178 3300005618 Ga0068864_100684424 Ga0068864_1006844242 176
179 3300005718 Ga0068866_10006749 Ga0068866_100067495 176
180 3300005718 Ga0068866_10391689 Ga0068866_103916891 176
181 3300005719 Ga0068861_100299232 Ga0068861_1002992322 176
182 3300005834 Ga0068851_10002715 Ga0068851_100027151 176
183 3300005834 Ga0068851_10114074 Ga0068851_101140743 176
184 3300005834 Ga0068851_10265089 Ga0068851_102650892 176
185 3300005834 Ga0068851_10308308 Ga0068851_103083082 176
186 3300005841 Ga0068863_100006484 Ga0068863_10000648415 176
187 3300005842 Ga0068858_100007187 Ga0068858_1000071878 176
188 3300005842 Ga0068858_100063635 Ga0068858_1000636354 176
189 3300005842 Ga0068858_100320673 Ga0068858_1003206732 176
190 3300005842 Ga0068858_100708757 Ga0068858_1007087571 176
191 3300005843 Ga0068860_100195121 Ga0068860_1001951212 176
192 3300005843 Ga0068860_100635252 Ga0068860_1006352522 176
193 3300006237 Ga0097621_100244088 Ga0097621_1002440883 176
194 3300006237 Ga0097621_100499238 Ga0097621_1004992382 176
195 3300006358 Ga0068871_101088954 Ga0068871_1010889541 176
196 3300006881 Ga0068865_100044991 Ga0068865_1000449912 176
197 3300006881 Ga0068865_100133430 Ga0068865_1001334302 176
198 3300006881 Ga0068865_100325691 Ga0068865_1003256912 176
199 3300006931 Ga0097620_100045772 Ga0097620_1000457724 176
200 3300006931 Ga0097620_100088518 Ga0097620_1000885183 176
201 3300006931 Ga0097620_100266897 Ga0097620_1002668972 176
202 3300009011 Ga0105251_10101150 Ga0105251_101011502 176
203 3300009098 Ga0105245_10048004 Ga0105245_100480043 176
204 3300009098 Ga0105245_10068217 Ga0105245_100682173 176
205 3300009098 Ga0105245_10654205 Ga0105245_106542052 176
206 3300009148 Ga0105243_10246758 Ga0105243_102467582 176
207 3300009174 Ga0105241_10707824 Ga0105241_107078241 176
208 3300009176 Ga0105242_10896806 Ga0105242_108968062 176
209 3300009177 Ga0105248_10001411 Ga0105248_1000141110 176
210 3300009177 Ga0105248_10374413 Ga0105248_103744132 176
211 3300009177 Ga0105248_10377469 Ga0105248_103774692 176
212 3300009545 Ga0105237_10630500 Ga0105237_106305002 176
213 3300009551 Ga0105238_10207749 Ga0105238_102077492 176
214 3300011119 Ga0105246_10142976 Ga0105246_101429763 176
215 3300011119 Ga0105246_10421760 Ga0105246_104217602 176
216 3300013100 Ga0157373_10043020 Ga0157373_100430202 176
217 3300013100 Ga0157373_10122337 Ga0157373_101223372 176
218 3300013100 Ga0157373_10174005 Ga0157373_101740052 176
219 3300013102 Ga0157371_10028899 Ga0157371_100288993 176
220 3300013102 Ga0157371_10081105 Ga0157371_100811052 176
221 3300013102 Ga0157371_10335148 Ga0157371_103351482 176
222 3300013105 Ga0157369_10522132 Ga0157369_105221322 176
223 3300013296 Ga0157374_10030163 Ga0157374_100301633 176
224 3300013296 Ga0157374_10277662 Ga0157374_102776622 176
225 3300013296 Ga0157374_10382466 Ga0157374_103824662 176
226 3300013296 Ga0157374_11835200 Ga0157374_118352001 176
227 3300013297 Ga0157378_10288740 Ga0157378_102887401 176
228 3300013297 Ga0157378_10366194 Ga0157378_103661942 176
229 3300013297 Ga0157378_10499479 Ga0157378_104994792 176
230 3300013306 Ga0163162_11391322 Ga0163162_113913221 176
231 3300013306 Ga0163162_12295873 Ga0163162_122958731 176
232 3300013307 Ga0157372_10023759 Ga0157372_100237595 176
233 3300013308 Ga0157375_10021664 Ga0157375_100216644 176
234 3300013308 Ga0157375_10537932 Ga0157375_105379322 176
235 3300013308 Ga0157375_10587329 Ga0157375_105873292 176
236 3300013308 Ga0157375_11378080 Ga0157375_113780802 176
237 3300014325 Ga0163163_10071584 Ga0163163_100715842 176
238 3300014325 Ga0163163_10083214 Ga0163163_100832144 176
239 3300014968 Ga0157379_10001782 Ga0157379_1000178214 176
240 3300014968 Ga0157379_10057142 Ga0157379_100571423 176
241 3300014968 Ga0157379_10909005 Ga0157379_109090052 176
242 3300025315 Ga0207697_10021713 Ga0207697_100217132 176
243 3300025315 Ga0207697_10219700 Ga0207697_102197002 176
244 3300025321 Ga0207656_10013560 Ga0207656_100135602 176
245 3300025893 Ga0207682_10008218 Ga0207682_100082183 176
246 3300025899 Ga0207642_10040110 Ga0207642_100401102 176
247 3300025901 Ga0207688_10041320 Ga0207688_100413203 176
248 3300025903 Ga0207680_10005472 Ga0207680_100054726 176
249 3300025903 Ga0207680_10013886 Ga0207680_100138864 176
250 3300025903 Ga0207680_10025541 Ga0207680_100255412 176
251 3300025903 Ga0207680_10122207 Ga0207680_101222072 176
252 3300025903 Ga0207680_10444685 Ga0207680_104446851 176
253 3300025904 Ga0207647_10003939 Ga0207647_1000393911 176
254 3300025907 Ga0207645_10036726 Ga0207645_100367263 176
255 3300025907 Ga0207645_10109045 Ga0207645_101090452 176
256 3300025907 Ga0207645_10174139 Ga0207645_101741392 176
257 3300025907 Ga0207645_10178160 Ga0207645_101781602 176
258 3300025908 Ga0207643_10122743 Ga0207643_101227432 176
259 3300025909 Ga0207705_10003103 Ga0207705_100031032 176
260 3300025909 Ga0207705_10004954 Ga0207705_100049542 176
261 3300025909 Ga0207705_10130873 Ga0207705_101308732 176
262 3300025909 Ga0207705_10218103 Ga0207705_102181032 176
263 3300025909 Ga0207705_10428860 Ga0207705_104288602 176
264 3300025918 Ga0207662_10160306 Ga0207662_101603062 176
265 3300025918 Ga0207662_10203519 Ga0207662_102035192 176
266 3300025919 Ga0207657_10008170 Ga0207657_1000817014 176
267 3300025919 Ga0207657_10200823 Ga0207657_102008232 176
268 3300025919 Ga0207657_10514929 Ga0207657_105149291 176
269 3300025919 Ga0207657_10564964 Ga0207657_105649642 176
270 3300025919 Ga0207657_10940270 Ga0207657_109402701 176
271 3300025920 Ga0207649_10025348 Ga0207649_100253483 176
272 3300025920 Ga0207649_10041227 Ga0207649_100412272 176
273 3300025920 Ga0207649_10071522 Ga0207649_100715222 176
274 3300025920 Ga0207649_10109523 Ga0207649_101095232 176
275 3300025920 Ga0207649_10211799 Ga0207649_102117991 176
276 3300025920 Ga0207649_10619719 Ga0207649_106197191 176
277 3300025920 Ga0207649_10632779 Ga0207649_106327791 176
278 3300025923 Ga0207681_10182457 Ga0207681_101824572 176
279 3300025924 Ga0207694_10239640 Ga0207694_102396402 176
280 3300025925 Ga0207650_10040083 Ga0207650_100400832 176
281 3300025925 Ga0207650_10138955 Ga0207650_101389552 176
282 3300025925 Ga0207650_10650950 Ga0207650_106509502 176
283 3300025926 Ga0207659_10052602 Ga0207659_100526023 176
284 3300025927 Ga0207687_10017705 Ga0207687_100177053 176
285 3300025927 Ga0207687_10109576 Ga0207687_101095762 176
286 3300025927 Ga0207687_10324423 Ga0207687_103244232 176
287 3300025931 Ga0207644_10004377 Ga0207644_100043777 176
288 3300025931 Ga0207644_10010174 Ga0207644_100101744 176
289 3300025931 Ga0207644_10076393 Ga0207644_100763932 176
290 3300025931 Ga0207644_10308873 Ga0207644_103088731 176
291 3300025931 Ga0207644_10945355 Ga0207644_109453552 176
292 3300025932 Ga0207690_10039855 Ga0207690_100398552 176
293 3300025932 Ga0207690_10117963 Ga0207690_101179632 176
294 3300025932 Ga0207690_10405984 Ga0207690_104059842 176
295 3300025933 Ga0207706_10000742 Ga0207706_1000074217 176
296 3300025933 Ga0207706_10011556 Ga0207706_100115565 176
297 3300025933 Ga0207706_10036685 Ga0207706_100366855 176
298 3300025933 Ga0207706_10072603 Ga0207706_100726033 176
299 3300025933 Ga0207706_10114309 Ga0207706_101143092 176
300 3300025933 Ga0207706_10264113 Ga0207706_102641132 176
301 3300025935 Ga0207709_10068490 Ga0207709_100684902 176
302 3300025937 Ga0207669_10483542 Ga0207669_104835422 176
303 3300025937 Ga0207669_10596151 Ga0207669_105961511 176
304 3300025938 Ga0207704_10007623 Ga0207704_100076235 176
305 3300025938 Ga0207704_10241090 Ga0207704_102410901 176
306 3300025940 Ga0207691_10005345 Ga0207691_100053452 176
307 3300025940 Ga0207691_10066301 Ga0207691_100663012 176
308 3300025940 Ga0207691_10105143 Ga0207691_101051433 176
309 3300025941 Ga0207711_10007890 Ga0207711_100078906 176
310 3300025941 Ga0207711_10015675 Ga0207711_100156753 176
311 3300025941 Ga0207711_10125118 Ga0207711_101251182 176
312 3300025941 Ga0207711_10557334 Ga0207711_105573342 176
313 3300025942 Ga0207689_10035485 Ga0207689_100354852 176
314 3300025942 Ga0207689_10279293 Ga0207689_102792932 176
315 3300025944 Ga0207661_10095297 Ga0207661_100952972 176
316 3300025945 Ga0207679_10004636 Ga0207679_100046365 176
317 3300025945 Ga0207679_10106452 Ga0207679_101064523 176
318 3300025945 Ga0207679_10143780 Ga0207679_101437802 176
319 3300025945 Ga0207679_10153164 Ga0207679_101531642 176
320 3300025945 Ga0207679_10158306 Ga0207679_101583062 176
321 3300025945 Ga0207679_10570475 Ga0207679_105704751 176
322 3300025949 Ga0207667_10679885 Ga0207667_106798852 176
323 3300025960 Ga0207651_10020635 Ga0207651_100206352 176
324 3300025960 Ga0207651_10025830 Ga0207651_100258304 176
325 3300025960 Ga0207651_10166768 Ga0207651_101667682 176
326 3300025960 Ga0207651_10265791 Ga0207651_102657912 176
327 3300025960 Ga0207651_10309706 Ga0207651_103097062 176
328 3300025972 Ga0207668_10140995 Ga0207668_101409952 176
329 3300025981 Ga0207640_10051244 Ga0207640_100512443 176
330 3300025981 Ga0207640_10064855 Ga0207640_100648552 176
331 3300025981 Ga0207640_10232852 Ga0207640_102328522 176
332 3300025981 Ga0207640_10493687 Ga0207640_104936872 176
333 3300025986 Ga0207658_10001885 Ga0207658_1000188511 176
334 3300025986 Ga0207658_10017392 Ga0207658_100173922 176
335 3300025986 Ga0207658_10071299 Ga0207658_100712993 176
336 3300025986 Ga0207658_10117946 Ga0207658_101179462 176
337 3300025986 Ga0207658_10326170 Ga0207658_103261703 176
338 3300025986 Ga0207658_10438386 Ga0207658_104383862 176
339 3300025986 Ga0207658_10569889 Ga0207658_105698892 176
340 3300026023 Ga0207677_10000890 Ga0207677_1000089012 176
341 3300026023 Ga0207677_10064764 Ga0207677_100647641 176
342 3300026023 Ga0207677_10318573 Ga0207677_103185732 176
343 3300026023 Ga0207677_10597282 Ga0207677_105972822 176
344 3300026035 Ga0207703_10003017 Ga0207703_1000301711 176
345 3300026035 Ga0207703_10415808 Ga0207703_104158082 176
346 3300026041 Ga0207639_10144631 Ga0207639_101446312 176
347 3300026041 Ga0207639_10362512 Ga0207639_103625123 176
348 3300026041 Ga0207639_10796789 Ga0207639_107967892 176
349 3300026067 Ga0207678_10000558 Ga0207678_1000055844 176
350 3300026067 Ga0207678_10001651 Ga0207678_1000165111 176
351 3300026067 Ga0207678_10115782 Ga0207678_101157822 176
352 3300026067 Ga0207678_10302667 Ga0207678_103026672 176
353 3300026067 Ga0207678_10513188 Ga0207678_105131882 176
354 3300026078 Ga0207702_10497558 Ga0207702_104975581 176
355 3300026078 Ga0207702_10624504 Ga0207702_106245042 176
356 3300026088 Ga0207641_10013048 Ga0207641_100130484 176
357 3300026089 Ga0207648_10005192 Ga0207648_1000519217 176
358 3300026089 Ga0207648_10005560 Ga0207648_100055602 176
359 3300026089 Ga0207648_10087242 Ga0207648_100872423 176
360 3300026095 Ga0207676_10059822 Ga0207676_100598224 176
361 3300026095 Ga0207676_10496341 Ga0207676_104963412 176
362 3300026095 Ga0207676_10507507 Ga0207676_105075072 176
363 3300026116 Ga0207674_10002680 Ga0207674_1000268012 176
364 3300026116 Ga0207674_10007257 Ga0207674_100072574 176
365 3300026116 Ga0207674_11255945 Ga0207674_112559451 176
366 3300026118 Ga0207675_100157398 Ga0207675_1001573982 176
367 3300026121 Ga0207683_10019662 Ga0207683_100196626 176
368 3300026121 Ga0207683_10046328 Ga0207683_100463283 176
369 3300026121 Ga0207683_10133954 Ga0207683_101339543 176
370 3300026142 Ga0207698_10121945 Ga0207698_101219453 176
371 3300026142 Ga0207698_10157645 Ga0207698_101576452 176
372 3300026142 Ga0207698_10166044 Ga0207698_101660442 176
373 3300026142 Ga0207698_10174346 Ga0207698_101743462 176
374 3300026142 Ga0207698_10188095 Ga0207698_101880952 176
375 3300026142 Ga0207698_10432273 Ga0207698_104322732 176
376 3300028379 Ga0268266_10150624 Ga0268266_101506242 176
377 3300028381 Ga0268264_10433370 Ga0268264_104333702 176
378 3300028381 Ga0268264_10440128 Ga0268264_104401282 176
379 3300037418 Ga0395900_0122741 Ga0395900_0122741_1193_1726 176
380 3300037471 Ga0395905_0072518 Ga0395905_0072518_1375_1908 176
381 3300037471 Ga0395905_0308781 Ga0395905_0308781_212_745 176
382 3300038443 Ga0395901_0094734 Ga0395901_0094734_1120_1653 176
383 3300038443 Ga0395901_0133521 Ga0395901_0133521_1265_1798 176
384 3300038443 Ga0395901_1049794 Ga0395901_1049794_122_655 176
385 3300046539 Ga0495621_0000183 Ga0495621_0000183_11268_11801 176
386 3300046539 Ga0495621_0063417 Ga0495621_0063417_596_1129 176
387 3300046616 Ga0495668_0239633 Ga0495668_0239633_18_551 176
388 3300046684 Ga0495669_0100617 Ga0495669_0100617_396_929 176
389 3300046684 Ga0495669_0255306 Ga0495669_0255306_141_674 176
390 3300046691 Ga0495670_0005394 Ga0495670_0005394_2218_2751 176
391 3300046691 Ga0495670_0136025 Ga0495670_0136025_555_1088 176
392 3300048904 Ga0496101_0015261 Ga0496101_0015261_4321_4854 176
393 3300048904 Ga0496101_0234621 Ga0496101_0234621_751_1284 176
394 3300048904 Ga0496101_0982892 Ga0496101_0982892_22_555 176
395 3300048905 Ga0496102_0275531 Ga0496102_0275531_751_1284 176
396 3300048905 Ga0496102_0602910 Ga0496102_0602910_356_889 176
397 3300048906 Ga0496103_0130767 Ga0496103_0130767_238_771 176
398 3300048906 Ga0496103_0543422 Ga0496103_0543422_136_669 176
399 3300048907 Ga0496104_0081963 Ga0496104_0081963_2217_2750 176
400 3300048909 Ga0496106_0075995 Ga0496106_0075995_149_682 176
401 3300048910 Ga0496107_0002167 Ga0496107_0002167_11998_12531 176
402 3300048910 Ga0496107_0020747 Ga0496107_0020747_3379_3912 176
403 3300048910 Ga0496107_0051032 Ga0496107_0051032_1475_2008 176
404 3300048910 Ga0496107_0432227 Ga0496107_0432227_50_583 176
405 3300048911 Ga0496108_0001354 Ga0496108_0001354_2237_2770 176
406 3300048911 Ga0496108_0354992 Ga0496108_0354992_697_1230 176
407 3300048912 Ga0496109_0033166 Ga0496109_0033166_145_678 176
408 3300048912 Ga0496109_0326458 Ga0496109_0326458_218_751 176
409 3300048914 Ga0496111_0077057 Ga0496111_0077057_1318_1851 176
410 3300048914 Ga0496111_0097256 Ga0496111_0097256_664_1197 176
411 3300048914 Ga0496111_0273357 Ga0496111_0273357_51_584 176
412 3300048914 Ga0496111_0579275 Ga0496111_0579275_239_772 176
413 3300048915 Ga0496112_0024097 Ga0496112_0024097_837_1370 176
414 3300048915 Ga0496112_0143243 Ga0496112_0143243_1227_1760 176
415 3300048915 Ga0496112_0324766 Ga0496112_0324766_64_597 176
416 3300048915 Ga0496112_1108265 Ga0496112_1108265_101_634 176
417 3300048916 Ga0496113_0105347 Ga0496113_0105347_1065_1598 176
418 3300048916 Ga0496113_0291569 Ga0496113_0291569_212_745 176
419 3300005339 Ga0070660_100010347 Ga0070660_1000103474 177
420 3300005344 Ga0070661_100914795 Ga0070661_1009147951 177
421 3300005345 Ga0070692_10003915 Ga0070692_100039155 177
422 3300005347 Ga0070668_100053350 Ga0070668_1000533502 177
423 3300005353 Ga0070669_100185962 Ga0070669_1001859622 177
424 3300005353 Ga0070669_100355195 Ga0070669_1003551951 177
425 3300005366 Ga0070659_100005873 Ga0070659_1000058735 177
426 3300005367 Ga0070667_100523350 Ga0070667_1005233501 177
427 3300005444 Ga0070694_100005140 Ga0070694_1000051405 177
428 3300005455 Ga0070663_100374509 Ga0070663_1003745092 177
429 3300005457 Ga0070662_100075828 Ga0070662_1000758283 177
430 3300005539 Ga0068853_100066823 Ga0068853_1000668232 177
431 3300005545 Ga0070695_100325650 Ga0070695_1003256502 177
432 3300005548 Ga0070665_100008473 Ga0070665_1000084732 177
433 3300005563 Ga0068855_100148527 Ga0068855_1001485272 177
434 3300005577 Ga0068857_100133252 Ga0068857_1001332521 177
435 3300005578 Ga0068854_100742551 Ga0068854_1007425511 177
436 3300005616 Ga0068852_100121904 Ga0068852_1001219042 177
437 3300005617 Ga0068859_100742780 Ga0068859_1007427802 177
438 3300005841 Ga0068863_100144044 Ga0068863_1001440442 177
439 3300005842 Ga0068858_101484133 Ga0068858_1014841331 177
440 3300005843 Ga0068860_100061719 Ga0068860_1000617192 177
441 3300005843 Ga0068860_100066587 Ga0068860_1000665873 177
442 3300005844 Ga0068862_100382267 Ga0068862_1003822672 177
443 3300005844 Ga0068862_100729128 Ga0068862_1007291281 177
444 3300005844 Ga0068862_100730753 Ga0068862_1007307532 177
445 3300006358 Ga0068871_101433663 Ga0068871_1014336631 177
446 3300006881 Ga0068865_100040177 Ga0068865_1000401772 177
447 3300006931 Ga0097620_100742800 Ga0097620_1007428002 177
448 3300007076 Ga0075435_100510190 Ga0075435_1005101902 177
449 3300009092 Ga0105250_10272567 Ga0105250_102725672 177
450 3300009098 Ga0105245_10197442 Ga0105245_101974422 177
451 3300009148 Ga0105243_10156449 Ga0105243_101564492 177
452 3300009553 Ga0105249_10013895 Ga0105249_100138952 177
453 3300010375 Ga0105239_10085530 Ga0105239_100855302 177
454 3300013306 Ga0163162_10050129 Ga0163162_100501292 177
455 3300014745 Ga0157377_10008557 Ga0157377_100085572 177
456 3300025901 Ga0207688_10025327 Ga0207688_100253272 177
457 3300025919 Ga0207657_10019353 Ga0207657_100193534 177
458 3300025923 Ga0207681_10169137 Ga0207681_101691372 177
459 3300025925 Ga0207650_10293004 Ga0207650_102930042 177
460 3300025932 Ga0207690_10007764 Ga0207690_100077645 177
461 3300025933 Ga0207706_10004043 Ga0207706_100040435 177
462 3300025938 Ga0207704_10109742 Ga0207704_101097422 177
463 3300025938 Ga0207704_10268910 Ga0207704_102689101 177
464 3300025940 Ga0207691_10013135 Ga0207691_100131352 177
465 3300025942 Ga0207689_10023182 Ga0207689_100231822 177
466 3300025942 Ga0207689_10420103 Ga0207689_104201032 177
467 3300025944 Ga0207661_11185691 Ga0207661_111856911 177
468 3300025949 Ga0207667_10022584 Ga0207667_100225844 177
469 3300025961 Ga0207712_10002542 Ga0207712_100025422 177
470 3300025972 Ga0207668_10336687 Ga0207668_103366872 177
471 3300025981 Ga0207640_10257496 Ga0207640_102574962 177
472 3300025986 Ga0207658_10321305 Ga0207658_103213052 177
473 3300026023 Ga0207677_10143124 Ga0207677_101431242 177
474 3300026041 Ga0207639_10313157 Ga0207639_103131572 177
475 3300026067 Ga0207678_10228086 Ga0207678_102280862 177
476 3300026088 Ga0207641_10051781 Ga0207641_100517813 177
477 3300026095 Ga0207676_10495068 Ga0207676_104950682 177
478 3300026116 Ga0207674_10039628 Ga0207674_100396282 177
479 3300026142 Ga0207698_10140337 Ga0207698_101403372 177
480 3300028380 Ga0268265_10291751 Ga0268265_102917512 177
481 3300028380 Ga0268265_10632620 Ga0268265_106326201 177
482 3300028381 Ga0268264_10007642 Ga0268264_1000764211 177
483 3300028381 Ga0268264_10029770 Ga0268264_100297705 177
484 3300031548 Ga0307408_100121665 Ga0307408_1001216652 177
485 3300031852 Ga0307410_10670604 Ga0307410_106706042 177
486 3300031995 Ga0307409_100108393 Ga0307409_1001083932 177
487 3300032002 Ga0307416_101845024 Ga0307416_1018450241 177
488 3300032005 Ga0307411_10186562 Ga0307411_101865622 177
489 3300035242 Ga0373962_0222350 Ga0373962_0222350_74_610 177
490 3300037418 Ga0395900_0547656 Ga0395900_0547656_152_688 177
491 3300037418 Ga0395900_0686531 Ga0395900_0686531_327_863 177
492 3300037471 Ga0395905_0819994 Ga0395905_0819994_176_712 177
493 3300038443 Ga0395901_0563040 Ga0395901_0563040_375_911 177
494 3300049661 Ga0501217_105821 Ga0501217_105821_214_783 177
495 3300049667 Ga0501230_010693 Ga0501230_010693_697_1266 177
496 3300049669 Ga0501235_085822 Ga0501235_085822_44_613 177
497 3300049679 Ga0501249_027203 Ga0501249_027203_543_1112 177
498 3300050515 nmdc:mga0a205_822_c1 nmdc:mga0a205_822_c1_8703_9239 177
499 3300001979 JGI24740J21852_10044166 JGI24740J21852_100441662 178
500 3300002239 JGI24034J26672_10021898 JGI24034J26672_100218982 178
501 3300005327 Ga0070658_11211751 Ga0070658_112117511 178
502 3300005328 Ga0070676_10098830 Ga0070676_100988301 178
503 3300005328 Ga0070676_10223414 Ga0070676_102234142 178
504 3300005329 Ga0070683_100560315 Ga0070683_1005603152 178
505 3300005329 Ga0070683_101172081 Ga0070683_1011720811 178
506 3300005330 Ga0070690_100846723 Ga0070690_1008467231 178
507 3300005331 Ga0070670_100004708 Ga0070670_1000047085 178
508 3300005333 Ga0070677_10041020 Ga0070677_100410202 178
509 3300005335 Ga0070666_10001840 Ga0070666_1000184010 178
510 3300005335 Ga0070666_10234356 Ga0070666_102343562 178
511 3300005338 Ga0068868_100064966 Ga0068868_1000649663 178
512 3300005338 Ga0068868_100297182 Ga0068868_1002971822 178
513 3300005343 Ga0070687_100438231 Ga0070687_1004382312 178
514 3300005344 Ga0070661_100127405 Ga0070661_1001274052 178
515 3300005344 Ga0070661_100153148 Ga0070661_1001531481 178
516 3300005344 Ga0070661_100167816 Ga0070661_1001678162 178
517 3300005344 Ga0070661_100299856 Ga0070661_1002998561 178
518 3300005354 Ga0070675_100009388 Ga0070675_1000093885 178
519 3300005354 Ga0070675_100920121 Ga0070675_1009201212 178
520 3300005355 Ga0070671_100019434 Ga0070671_1000194343 178
521 3300005355 Ga0070671_100045542 Ga0070671_1000455424 178
522 3300005355 Ga0070671_100141007 Ga0070671_1001410072 178
523 3300005356 Ga0070674_100045140 Ga0070674_1000451403 178
524 3300005356 Ga0070674_100135073 Ga0070674_1001350732 178
525 3300005364 Ga0070673_100000346 Ga0070673_1000003463 178
526 3300005366 Ga0070659_100554784 Ga0070659_1005547842 178
527 3300005366 Ga0070659_100568334 Ga0070659_1005683342 178
528 3300005367 Ga0070667_100002178 Ga0070667_1000021785 178
529 3300005367 Ga0070667_100199767 Ga0070667_1001997672 178
530 3300005455 Ga0070663_100263044 Ga0070663_1002630442 178
531 3300005456 Ga0070678_100003221 Ga0070678_1000032215 178
532 3300005456 Ga0070678_100755229 Ga0070678_1007552292 178
533 3300005457 Ga0070662_100032279 Ga0070662_1000322793 178
534 3300005457 Ga0070662_100203686 Ga0070662_1002036862 178
535 3300005457 Ga0070662_100235049 Ga0070662_1002350492 178
536 3300005459 Ga0068867_100065520 Ga0068867_1000655202 178
537 3300005459 Ga0068867_101068544 Ga0068867_1010685441 178
538 3300005543 Ga0070672_100002995 Ga0070672_10000299511 178
539 3300005543 Ga0070672_100130574 Ga0070672_1001305742 178
540 3300005543 Ga0070672_100305875 Ga0070672_1003058752 178
541 3300005548 Ga0070665_100015258 Ga0070665_1000152582 178
542 3300005564 Ga0070664_100152958 Ga0070664_1001529582 178
543 3300005564 Ga0070664_100203028 Ga0070664_1002030282 178
544 3300005564 Ga0070664_100770046 Ga0070664_1007700462 178
545 3300005578 Ga0068854_100017334 Ga0068854_1000173343 178
546 3300005616 Ga0068852_100088342 Ga0068852_1000883422 178
547 3300005616 Ga0068852_100396906 Ga0068852_1003969062 178
548 3300005617 Ga0068859_100551423 Ga0068859_1005514232 178
549 3300005618 Ga0068864_100010084 Ga0068864_1000100845 178
550 3300005618 Ga0068864_100711254 Ga0068864_1007112542 178
551 3300005834 Ga0068851_10187922 Ga0068851_101879222 178
552 3300005841 Ga0068863_100000616 Ga0068863_10000061620 178
553 3300005841 Ga0068863_100092085 Ga0068863_1000920852 178
554 3300005842 Ga0068858_100004194 Ga0068858_1000041946 178
555 3300005844 Ga0068862_100081634 Ga0068862_1000816342 178
556 3300005985 Ga0081539_10062552 Ga0081539_100625522 178
557 3300006237 Ga0097621_100022615 Ga0097621_1000226155 178
558 3300006237 Ga0097621_101051707 Ga0097621_1010517072 178
559 3300006358 Ga0068871_100208915 Ga0068871_1002089152 178
560 3300006931 Ga0097620_100551404 Ga0097620_1005514042 178
561 3300009177 Ga0105248_10018999 Ga0105248_100189996 178
562 3300009177 Ga0105248_10105359 Ga0105248_101053593 178
563 3300009177 Ga0105248_10816550 Ga0105248_108165502 178
564 3300009177 Ga0105248_11214028 Ga0105248_112140281 178
565 3300009553 Ga0105249_10603575 Ga0105249_106035752 178
566 3300013296 Ga0157374_10004257 Ga0157374_100042577 178
567 3300013306 Ga0163162_10000645 Ga0163162_1000064516 178
568 3300013308 Ga0157375_10013824 Ga0157375_100138247 178
569 3300014325 Ga0163163_10014438 Ga0163163_100144385 178
570 3300014325 Ga0163163_10124736 Ga0163163_101247362 178
571 3300021384 Ga0213876_10039897 Ga0213876_100398972 178
572 3300025321 Ga0207656_10216066 Ga0207656_102160662 178
573 3300025901 Ga0207688_10141012 Ga0207688_101410122 178
574 3300025903 Ga0207680_10005316 Ga0207680_100053165 178
575 3300025903 Ga0207680_10160456 Ga0207680_101604562 178
576 3300025904 Ga0207647_10014370 Ga0207647_100143705 178
577 3300025907 Ga0207645_10102840 Ga0207645_101028402 178
578 3300025920 Ga0207649_10057363 Ga0207649_100573631 178
579 3300025920 Ga0207649_10840760 Ga0207649_108407602 178
580 3300025925 Ga0207650_10016148 Ga0207650_100161483 178
581 3300025925 Ga0207650_10025993 Ga0207650_100259932 178
582 3300025926 Ga0207659_10101363 Ga0207659_101013632 178
583 3300025931 Ga0207644_10008224 Ga0207644_100082244 178
584 3300025931 Ga0207644_10120867 Ga0207644_101208672 178
585 3300025933 Ga0207706_10000893 Ga0207706_100008932 178
586 3300025933 Ga0207706_10276530 Ga0207706_102765302 178
587 3300025937 Ga0207669_10108034 Ga0207669_101080342 178
588 3300025940 Ga0207691_10000820 Ga0207691_1000082010 178
589 3300025941 Ga0207711_10001274 Ga0207711_1000127412 178
590 3300025941 Ga0207711_10579790 Ga0207711_105797902 178
591 3300025944 Ga0207661_10814020 Ga0207661_108140201 178
592 3300025945 Ga0207679_10056175 Ga0207679_100561754 178
593 3300025960 Ga0207651_10015279 Ga0207651_100152794 178
594 3300025961 Ga0207712_10604818 Ga0207712_106048181 178
595 3300025972 Ga0207668_10196874 Ga0207668_101968742 178
596 3300025981 Ga0207640_10006679 Ga0207640_100066795 178
597 3300025981 Ga0207640_10570229 Ga0207640_105702292 178
598 3300025986 Ga0207658_10008648 Ga0207658_100086487 178
599 3300026023 Ga0207677_10125417 Ga0207677_101254172 178
600 3300026023 Ga0207677_10266324 Ga0207677_102663242 178
601 3300026035 Ga0207703_10027953 Ga0207703_100279534 178
602 3300026067 Ga0207678_10005870 Ga0207678_1000587010 178
603 3300026088 Ga0207641_10003074 Ga0207641_1000307412 178
604 3300026088 Ga0207641_10250929 Ga0207641_102509292 178
605 3300026088 Ga0207641_11368771 Ga0207641_113687711 178
606 3300026089 Ga0207648_10095447 Ga0207648_100954472 178
607 3300026089 Ga0207648_10947568 Ga0207648_109475682 178
608 3300026095 Ga0207676_10007129 Ga0207676_1000712910 178
609 3300026116 Ga0207674_10001601 Ga0207674_1000160111 178
610 3300026121 Ga0207683_10007896 Ga0207683_100078962 178
611 3300026142 Ga0207698_10116555 Ga0207698_101165552 178
612 3300028379 Ga0268266_10010106 Ga0268266_100101063 178
613 3300028380 Ga0268265_10144046 Ga0268265_101440462 178
614 3300028381 Ga0268264_10210676 Ga0268264_102106762 178
615 3300031548 Ga0307408_100200839 Ga0307408_1002008392 178
616 3300031731 Ga0307405_10204901 Ga0307405_102049012 178
617 3300031731 Ga0307405_10785965 Ga0307405_107859651 178
618 3300031824 Ga0307413_10165600 Ga0307413_101656002 178
619 3300031824 Ga0307413_10306613 Ga0307413_103066132 178
620 3300031901 Ga0307406_10222113 Ga0307406_102221131 178
621 3300031901 Ga0307406_10603114 Ga0307406_106031142 178
622 3300031911 Ga0307412_10500473 Ga0307412_105004732 178
623 3300032002 Ga0307416_100006146 Ga0307416_1000061464 178
624 3300032002 Ga0307416_100245785 Ga0307416_1002457852 178
625 3300032005 Ga0307411_10250357 Ga0307411_102503572 178
626 3300032126 Ga0307415_100009011 Ga0307415_1000090115 178
627 3300032126 Ga0307415_100284462 Ga0307415_1002844622 178
628 3300032126 Ga0307415_100450701 Ga0307415_1004507012 178
629 3300032126 Ga0307415_101301272 Ga0307415_1013012721 178
630 3300035171 Ga0373946_0100125 Ga0373946_0100125_596_1141 178
631 3300035692 Ga0373935_0233231 Ga0373935_0233231_673_1218 178
632 3300035725 Ga0373947_0095669 Ga0373947_0095669_928_1473 178
633 3300037068 Ga0373925_0126560 Ga0373925_0126560_165_710 178
634 3300037418 Ga0395900_0051457 Ga0395900_0051457_406_945 178
635 3300037466 Ga0395898_0370582 Ga0395898_0370582_248_787 178
636 3300037471 Ga0395905_0016471 Ga0395905_0016471_5796_6335 178
637 3300037471 Ga0395905_0038845 Ga0395905_0038845_1753_2292 178
638 3300037471 Ga0395905_0127390 Ga0395905_0127390_1180_1716 178
639 3300038443 Ga0395901_0087707 Ga0395901_0087707_388_927 178
640 3300039437 Ga0436365_0615625 Ga0436365_0615625_8408_8944 178
641 3300042007 Ga0439449_0112669 Ga0439449_0112669_73_612 178
642 3300044656 Ga0466969_0214982 Ga0466969_0214982_24_563 178
643 3300044658 Ga0466972_0195020 Ga0466972_0195020_162_701 178
644 3300044684 Ga0466966_0159427 Ga0466966_0159427_39_578 178
645 3300044693 Ga0466961_0240679 Ga0466961_0240679_496_1035 178
646 3300044694 Ga0466963_0131466 Ga0466963_0131466_150_689 178
647 3300044706 Ga0466964_0009075 Ga0466964_0009075_2919_3458 178
648 3300044706 Ga0466964_0049800 Ga0466964_0049800_1112_1651 178
649 3300044765 Ga0466970_0006659 Ga0466970_0006659_2705_3244 178
650 3300044765 Ga0466970_0206476 Ga0466970_0206476_452_991 178
651 3300044842 Ga0466957_0023627 Ga0466957_0023627_2498_3037 178
652 3300045836 Ga0466958_0070961 Ga0466958_0070961_13_552 178
653 3300045836 Ga0466958_0163225 Ga0466958_0163225_281_820 178
654 3300045976 Ga0466967_0026767 Ga0466967_0026767_557_1096 178
655 3300046459 Ga0495629_0348390 Ga0495629_0348390_320_859 178
656 3300048903 Ga0496100_0459970 Ga0496100_0459970_426_965 178
657 3300048904 Ga0496101_0044620 Ga0496101_0044620_1737_2273 178
658 3300048904 Ga0496101_0111094 Ga0496101_0111094_1512_2051 178
659 3300048904 Ga0496101_0321892 Ga0496101_0321892_471_1010 178
660 3300048905 Ga0496102_0085007 Ga0496102_0085007_2306_2845 178
661 3300048906 Ga0496103_0132032 Ga0496103_0132032_985_1524 178
662 3300048909 Ga0496106_0683910 Ga0496106_0683910_257_793 178
663 3300048910 Ga0496107_0084173 Ga0496107_0084173_253_789 178
664 3300048911 Ga0496108_0064742 Ga0496108_0064742_1913_2452 178
665 3300048912 Ga0496109_0003600 Ga0496109_0003600_10300_10839 178
666 3300048913 Ga0496110_0010292 Ga0496110_0010292_6455_6994 178
667 3300048914 Ga0496111_0006954 Ga0496111_0006954_4717_5256 178
668 3300048915 Ga0496112_0044416 Ga0496112_0044416_195_734 178
669 3300048916 Ga0496113_0038849 Ga0496113_0038849_1668_2207 178
670 3300048917 Ga0496114_0131015 Ga0496114_0131015_183_719 178
671 3300048918 Ga0496115_0036712 Ga0496115_0036712_3194_3730 178
672 3300061719 Ga0466962_0007379 Ga0466962_0007379_4151_4690 178

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kxo-assembly1.cif.gz_B solution nmr structure of the cell division regulator mine protein from neisseria gonorrhoeae 0.7023 112 134
4jpq-assembly2.cif.gz_B crystal structure of a putative carbohydrate-binding protein (bacuni_03838) from bacteroides uniformis atcc 8492 at 2.70 a resolution 0.634 1 172
4jpq-assembly2.cif.gz_B crystal structure of a putative carbohydrate-binding protein (bacuni_03838) from bacteroides uniformis atcc 8492 at 2.70 a resolution 0.6146 1 172
6ilm-assembly1.cif.gz_E cryo-em structure of echovirus 6 complexed with its uncoating receptor fcrn at ph 7.4 0.5877 15 139
3tbt-assembly4.cif.gz_J crystal structure of the murine class i major histocompatibility complex h-2db in complex with the lcmv-derived gp33 altered peptide ligand (v3p, y4s) 0.581 14 143
ID Description Score Start End Superfamily
af_Q18357_79_204_2.60.40.1190 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7629 56 178 2.60.40.1190
af_Q18357_79_204_2.60.40.1190 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7421 56 178 2.60.40.1190
2kxoB01 Alpha Beta;2-Layer Sandwich;Cell Cycle; Chain A;Cell division topological specificity factor MinE 0.733 112 129 3.30.1070.10
af_Q54EU8_18_231_2.60.40.1190 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6549 1 173 2.60.40.1190
af_Q6P2T7_18_176_2.60.40.1190 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6542 21 168 2.60.40.1190
ID Description Score Start End GO Terms
AF-A0A6G7YSJ8-F1-model_v4 DOMON-like domain-containing protein 0.9797 1 178
AF-A0A7G9SFC7-F1-model_v4 DOMON-like domain-containing protein 0.9793 47 178
AF-A0A7X5Y6Z0-F1-model_v4 DOMON-like domain-containing protein 0.9757 1 178
AF-A0A6G7YSJ8-F1-model_v4 DOMON-like domain-containing protein 0.9743 1 178
AF-A0A7G9SFC7-F1-model_v4 DOMON-like domain-containing protein 0.9576 47 178

Feature Viewer

pLDDT pTM Quality
94.15 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map