F474191

General Info

Members Datasets Scaffolds Average Seq Length
671 447 442 170

Family's Representative Sequence

Representative Sequence 3300049742|Ga0501080_0048319|Ga0501080_0048319_1566_2075
Length 169
Sequence MRYWLGLGANLGDRRAALEAALAGLAGAGIAVEAVSPAYETAPRDVVDQPAFMNAAARVRTDLPPEELLAAVKRLERALGREPGPRWGPRAIDCDLLLWEGGAHDAGELLTIPHPRLAERRFALLPLLDLDPALALPDGRRLADLLAAIPPDDQPARRLEEPLAAPELD

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
5 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
6 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
7 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
8 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
9 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
10 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
11 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
12 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
13 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
14 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
15 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
16 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
17 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
18 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
19 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
20 2519899620 Rhizobium sp. Pop5 Isolate Nodule
21 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
22 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
23 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
24 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
25 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
26 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
27 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
28 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
29 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
30 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
31 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
32 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
33 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
34 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
35 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
36 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
37 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
38 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
39 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
40 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
41 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
42 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
43 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
44 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
45 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
46 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
47 2643221599 Rhizobium sp. Root708 Isolate Unclassified
48 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
49 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
50 2643221719 Rhizobium sp. Root274 Isolate Unclassified
51 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
52 2718217882 Rhizobium sp. N741 Isolate Nodule
53 2718217927 Rhizobium sp. N324 Isolate Nodule
54 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
55 2718218009 Rhizobium sp. N561 Isolate Nodule
56 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
57 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
58 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
59 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
60 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
61 2718218363 Rhizobium sp. N113 Isolate Nodule
62 2718218365 Rhizobium sp. N731 Isolate Nodule
63 2718218366 Rhizobium sp. N621 Isolate Nodule
64 2718218423 Rhizobium sp. N941 Isolate Nodule
65 2721755514 Rhizobium sp. N6212 Isolate Nodule
66 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
67 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
68 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
69 2721755809 Rhizobium sp. N541 Isolate Nodule
70 2721755810 Rhizobium sp. N871 Isolate Nodule
71 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
72 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
73 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
74 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
75 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
76 2728369365 Rhizobium sp. N1341 Isolate Nodule
77 2728369397 Rhizobium sp. N1314 Isolate Nodule
78 2738541293 Rhizobium sp. GV031 Isolate Unclassified
79 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
80 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
81 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
82 2791355256 Rhizobium sp. M10 Isolate Nodule
83 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
84 2791355260 Rhizobium sp. L9 Isolate Nodule
85 2791355261 Rhizobium sp. J15 Isolate Nodule
86 2791355262 Rhizobium sp. M1 Isolate Nodule
87 2791355263 Rhizobium chutanense C5 Isolate Nodule
88 2791355264 Rhizobium sp. S9 Isolate Nodule
89 2791355265 Rhizobium sp. H4 Isolate Nodule
90 2791355266 Rhizobium sp. L43 Isolate Nodule
91 2791355267 Rhizobium sp. L18 Isolate Nodule
92 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
93 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
94 2802429633 Rhizobium anhuiense J3 Isolate Nodule
95 2802429634 Rhizobium anhuiense S10 Isolate Nodule
96 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
97 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
98 2802429637 Rhizobium anhuiense C15 Isolate Nodule
99 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
100 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
101 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
102 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
103 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
104 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
105 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
106 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
107 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
108 2838048938 Rhizobium pisi 27/80 Isolate Nodule
109 2838061910 Rhizobium phaseoli L15 Isolate Nodule
110 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
111 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
112 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
113 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
114 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
115 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
116 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
117 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
118 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
119 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
120 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
121 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
122 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
123 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
124 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
125 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
126 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
127 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
128 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
129 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
130 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
131 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
132 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
133 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
134 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
135 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
136 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
137 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
138 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
139 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
140 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
141 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
142 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
143 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
144 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
145 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
146 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
147 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
148 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
149 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
150 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
151 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
152 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
153 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
154 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
155 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
156 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
157 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
158 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
159 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
160 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
161 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
162 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
163 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
164 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
165 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
166 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
167 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
168 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
169 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
170 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
171 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
172 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
173 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
174 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
175 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
176 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
177 2933599457 Rhizobium phaseoli M3 Isolate Nodule
178 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
179 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
180 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
181 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
182 2936381700 Rhizobium chutanense C16 Isolate Unclassified
183 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
184 2996887358 Rhizobium sp. R711 Isolate Nodule
185 2996893221 Rhizobium sp. R635 Isolate Nodule
186 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
187 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
188 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
189 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
190 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
191 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
192 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
193 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
194 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
195 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
196 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
197 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
198 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
199 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
200 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
201 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
202 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
203 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
204 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
205 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
206 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
207 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
208 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
209 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
210 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
211 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
212 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
213 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
214 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
215 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
216 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
217 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
218 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
219 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
220 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
221 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
222 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
223 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
224 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
225 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
226 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
227 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
228 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
229 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
230 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
231 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
232 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
233 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
234 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
235 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
236 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
237 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
238 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
239 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
240 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
241 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
242 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
243 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
244 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
245 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
246 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
247 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
248 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
249 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
250 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
251 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
252 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
253 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
254 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
255 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
256 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
257 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
258 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
259 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
260 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
261 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
262 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
263 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
264 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
265 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
266 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
267 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
268 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
278 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
281 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
282 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
283 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
284 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
285 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
286 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
287 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
288 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
289 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
290 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
291 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
292 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
293 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
294 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
295 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
296 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
297 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
298 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
299 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
300 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
301 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
302 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
303 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
304 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
305 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
306 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
307 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
308 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
309 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
310 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
311 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
312 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
313 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
314 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
315 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
316 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
317 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
318 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
319 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
320 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
321 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
322 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
323 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
324 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
325 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
326 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
327 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
328 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
329 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
330 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
331 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
332 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
333 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
334 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
335 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
336 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
337 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
338 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
339 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
340 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
341 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
342 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
343 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
344 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
345 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
346 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
347 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
348 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
349 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
350 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
351 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
352 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
353 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
354 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
355 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
356 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
357 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
358 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
359 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
360 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
361 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
362 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
363 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
364 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
365 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
366 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
367 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
368 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
369 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
370 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
371 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
372 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
373 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
378 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
379 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
380 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
381 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
382 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
383 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
384 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
385 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
386 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
387 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
388 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
389 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
390 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
391 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
392 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
393 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
394 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
395 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
396 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
397 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
398 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
399 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
400 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
401 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
402 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
403 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
404 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
405 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
406 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
407 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
408 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
409 8005258706 Rhizobium sp. R693 Isolate Nodule
410 8005275841 Rhizobium sp. N4311 Isolate Nodule
411 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
412 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
413 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
414 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
415 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
416 8005321885 Rhizobium sp. R72 Isolate Nodule
417 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
418 8005382845 Rhizobium sp. R634 Isolate Nodule
419 8005395548 Rhizobium sp. R339 Isolate Nodule
420 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
421 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
422 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
423 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
424 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
425 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
426 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
427 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
428 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
429 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
430 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
431 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
432 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
433 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
434 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
435 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
436 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
437 8018176218 Rhizobium sp. N122 Isolate Nodule
438 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
439 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
440 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
441 8024501048 Rhizobium sp. H4 Isolate Nodule
442 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
443 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
444 8056382006 Rhizobium croatiense 13T Isolate Nodule
445 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
446 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
447 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 65.87
Metatranscriptomes 0
Isolates 34.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.08
Nodule 26.23
Rhizoplane 3.13
Rhizosphere 25.19
Stem 0
Stem Tuber 0
Unclassified 19.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000136 3300001979 Bacteria 28016
2 JGI25155J39150_1000001 3300002704 Bacteria 354543
3 JGI25156J39149_1000001 3300002705 Bacteria 354557
4 JGI25162J39368_1001158 3300002737 Bacteria 15692
5 JGI25162J39368_1002359 3300002737 Bacteria 7475
6 JGI25162J39368_1003705 3300002737 Bacteria 4150
7 JGI25154J39366_1000011 3300002738 Bacteria 296007
8 JGI25158J39367_1000255 3300002739 Bacteria 12155
9 JGI25157J39369_1000030 3300002741 Bacteria 146112
10 JGI25152J39213_1002860 3300002773 Bacteria 6180
11 JGI25152J39213_1009190 3300002773 Bacteria 2367
12 JGI25152J39213_1030848 3300002773 Bacteria 829
13 JGI25150J39212_1000137 3300002774 Bacteria 41263
14 JGI25150J39212_1032174 3300002774 Bacteria 718
15 JGI25159J45721_1000272 3300002987 Bacteria 24252
16 JGI25159J45721_1001295 3300002987 Bacteria 10564
17 JGI25151J46595_10000134 3300003187 Bacteria 98987
18 JGI25151J46595_10000300 3300003187 Bacteria 54213
19 JGI25151J46595_10002851 3300003187 Bacteria 9945
20 JGI25165J46597_1001317 3300003214 Bacteria 14046
21 JGI25165J46597_1001387 3300003214 Bacteria 13290
22 JGI25165J46597_1002284 3300003214 Bacteria 6553
23 JGI25153J46596_10005686 3300003215 Bacteria 6506
24 JGI25153J46596_10009240 3300003215 Bacteria 4612
25 JGI25153J46596_10015744 3300003215 Bacteria 3062
26 JGI25153J46596_10058660 3300003215 Bacteria 1058
27 JGI25153J46596_10097949 3300003215 Unclassified 695
28 rootH1_10010859 3300003316 Bacteria 5003
29 rootH1_10138550 3300003316 Bacteria 1323
30 rootH2_10055022 3300003320 Bacteria 5009
31 rootH2_10217396 3300003320 Bacteria 1455
32 rootL2_10037168 3300003322 Bacteria 1723
33 rootL2_10067723 3300003322 Bacteria 12506
34 JGI25160J50197_1000010 3300003354 Bacteria 279365
35 JGI25161J50226_1000006 3300003374 Bacteria 279563
36 JGI25161J50226_1000282 3300003374 Bacteria 29080
37 JGI25161J50226_1003736 3300003374 Bacteria 3385
38 JGI25161J50226_1006287 3300003374 Bacteria 2170
39 Ga0055526_1000191 3300003771 Bacteria 53302
40 Ga0055526_1005036 3300003771 Bacteria 7723
41 Ga0055526_1011041 3300003771 Bacteria 4123
42 Ga0055526_1017456 3300003771 Bacteria 2738
43 Ga0055526_1039379 3300003771 Bacteria 1205
44 Ga0055524_1005678 3300003775 Bacteria 5530
45 Ga0055524_1007042 3300003775 Bacteria 4829
46 Ga0055524_1010213 3300003775 Bacteria 3753
47 Ga0055524_1014795 3300003775 Bacteria 2875
48 Ga0055524_1016704 3300003775 Bacteria 2618
49 Ga0055524_1028517 3300003775 Bacteria 1670
50 Ga0055528_1000794 3300003790 Bacteria 21880
51 Ga0055528_1001243 3300003790 Bacteria 16193
52 Ga0055528_1003681 3300003790 Bacteria 7605
53 Ga0055528_1004133 3300003790 Bacteria 7071
54 Ga0055528_1014390 3300003790 Bacteria 2928
55 Ga0055528_1018780 3300003790 Bacteria 2327
56 Ga0055528_1032091 3300003790 Bacteria 1351
57 Ga0055540_1003033 3300003792 Bacteria 8386
58 Ga0055540_1012330 3300003792 Bacteria 2690
59 Ga0055540_1016002 3300003792 Bacteria 2154
60 Ga0055531_10048294 3300003794 Bacteria 1149
61 Ga0058692_1012924 3300003856 Bacteria 1960
62 Ga0055543_1000014 3300004625 Bacteria 177906
63 Ga0055543_1000020 3300004625 Bacteria 150535
64 Ga0055543_1001626 3300004625 Bacteria 8580
65 Ga0065165_1000251 3300005262 Bacteria 93020
66 Ga0065165_1010297 3300005262 Bacteria 4062
67 Ga0065165_1014133 3300005262 Bacteria 3117
68 Ga0065165_1024832 3300005262 Bacteria 2005
69 Ga0070670_100002269 3300005331 Bacteria 15819
70 Ga0070668_100806915 3300005347 Bacteria 834
71 Ga0070671_100081122 3300005355 Bacteria 2712
72 Ga0070663_100907622 3300005455 Bacteria 761
73 Ga0070665_100156677 3300005548 Bacteria 2279
74 Ga0068855_100066371 3300005563 Bacteria 4207
75 Ga0068856_100075976 3300005614 Bacteria 3328
76 Ga0068856_100163634 3300005614 Bacteria 2236
77 Ga0068861_100498561 3300005719 Bacteria 1100
78 Ga0081455_10551087 3300005937 Bacteria 762
79 Ga0075368_10007373 3300006042 Bacteria 3878
80 Ga0075368_10247019 3300006042 Bacteria 762
81 Ga0075363_100028582 3300006048 Bacteria 2870
82 Ga0075363_100040896 3300006048 Bacteria 2444
83 Ga0075363_100071222 3300006048 Bacteria 1889
84 Ga0075364_10579894 3300006051 Bacteria 766
85 Ga0075362_10001489 3300006177 Bacteria 7518
86 Ga0075362_10231945 3300006177 Bacteria 904
87 Ga0075367_10002471 3300006178 Bacteria 8461
88 Ga0075367_10002760 3300006178 Bacteria 8130
89 Ga0075367_10380351 3300006178 Bacteria 892
90 Ga0075367_10527163 3300006178 Bacteria 750
91 Ga0075369_10000330 3300006186 Bacteria 14095
92 Ga0075369_10032046 3300006186 Bacteria 2222
93 Ga0075366_10078014 3300006195 Bacteria 1977
94 Ga0075370_10001061 3300006353 Bacteria 11450
95 Ga0075370_10003623 3300006353 Bacteria 7388
96 Ga0075370_10489312 3300006353 Bacteria 742
97 Ga0105240_10000005 3300009093 Bacteria 702630
98 Ga0105248_10514549 3300009177 Bacteria 1350
99 Ga0105237_10000809 3300009545 Bacteria 42758
100 Ga0105249_10361728 3300009553 Bacteria 1473
101 Ga0123341_1000004 3300009765 Bacteria 153727
102 Ga0123342_1006869 3300009766 Bacteria 15472
103 Ga0105239_10004791 3300010375 Bacteria 16055
104 Ga0105239_11980068 3300010375 Bacteria 676
105 Ga0157370_10001170 3300013104 Bacteria 32703
106 Ga0157369_11115730 3300013105 Bacteria 806
107 Ga0163162_11061907 3300013306 Bacteria 917
108 Ga0157372_11001975 3300013307 Bacteria 968
109 Ga0182008_10026604 3300014497 Bacteria 2933
110 Ga0182007_10005859 3300015262 Bacteria 5341
111 Ga0182005_1012463 3300015265 Bacteria 2400
112 Ga0209435_100012 3300025206 Bacteria 401621
113 Ga0209760_103929 3300025207 Bacteria 1298
114 Ga0209436_100034 3300025208 Bacteria 80089
115 Ga0209436_106118 3300025208 Bacteria 2674
116 Ga0209437_100047 3300025233 Bacteria 405163
117 Ga0209437_100165 3300025233 Bacteria 145009
118 Ga0207425_1000024 3300025245 Bacteria 328978
119 Ga0207425_1002510 3300025245 Bacteria 6436
120 Ga0207425_1010394 3300025245 Bacteria 2266
121 Ga0207425_1044298 3300025245 Bacteria 836
122 Ga0209646_1000026 3300025246 Bacteria 401621
123 Ga0209646_1014159 3300025246 Bacteria 1203
124 Ga0209026_1000014 3300025250 Bacteria 401621
125 Ga0209677_100570 3300025253 Bacteria 20385
126 Ga0209759_1000012 3300025256 Bacteria 401621
127 Ga0209129_1000069 3300025258 Bacteria 212790
128 Ga0209129_1000133 3300025258 Bacteria 126018
129 Ga0209129_1000732 3300025258 Bacteria 21108
130 Ga0209129_1000817 3300025258 Bacteria 19602
131 Ga0209129_1027073 3300025258 Bacteria 985
132 Ga0209233_1000048 3300025261 Bacteria 453669
133 Ga0209233_1000069 3300025261 Bacteria 367639
134 Ga0209233_1000195 3300025261 Bacteria 125863
135 Ga0209673_1000013 3300025273 Bacteria 571633
136 Ga0209673_1000048 3300025273 Bacteria 287976
137 Ga0209673_1000552 3300025273 Bacteria 60264
138 Ga0209673_1000580 3300025273 Bacteria 57834
139 Ga0209673_1000959 3300025273 Bacteria 36010
140 Ga0209673_1004682 3300025273 Bacteria 7218
141 Ga0209673_1005882 3300025273 Bacteria 6068
142 Ga0209673_1007231 3300025273 Bacteria 5169
143 Ga0209130_1000004 3300025284 Bacteria 633436
144 Ga0209130_1000021 3300025284 Bacteria 374278
145 Ga0209675_1015462 3300025291 Bacteria 2265
146 Ga0209676_1095737 3300025292 Bacteria 642
147 Ga0209025_1000050 3300025294 Bacteria 331531
148 Ga0209025_1000166 3300025294 Bacteria 164692
149 Ga0209025_1003517 3300025294 Bacteria 14707
150 Ga0209025_1005057 3300025294 Bacteria 10982
151 Ga0209025_1011274 3300025294 Bacteria 5914
152 Ga0209025_1012989 3300025294 Bacteria 5273
153 Ga0209025_1036997 3300025294 Bacteria 2174
154 Ga0209564_1000273 3300025295 Bacteria 108165
155 Ga0209564_1001066 3300025295 Bacteria 33193
156 Ga0209564_1002209 3300025295 Bacteria 16230
157 Ga0209564_1005653 3300025295 Bacteria 7022
158 Ga0209564_1008240 3300025295 Bacteria 5191
159 Ga0209758_1000083 3300025297 Bacteria 257283
160 Ga0209758_1000384 3300025297 Bacteria 76474
161 Ga0209758_1000749 3300025297 Bacteria 47284
162 Ga0209758_1001310 3300025297 Bacteria 30349
163 Ga0209758_1004443 3300025297 Bacteria 11663
164 Ga0209758_1004646 3300025297 Bacteria 11245
165 Ga0209758_1007723 3300025297 Bacteria 7215
166 Ga0209256_1000371 3300025299 Bacteria 72192
167 Ga0209256_1003416 3300025299 Bacteria 11174
168 Ga0209256_1004340 3300025299 Bacteria 8999
169 Ga0209256_1004711 3300025299 Bacteria 8357
170 Ga0209256_1010986 3300025299 Bacteria 3695
171 Ga0209256_1012055 3300025299 Bacteria 3368
172 Ga0209256_1081155 3300025299 Bacteria 708
173 Ga0207426_1000003 3300025302 Bacteria 1063212
174 Ga0207426_1000010 3300025302 Bacteria 796003
175 Ga0207426_1000039 3300025302 Bacteria 439937
176 Ga0207426_1000671 3300025302 Bacteria 41548
177 Ga0209051_1000142 3300025303 Bacteria 135337
178 Ga0209051_1007308 3300025303 Bacteria 6061
179 Ga0209051_1008288 3300025303 Bacteria 5518
180 Ga0209051_1029198 3300025303 Bacteria 2162
181 Ga0209051_1084409 3300025303 Bacteria 904
182 Ga0209257_1004899 3300025304 Bacteria 9871
183 Ga0209257_1062481 3300025304 Bacteria 1008
184 Ga0207695_10000011 3300025913 Bacteria 910221
185 Ga0207671_10003637 3300025914 Bacteria 15221
186 Ga0207650_10003188 3300025925 Bacteria 11307
187 Ga0207667_10069632 3300025949 Bacteria 3662
188 Ga0207668_10503487 3300025972 Bacteria 1042
189 Ga0207639_10838813 3300026041 Bacteria 858
190 Ga0207678_10696384 3300026067 Bacteria 894
191 Ga0207702_10128849 3300026078 Bacteria 2275
192 Ga0207675_100319457 3300026118 Bacteria 1515
193 Ga0209813_10191286 3300027866 Bacteria 753
194 Ga0268266_10121073 3300028379 Bacteria 2329
195 Ga0268265_11482618 3300028380 Bacteria 682
196 Ga0307515_10127177 3300028794 Bacteria 2836
197 Ga0307515_10379389 3300028794 Bacteria 1047
198 Ga0265338_10014309 3300028800 Bacteria 8837
199 Ga0307405_10002522 3300031731 Bacteria 8106
200 Ga0307412_10006359 3300031911 Bacteria 6675
201 Ga0439465_0000344 3300041413 Bacteria 13291
202 Ga0439465_0005512 3300041413 Bacteria 4036
203 Ga0439465_0021824 3300041413 Bacteria 2010
204 Ga0439465_0035462 3300041413 Bacteria 1599
205 Ga0451833_0423070 3300041491 Bacteria 634
206 Ga0451833_0687010 3300041491 Bacteria 1618
207 Ga0451837_0108696 3300041494 Bacteria 698
208 Ga0451837_0381245 3300041494 Bacteria 1457
209 Ga0451839_0828661 3300041496 Bacteria 1681
210 Ga0451841_0584862 3300041498 Bacteria 1146
211 Ga0451845_0871543 3300041501 Bacteria 1438
212 Ga0451847_0139396 3300041503 Bacteria 1424
213 Ga0451849_1076091 3300041505 Bacteria 966
214 Ga0451849_1390237 3300041505 Bacteria 1299
215 Ga0451851_0204499 3300041507 Bacteria 4532
216 Ga0451851_0631139 3300041507 Bacteria 1265
217 Ga0451843_0630401 3300041509 Bacteria 1232
218 Ga0451855_0141101 3300041511 Bacteria 762
219 Ga0451855_1995774 3300041511 Bacteria 1164
220 Ga0451853_1345831 3300041512 Bacteria 3042
221 Ga0439431_0152225 3300041997 Bacteria 658
222 Ga0439432_050355 3300042006 Bacteria 1300
223 Ga0439449_0005557 3300042007 Bacteria 4825
224 Ga0466966_0025673 3300044684 Bacteria 3848
225 Ga0466963_0105375 3300044694 Bacteria 1932
226 Ga0466970_0000649 3300044765 Bacteria 17115
227 Ga0466957_0032447 3300044842 Bacteria 3127
228 Ga0466959_0072429 3300045049 Bacteria 2494
229 Ga0466958_0073571 3300045836 Bacteria 2093
230 Ga0466967_1384992 3300045976 Bacteria 700
231 Ga0495617_112574 3300046452 Bacteria 880
232 Ga0495592_0064949 3300046454 Bacteria 2673
233 Ga0495638_0000145 3300046460 Bacteria 112275
234 Ga0495638_0130856 3300046460 Bacteria 1474
235 Ga0495650_0026325 3300046471 Bacteria 2708
236 Ga0495650_0105711 3300046471 Bacteria 1052
237 Ga0495605_0000715 3300046474 Bacteria 24441
238 Ga0495605_0034646 3300046474 Bacteria 2556
239 Ga0495605_0380348 3300046474 Bacteria 589
240 Ga0495662_0000738 3300046476 Bacteria 15658
241 Ga0495664_0091918 3300046477 Bacteria 1825
242 Ga0495585_0013441 3300046492 Bacteria 4791
243 Ga0495585_0021340 3300046492 Bacteria 3719
244 Ga0495607_0029168 3300046501 Bacteria 3398
245 Ga0495583_0004516 3300046506 Bacteria 9921
246 Ga0495583_0132988 3300046506 Bacteria 1040
247 Ga0495606_0002372 3300046507 Bacteria 22115
248 Ga0495606_0008918 3300046507 Bacteria 8589
249 Ga0495606_0077069 3300046507 Bacteria 2082
250 Ga0495606_0222298 3300046507 Bacteria 1063
251 Ga0495610_0000703 3300046512 Bacteria 32000
252 Ga0495610_0034788 3300046512 Bacteria 2591
253 Ga0495616_0026298 3300046513 Bacteria 3099
254 Ga0495616_0196244 3300046513 Bacteria 889
255 Ga0495620_0006623 3300046515 Bacteria 6347
256 Ga0495620_0016476 3300046515 Bacteria 3707
257 Ga0495631_0001539 3300046518 Bacteria 13867
258 Ga0495632_0001929 3300046519 Bacteria 16568
259 Ga0495632_0002877 3300046519 Bacteria 12688
260 Ga0495632_0013737 3300046519 Bacteria 4608
261 Ga0495632_0297083 3300046519 Bacteria 717
262 Ga0495643_0029212 3300046522 Bacteria 3085
263 Ga0495643_0033938 3300046522 Bacteria 2818
264 Ga0495643_0038213 3300046522 Bacteria 2630
265 Ga0495643_0086102 3300046522 Bacteria 1628
266 Ga0495652_0119334 3300046529 Bacteria 2107
267 Ga0495640_0058710 3300046533 Bacteria 2623
268 Ga0495587_0056697 3300046536 Bacteria 2305
269 Ga0495597_0012545 3300046542 Bacteria 4086
270 Ga0495633_0047575 3300046558 Bacteria 2027
271 Ga0495633_0279821 3300046558 Bacteria 759
272 Ga0495656_0068928 3300046615 Bacteria 1565
273 Ga0495656_0127804 3300046615 Bacteria 1207
274 Ga0495668_0003583 3300046616 Bacteria 11528
275 Ga0495668_0037863 3300046616 Bacteria 2697
276 Ga0495611_0003021 3300046648 Bacteria 7497
277 Ga0495625_0002190 3300046660 Bacteria 21683
278 Ga0495625_0075147 3300046660 Bacteria 2364
279 Ga0495625_0297746 3300046660 Bacteria 1033
280 Ga0495635_0035183 3300046663 Bacteria 3473
281 Ga0495661_0226546 3300046665 Bacteria 966
282 Ga0495588_0033187 3300046674 Bacteria 2606
283 Ga0495657_0054655 3300046675 Bacteria 2666
284 Ga0495624_0056174 3300046690 Bacteria 2478
285 Ga0495670_0023596 3300046691 Bacteria 3036
286 Ga0495670_0054915 3300046691 Bacteria 1997
287 Ga0495670_0460579 3300046691 Bacteria 689
288 Ga0495671_0140042 3300046692 Bacteria 1179
289 Ga0495649_0201381 3300046694 Bacteria 1034
290 Ga0495649_0359782 3300046694 Bacteria 734
291 Ga0495600_0110988 3300046809 Bacteria 1785
292 Ga0495604_0065192 3300047317 Bacteria 2773
293 Ga0495636_0019889 3300047318 Bacteria 2702
294 Ga0495674_0491206 3300047319 Bacteria 983
295 Ga0495672_0005896 3300047320 Bacteria 9602
296 Ga0495687_020307 3300047443 Bacteria 3239
297 Ga0495687_102134 3300047443 Bacteria 1073
298 Ga0495679_055582 3300047446 Bacteria 1175
299 Ga0495681_0029736 3300047470 Bacteria 2792
300 Ga0495686_0001073 3300047472 Bacteria 32557
301 Ga0495686_0005102 3300047472 Bacteria 10499
302 Ga0495686_0101949 3300047472 Bacteria 1730
303 Ga0495686_0217949 3300047472 Bacteria 1087
304 Ga0495686_0306845 3300047472 Bacteria 874
305 Ga0495686_0379424 3300047472 Bacteria 763
306 Ga0495626_0023555 3300048091 Bacteria 3031
307 Ga0496100_0002352 3300048903 Bacteria 9571
308 Ga0496100_0438589 3300048903 Bacteria 1000
309 Ga0496101_0128394 3300048904 Bacteria 1923
310 Ga0496101_0254256 3300048904 Bacteria 1369
311 Ga0496102_0005955 3300048905 Bacteria 10383
312 Ga0496102_0198688 3300048905 Bacteria 1890
313 Ga0496103_0001184 3300048906 Bacteria 17910
314 Ga0496103_1050657 3300048906 Bacteria 505
315 Ga0496104_0799759 3300048907 Bacteria 849
316 Ga0496105_0026425 3300048908 Bacteria 4734
317 Ga0496106_0000125 3300048909 Bacteria 59031
318 Ga0496106_0106628 3300048909 Bacteria 2178
319 Ga0496106_0856927 3300048909 Bacteria 719
320 Ga0496107_0062984 3300048910 Bacteria 2687
321 Ga0496111_0593016 3300048914 Bacteria 811
322 Ga0496113_0016531 3300048916 Bacteria 5099
323 Ga0496113_0564739 3300048916 Bacteria 912
324 Ga0496113_0913338 3300048916 Bacteria 694
325 Ga0496114_0075401 3300048917 Bacteria 2841
326 Ga0496114_0175450 3300048917 Bacteria 1870
327 Ga0496116_0005363 3300048919 Bacteria 11934
328 Ga0496116_0009212 3300048919 Bacteria 8450
329 Ga0496116_0012844 3300048919 Bacteria 6806
330 Ga0496116_0012915 3300048919 Bacteria 6780
331 Ga0496116_0028834 3300048919 Bacteria 4013
332 Ga0496116_0040914 3300048919 Bacteria 3185
333 Ga0496116_0061961 3300048919 Bacteria 2418
334 Ga0496116_0238011 3300048919 Bacteria 917
335 Ga0496117_0002198 3300048920 Bacteria 25364
336 Ga0496117_0018379 3300048920 Bacteria 5790
337 Ga0496117_0082333 3300048920 Bacteria 2108
338 Ga0496117_0085495 3300048920 Bacteria 2053
339 Ga0496117_0122131 3300048920 Bacteria 1598
340 Ga0496118_0002392 3300048921 Bacteria 25358
341 Ga0496118_0003857 3300048921 Bacteria 18424
342 Ga0496118_0024594 3300048921 Bacteria 5194
343 Ga0496118_0092262 3300048921 Bacteria 2079
344 Ga0496118_0093505 3300048921 Bacteria 2059
345 Ga0496118_0462469 3300048921 Bacteria 641
346 Ga0496119_0004664 3300048922 Bacteria 13512
347 Ga0496119_0020340 3300048922 Bacteria 4846
348 Ga0496119_0046424 3300048922 Bacteria 2713
349 Ga0496119_0074982 3300048922 Bacteria 1968
350 Ga0496119_0083065 3300048922 Bacteria 1840
351 Ga0496119_0104765 3300048922 Bacteria 1581
352 Ga0496120_0004195 3300048923 Bacteria 12312
353 Ga0496121_0002775 3300048924 Bacteria 25995
354 Ga0496121_0020325 3300048924 Bacteria 6580
355 Ga0496121_0031045 3300048924 Bacteria 4893
356 Ga0496121_0031418 3300048924 Bacteria 4851
357 Ga0496121_0033635 3300048924 Bacteria 4634
358 Ga0496121_0072638 3300048924 Bacteria 2761
359 Ga0496121_0098968 3300048924 Bacteria 2255
360 Ga0496121_0351628 3300048924 Bacteria 981
361 Ga0496121_0366015 3300048924 Bacteria 955
362 Ga0496121_0373303 3300048924 Bacteria 943
363 Ga0496121_0631817 3300048924 Bacteria 655
364 Ga0496122_0005990 3300048925 Bacteria 14209
365 Ga0496122_0007088 3300048925 Bacteria 12593
366 Ga0496122_0016747 3300048925 Bacteria 6907
367 Ga0496122_0032632 3300048925 Bacteria 4301
368 Ga0496122_0036840 3300048925 Bacteria 3947
369 Ga0496122_0125558 3300048925 Bacteria 1643
370 Ga0496122_0318512 3300048925 Bacteria 828
371 Ga0496123_0003616 3300048926 Bacteria 17128
372 Ga0496123_0014496 3300048926 Bacteria 6528
373 Ga0496123_0028689 3300048926 Bacteria 4113
374 Ga0496123_0029563 3300048926 Bacteria 4029
375 Ga0496123_0032137 3300048926 Bacteria 3806
376 Ga0496123_0117400 3300048926 Bacteria 1505
377 Ga0496124_0004003 3300048927 Bacteria 17543
378 Ga0496124_0006551 3300048927 Bacteria 12658
379 Ga0496124_0045320 3300048927 Bacteria 3770
380 Ga0496124_0059163 3300048927 Bacteria 3219
381 Ga0496124_0083422 3300048927 Bacteria 2622
382 Ga0496124_0156837 3300048927 Bacteria 1779
383 Ga0496124_0253195 3300048927 Bacteria 1301
384 Ga0496124_0283813 3300048927 Bacteria 1205
385 Ga0496124_0405590 3300048927 Bacteria 944
386 Ga0496125_0003639 3300048928 Bacteria 18464
387 Ga0496125_0014114 3300048928 Bacteria 7797
388 Ga0496125_0177067 3300048928 Bacteria 1426
389 Ga0496125_0325152 3300048928 Bacteria 930
390 Ga0496125_0414426 3300048928 Bacteria 783
391 Ga0496125_0551548 3300048928 Bacteria 638
392 Ga0496126_0019302 3300048929 Bacteria 6715
393 Ga0496126_0082458 3300048929 Bacteria 2841
394 Ga0496126_0187659 3300048929 Bacteria 1752
395 Ga0496126_0255179 3300048929 Bacteria 1460
396 Ga0496126_0916269 3300048929 Bacteria 663
397 Ga0495678_024147 3300049459 Bacteria 2630
398 Ga0495678_052731 3300049459 Bacteria 1565
399 Ga0495678_060738 3300049459 Bacteria 1421
400 Ga0501032_0034664 3300049569 Bacteria 3454
401 Ga0501037_0208924 3300049573 Bacteria 1377
402 Ga0501046_0450400 3300049580 Bacteria 926
403 Ga0501047_0431506 3300049581 Bacteria 1148
404 Ga0501068_0156585 3300049584 Bacteria 1435
405 Ga0501080_0048319 3300049742 Bacteria 3961
406 Ga0501083_0757769 3300049744 Bacteria 631
407 Ga0501044_0174887 3300049823 Bacteria 2116
408 nmdc:mga03683_3800_c1 3300050489 Bacteria 4928
409 nmdc:mga03n38_100619_c1 3300050490 Bacteria 1393
410 nmdc:mga03n38_242829_c1 3300050490 Bacteria 948
411 nmdc:mga00v17_141911_c2 3300050491 Bacteria 664
412 nmdc:mga0yw44_575629_c1 3300050492 Bacteria 765
413 nmdc:mga07m45_390974_c1 3300050496 Bacteria 807
414 nmdc:mga07m45_430618_c1 3300050496 Bacteria 765
415 Ga0500610_0005661 3300053079 Bacteria 5151
416 Ga0495655_0122991 3300053083 Bacteria 792
417 Ga0500578_0069068 3300053086 Bacteria 2251
418 Ga0500651_0176445 3300053093 Bacteria 1271
419 Ga0500557_000494 3300053105 Bacteria 5247
420 Ga0500569_003626 3300053109 Bacteria 3176
421 Ga0500569_044354 3300053109 Bacteria 1316
422 Ga0500594_0000222 3300053118 Bacteria 13820
423 Ga0500608_008336 3300053122 Bacteria 4350
424 Ga0500618_004170 3300053125 Bacteria 4715
425 Ga0500618_012936 3300053125 Bacteria 2172
426 Ga0500618_036631 3300053125 Bacteria 1136
427 Ga0500658_0002500 3300053134 Bacteria 7116
428 Ga0500658_0007286 3300053134 Bacteria 4084
429 Ga0500568_0000846 3300053139 Bacteria 21547
430 Ga0500568_0003503 3300053139 Bacteria 8713
431 Ga0500590_000249 3300053148 Bacteria 16591
432 Ga0500604_0295956 3300053151 Bacteria 561
433 Ga0500616_0006239 3300053153 Bacteria 7862
434 Ga0500616_0008579 3300053153 Bacteria 6329
435 Ga0500622_0242031 3300053156 Bacteria 797
436 Ga0500627_0056756 3300053158 Bacteria 1716
437 Ga0500633_0020653 3300053160 Bacteria 1990
438 Ga0500633_0103457 3300053160 Bacteria 1050
439 Ga0500638_231715 3300053162 Bacteria 758
440 Ga0500636_0067338 3300053177 Bacteria 2081
441 Ga0500645_006761 3300053730 Bacteria 4062
442 Ga0466962_0188569 3300061719 Bacteria 1006

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0431506 Ga0501047_0431506_457_966 138
2 3300049742 Ga0501080_0048319 Ga0501080_0048319_1566_2075 138
3 3300028800 Ga0265338_10014309 Ga0265338_100143093 140
4 iso_pu_bacteria 2718217997 2719665604 147
5 iso_pu_bacteria 2718218199 2720492024 147
6 iso_pu_bacteria 2718218232 2720613289 147
7 iso_pu_bacteria 2718218233 2720620165 147
8 iso_pu_bacteria 2718218235 2720631590 147
9 iso_pu_bacteria 2718218269 2720775318 147
10 iso_pu_bacteria 2721755556 2723026936 147
11 iso_pu_bacteria 2721755684 2723560551 147
12 iso_pu_bacteria 2721755685 2723567137 147
13 iso_pu_bacteria 2721755819 2724089925 147
14 iso_pu_bacteria 2721755822 2724104402 147
15 iso_pu_bacteria 2728369352 2730107872 147
16 iso_pu_bacteria 2838048938 2838052428 147
17 iso_pu_bacteria 2838061910 2838067744 147
18 iso_pu_bacteria 2838068647 2838073582 147
19 iso_pu_bacteria 2842311132 2842316700 147
20 iso_pu_bacteria 2842422224 2842428067 147
21 iso_pu_bacteria 2842447887 2842450562 147
22 iso_pu_bacteria 2933599457 2933603936 147
23 iso_pu_bacteria 8005282627 8005283180 147
24 iso_pu_bacteria 8005497431 8005500327 147
25 iso_pu_bacteria 8005626139 8005626522 147
26 iso_pu_bacteria 8005668836 8005671744 147
27 3300002774 JGI25150J39212_1000137 JGI25150J39212_100013718 148
28 3300003187 JGI25151J46595_10000300 JGI25151J46595_1000030011 148
29 3300003215 JGI25153J46596_10005686 JGI25153J46596_100056867 148
30 3300025245 Ga0207425_1000024 Ga0207425_100002481 148
31 3300025258 Ga0209129_1000133 Ga0209129_100013333 148
32 3300025273 Ga0209673_1007231 Ga0209673_10072317 148
33 3300025294 Ga0209025_1000050 Ga0209025_1000050246 148
34 3300025297 Ga0209758_1000083 Ga0209758_100008311 148
35 3300048903 Ga0496100_0438589 Ga0496100_0438589_446_952 148
36 3300048904 Ga0496101_0128394 Ga0496101_0128394_61_567 148
37 3300048904 Ga0496101_0254256 Ga0496101_0254256_438_944 148
38 3300048916 Ga0496113_0564739 Ga0496113_0564739_121_627 148
39 3300048919 Ga0496116_0009212 Ga0496116_0009212_5831_6337 148
40 3300048919 Ga0496116_0012844 Ga0496116_0012844_4062_4568 148
41 3300048920 Ga0496117_0018379 Ga0496117_0018379_4646_5152 148
42 3300048920 Ga0496117_0082333 Ga0496117_0082333_1122_1628 148
43 3300048921 Ga0496118_0024594 Ga0496118_0024594_2231_2737 148
44 3300048921 Ga0496118_0093505 Ga0496118_0093505_669_1175 148
45 3300048924 Ga0496121_0020325 Ga0496121_0020325_4718_5224 148
46 3300048924 Ga0496121_0098968 Ga0496121_0098968_553_1059 148
47 3300048925 Ga0496122_0016747 Ga0496122_0016747_2239_2745 148
48 3300048925 Ga0496122_0032632 Ga0496122_0032632_3450_3956 148
49 3300048926 Ga0496123_0028689 Ga0496123_0028689_155_661 148
50 3300048926 Ga0496123_0029563 Ga0496123_0029563_116_622 148
51 3300048927 Ga0496124_0004003 Ga0496124_0004003_13053_13559 148
52 3300048927 Ga0496124_0006551 Ga0496124_0006551_1017_1523 148
53 3300048928 Ga0496125_0014114 Ga0496125_0014114_5912_6418 148
54 3300048928 Ga0496125_0414426 Ga0496125_0414426_119_625 148
55 iso_pu_bacteria 2643221653 2644298502 148
56 iso_pu_bacteria 2643221719 2644656731 148
57 iso_pu_bacteria 2738541293 2738802059 148
58 iso_pu_bacteria 2818991272 2819241633 148
59 iso_pu_bacteria 2891048133 2891052118 148
60 iso_pu_bacteria 2989776772 2989779030 148
61 iso_pu_bacteria 8005246636 8005248585 148
62 3300001979 JGI24740J21852_10000136 JGI24740J21852_1000013613 149
63 3300002704 JGI25155J39150_1000001 JGI25155J39150_100000119 149
64 3300002705 JGI25156J39149_1000001 JGI25156J39149_1000001313 149
65 3300002737 JGI25162J39368_1001158 JGI25162J39368_10011583 149
66 3300002737 JGI25162J39368_1002359 JGI25162J39368_10023597 149
67 3300002737 JGI25162J39368_1003705 JGI25162J39368_10037054 149
68 3300002738 JGI25154J39366_1000011 JGI25154J39366_100001170 149
69 3300002739 JGI25158J39367_1000255 JGI25158J39367_10002557 149
70 3300002741 JGI25157J39369_1000030 JGI25157J39369_1000030115 149
71 3300002773 JGI25152J39213_1002860 JGI25152J39213_10028605 149
72 3300002773 JGI25152J39213_1009190 JGI25152J39213_10091903 149
73 3300002773 JGI25152J39213_1030848 JGI25152J39213_10308481 149
74 3300002774 JGI25150J39212_1032174 JGI25150J39212_10321741 149
75 3300002987 JGI25159J45721_1000272 JGI25159J45721_100027222 149
76 3300002987 JGI25159J45721_1001295 JGI25159J45721_10012954 149
77 3300003187 JGI25151J46595_10000134 JGI25151J46595_1000013438 149
78 3300003187 JGI25151J46595_10002851 JGI25151J46595_100028517 149
79 3300003214 JGI25165J46597_1001317 JGI25165J46597_10013173 149
80 3300003214 JGI25165J46597_1001387 JGI25165J46597_10013872 149
81 3300003214 JGI25165J46597_1002284 JGI25165J46597_10022843 149
82 3300003215 JGI25153J46596_10009240 JGI25153J46596_100092406 149
83 3300003215 JGI25153J46596_10015744 JGI25153J46596_100157443 149
84 3300003215 JGI25153J46596_10058660 JGI25153J46596_100586601 149
85 3300003215 JGI25153J46596_10097949 JGI25153J46596_100979491 149
86 3300003316 rootH1_10010859 rootH1_100108595 149
87 3300003316 rootH1_10138550 rootH1_101385502 149
88 3300003320 rootH2_10055022 rootH2_100550225 149
89 3300003320 rootH2_10217396 rootH2_102173962 149
90 3300003322 rootL2_10037168 rootL2_100371683 149
91 3300003322 rootL2_10067723 rootL2_1006772310 149
92 3300003354 JGI25160J50197_1000010 JGI25160J50197_1000010101 149
93 3300003374 JGI25161J50226_1000006 JGI25161J50226_1000006101 149
94 3300003374 JGI25161J50226_1000282 JGI25161J50226_10002822 149
95 3300003374 JGI25161J50226_1003736 JGI25161J50226_10037364 149
96 3300003374 JGI25161J50226_1006287 JGI25161J50226_10062873 149
97 3300003771 Ga0055526_1000191 Ga0055526_100019138 149
98 3300003771 Ga0055526_1005036 Ga0055526_10050363 149
99 3300003771 Ga0055526_1011041 Ga0055526_10110416 149
100 3300003771 Ga0055526_1017456 Ga0055526_10174563 149
101 3300003771 Ga0055526_1039379 Ga0055526_10393792 149
102 3300003775 Ga0055524_1005678 Ga0055524_10056783 149
103 3300003775 Ga0055524_1007042 Ga0055524_10070424 149
104 3300003775 Ga0055524_1010213 Ga0055524_10102133 149
105 3300003775 Ga0055524_1014795 Ga0055524_10147952 149
106 3300003775 Ga0055524_1016704 Ga0055524_10167043 149
107 3300003775 Ga0055524_1028517 Ga0055524_10285171 149
108 3300003790 Ga0055528_1000794 Ga0055528_10007947 149
109 3300003790 Ga0055528_1001243 Ga0055528_100124317 149
110 3300003790 Ga0055528_1003681 Ga0055528_10036814 149
111 3300003790 Ga0055528_1004133 Ga0055528_10041335 149
112 3300003790 Ga0055528_1014390 Ga0055528_10143902 149
113 3300003790 Ga0055528_1018780 Ga0055528_10187804 149
114 3300003790 Ga0055528_1032091 Ga0055528_10320912 149
115 3300003792 Ga0055540_1003033 Ga0055540_10030336 149
116 3300003792 Ga0055540_1012330 Ga0055540_10123302 149
117 3300003792 Ga0055540_1016002 Ga0055540_10160022 149
118 3300003794 Ga0055531_10048294 Ga0055531_100482943 149
119 3300003856 Ga0058692_1012924 Ga0058692_10129243 149
120 3300004625 Ga0055543_1000014 Ga0055543_10000147 149
121 3300004625 Ga0055543_1000020 Ga0055543_100002027 149
122 3300004625 Ga0055543_1001626 Ga0055543_10016265 149
123 3300005262 Ga0065165_1000251 Ga0065165_100025111 149
124 3300005262 Ga0065165_1010297 Ga0065165_10102974 149
125 3300005262 Ga0065165_1014133 Ga0065165_10141333 149
126 3300005262 Ga0065165_1024832 Ga0065165_10248324 149
127 3300005331 Ga0070670_100002269 Ga0070670_10000226911 149
128 3300005347 Ga0070668_100806915 Ga0070668_1008069151 149
129 3300005355 Ga0070671_100081122 Ga0070671_1000811224 149
130 3300005455 Ga0070663_100907622 Ga0070663_1009076222 149
131 3300005548 Ga0070665_100156677 Ga0070665_1001566773 149
132 3300005563 Ga0068855_100066371 Ga0068855_1000663713 149
133 3300005614 Ga0068856_100075976 Ga0068856_1000759762 149
134 3300005614 Ga0068856_100163634 Ga0068856_1001636343 149
135 3300005719 Ga0068861_100498561 Ga0068861_1004985612 149
136 3300005937 Ga0081455_10551087 Ga0081455_105510872 149
137 3300006042 Ga0075368_10007373 Ga0075368_100073736 149
138 3300006042 Ga0075368_10247019 Ga0075368_102470191 149
139 3300006048 Ga0075363_100028582 Ga0075363_1000285823 149
140 3300006048 Ga0075363_100040896 Ga0075363_1000408964 149
141 3300006048 Ga0075363_100071222 Ga0075363_1000712222 149
142 3300006051 Ga0075364_10579894 Ga0075364_105798942 149
143 3300006177 Ga0075362_10001489 Ga0075362_100014896 149
144 3300006177 Ga0075362_10231945 Ga0075362_102319452 149
145 3300006178 Ga0075367_10002471 Ga0075367_100024717 149
146 3300006178 Ga0075367_10002760 Ga0075367_100027607 149
147 3300006178 Ga0075367_10380351 Ga0075367_103803512 149
148 3300006178 Ga0075367_10527163 Ga0075367_105271632 149
149 3300006186 Ga0075369_10000330 Ga0075369_100003306 149
150 3300006186 Ga0075369_10032046 Ga0075369_100320464 149
151 3300006195 Ga0075366_10078014 Ga0075366_100780143 149
152 3300006353 Ga0075370_10001061 Ga0075370_100010617 149
153 3300006353 Ga0075370_10003623 Ga0075370_100036234 149
154 3300006353 Ga0075370_10489312 Ga0075370_104893121 149
155 3300009093 Ga0105240_10000005 Ga0105240_10000005597 149
156 3300009177 Ga0105248_10514549 Ga0105248_105145492 149
157 3300009545 Ga0105237_10000809 Ga0105237_1000080917 149
158 3300009553 Ga0105249_10361728 Ga0105249_103617283 149
159 3300009765 Ga0123341_1000004 Ga0123341_1000004102 149
160 3300009766 Ga0123342_1006869 Ga0123342_10068698 149
161 3300010375 Ga0105239_10004791 Ga0105239_100047914 149
162 3300010375 Ga0105239_11980068 Ga0105239_119800682 149
163 3300013104 Ga0157370_10001170 Ga0157370_1000117015 149
164 3300013105 Ga0157369_11115730 Ga0157369_111157302 149
165 3300013306 Ga0163162_11061907 Ga0163162_110619072 149
166 3300013307 Ga0157372_11001975 Ga0157372_110019752 149
167 3300014497 Ga0182008_10026604 Ga0182008_100266043 149
168 3300015262 Ga0182007_10005859 Ga0182007_100058596 149
169 3300015265 Ga0182005_1012463 Ga0182005_10124633 149
170 3300025206 Ga0209435_100012 Ga0209435_10001269 149
171 3300025207 Ga0209760_103929 Ga0209760_1039292 149
172 3300025208 Ga0209436_100034 Ga0209436_1000344 149
173 3300025208 Ga0209436_106118 Ga0209436_1061184 149
174 3300025233 Ga0209437_100047 Ga0209437_100047225 149
175 3300025233 Ga0209437_100165 Ga0209437_100165129 149
176 3300025245 Ga0207425_1002510 Ga0207425_10025105 149
177 3300025245 Ga0207425_1010394 Ga0207425_10103943 149
178 3300025245 Ga0207425_1044298 Ga0207425_10442981 149
179 3300025246 Ga0209646_1000026 Ga0209646_100002669 149
180 3300025246 Ga0209646_1014159 Ga0209646_10141592 149
181 3300025250 Ga0209026_1000014 Ga0209026_100001469 149
182 3300025253 Ga0209677_100570 Ga0209677_1005709 149
183 3300025256 Ga0209759_1000012 Ga0209759_100001269 149
184 3300025258 Ga0209129_1000069 Ga0209129_1000069129 149
185 3300025258 Ga0209129_1000732 Ga0209129_10007329 149
186 3300025258 Ga0209129_1000817 Ga0209129_100081713 149
187 3300025258 Ga0209129_1027073 Ga0209129_10270731 149
188 3300025261 Ga0209233_1000048 Ga0209233_1000048177 149
189 3300025261 Ga0209233_1000069 Ga0209233_1000069259 149
190 3300025261 Ga0209233_1000195 Ga0209233_100019513 149
191 3300025273 Ga0209673_1000013 Ga0209673_1000013443 149
192 3300025273 Ga0209673_1000048 Ga0209673_1000048186 149
193 3300025273 Ga0209673_1000552 Ga0209673_10005528 149
194 3300025273 Ga0209673_1000580 Ga0209673_100058039 149
195 3300025273 Ga0209673_1000959 Ga0209673_100095920 149
196 3300025273 Ga0209673_1004682 Ga0209673_10046828 149
197 3300025273 Ga0209673_1005882 Ga0209673_10058826 149
198 3300025284 Ga0209130_1000004 Ga0209130_1000004190 149
199 3300025284 Ga0209130_1000021 Ga0209130_1000021166 149
200 3300025291 Ga0209675_1015462 Ga0209675_10154622 149
201 3300025292 Ga0209676_1095737 Ga0209676_10957371 149
202 3300025294 Ga0209025_1000166 Ga0209025_10001665 149
203 3300025294 Ga0209025_1003517 Ga0209025_10035177 149
204 3300025294 Ga0209025_1005057 Ga0209025_100505713 149
205 3300025294 Ga0209025_1011274 Ga0209025_10112747 149
206 3300025294 Ga0209025_1012989 Ga0209025_10129894 149
207 3300025294 Ga0209025_1036997 Ga0209025_10369973 149
208 3300025295 Ga0209564_1000273 Ga0209564_100027397 149
209 3300025295 Ga0209564_1001066 Ga0209564_100106624 149
210 3300025295 Ga0209564_1002209 Ga0209564_100220911 149
211 3300025295 Ga0209564_1005653 Ga0209564_10056537 149
212 3300025295 Ga0209564_1008240 Ga0209564_10082405 149
213 3300025297 Ga0209758_1000384 Ga0209758_100038450 149
214 3300025297 Ga0209758_1000749 Ga0209758_100074912 149
215 3300025297 Ga0209758_1001310 Ga0209758_10013109 149
216 3300025297 Ga0209758_1004443 Ga0209758_10044433 149
217 3300025297 Ga0209758_1004646 Ga0209758_100464610 149
218 3300025297 Ga0209758_1007723 Ga0209758_10077234 149
219 3300025299 Ga0209256_1000371 Ga0209256_100037135 149
220 3300025299 Ga0209256_1003416 Ga0209256_100341612 149
221 3300025299 Ga0209256_1004340 Ga0209256_10043408 149
222 3300025299 Ga0209256_1004711 Ga0209256_10047116 149
223 3300025299 Ga0209256_1010986 Ga0209256_10109863 149
224 3300025299 Ga0209256_1012055 Ga0209256_10120553 149
225 3300025299 Ga0209256_1081155 Ga0209256_10811552 149
226 3300025302 Ga0207426_1000003 Ga0207426_1000003538 149
227 3300025302 Ga0207426_1000010 Ga0207426_1000010192 149
228 3300025302 Ga0207426_1000039 Ga0207426_100003998 149
229 3300025302 Ga0207426_1000671 Ga0207426_100067129 149
230 3300025303 Ga0209051_1000142 Ga0209051_1000142109 149
231 3300025303 Ga0209051_1007308 Ga0209051_10073084 149
232 3300025303 Ga0209051_1008288 Ga0209051_10082887 149
233 3300025303 Ga0209051_1029198 Ga0209051_10291984 149
234 3300025303 Ga0209051_1084409 Ga0209051_10844092 149
235 3300025304 Ga0209257_1004899 Ga0209257_10048999 149
236 3300025304 Ga0209257_1062481 Ga0209257_10624811 149
237 3300025913 Ga0207695_10000011 Ga0207695_10000011321 149
238 3300025914 Ga0207671_10003637 Ga0207671_100036379 149
239 3300025925 Ga0207650_10003188 Ga0207650_100031888 149
240 3300025949 Ga0207667_10069632 Ga0207667_100696325 149
241 3300025972 Ga0207668_10503487 Ga0207668_105034872 149
242 3300026041 Ga0207639_10838813 Ga0207639_108388132 149
243 3300026067 Ga0207678_10696384 Ga0207678_106963841 149
244 3300026078 Ga0207702_10128849 Ga0207702_101288492 149
245 3300026118 Ga0207675_100319457 Ga0207675_1003194573 149
246 3300027866 Ga0209813_10191286 Ga0209813_101912861 149
247 3300028379 Ga0268266_10121073 Ga0268266_101210733 149
248 3300028380 Ga0268265_11482618 Ga0268265_114826181 149
249 3300028794 Ga0307515_10127177 Ga0307515_101271773 149
250 3300028794 Ga0307515_10379389 Ga0307515_103793892 149
251 3300031731 Ga0307405_10002522 Ga0307405_100025224 149
252 3300031911 Ga0307412_10006359 Ga0307412_100063596 149
253 3300041413 Ga0439465_0000344 Ga0439465_0000344_12324_12842 149
254 3300041413 Ga0439465_0005512 Ga0439465_0005512_2800_3327 149
255 3300041413 Ga0439465_0021824 Ga0439465_0021824_215_742 149
256 3300041413 Ga0439465_0035462 Ga0439465_0035462_49_567 149
257 3300041491 Ga0451833_0423070 Ga0451833_0423070_61_588 149
258 3300041491 Ga0451833_0687010 Ga0451833_0687010_344_862 149
259 3300041494 Ga0451837_0108696 Ga0451837_0108696_143_670 149
260 3300041494 Ga0451837_0381245 Ga0451837_0381245_870_1388 149
261 3300041496 Ga0451839_0828661 Ga0451839_0828661_315_833 149
262 3300041498 Ga0451841_0584862 Ga0451841_0584862_214_732 149
263 3300041501 Ga0451845_0871543 Ga0451845_0871543_448_966 149
264 3300041503 Ga0451847_0139396 Ga0451847_0139396_55_573 149
265 3300041505 Ga0451849_1076091 Ga0451849_1076091_385_912 149
266 3300041505 Ga0451849_1390237 Ga0451849_1390237_663_1181 149
267 3300041507 Ga0451851_0204499 Ga0451851_0204499_2352_2894 149
268 3300041507 Ga0451851_0631139 Ga0451851_0631139_222_740 149
269 3300041509 Ga0451843_0630401 Ga0451843_0630401_48_566 149
270 3300041511 Ga0451855_0141101 Ga0451855_0141101_207_734 149
271 3300041511 Ga0451855_1995774 Ga0451855_1995774_155_673 149
272 3300041512 Ga0451853_1345831 Ga0451853_1345831_347_874 149
273 3300041997 Ga0439431_0152225 Ga0439431_0152225_53_571 149
274 3300042006 Ga0439432_050355 Ga0439432_050355_397_915 149
275 3300042007 Ga0439449_0005557 Ga0439449_0005557_2316_2834 149
276 3300044684 Ga0466966_0025673 Ga0466966_0025673_197_724 149
277 3300044694 Ga0466963_0105375 Ga0466963_0105375_874_1401 149
278 3300044765 Ga0466970_0000649 Ga0466970_0000649_13246_13773 149
279 3300044842 Ga0466957_0032447 Ga0466957_0032447_11_538 149
280 3300045049 Ga0466959_0072429 Ga0466959_0072429_1434_1961 149
281 3300045836 Ga0466958_0073571 Ga0466958_0073571_660_1187 149
282 3300045976 Ga0466967_1384992 Ga0466967_1384992_135_662 149
283 3300046452 Ga0495617_112574 Ga0495617_112574_176_703 149
284 3300046454 Ga0495592_0064949 Ga0495592_0064949_755_1297 149
285 3300046460 Ga0495638_0000145 Ga0495638_0000145_94512_95018 149
286 3300046460 Ga0495638_0130856 Ga0495638_0130856_270_788 149
287 3300046471 Ga0495650_0026325 Ga0495650_0026325_1006_1533 149
288 3300046471 Ga0495650_0105711 Ga0495650_0105711_514_1041 149
289 3300046474 Ga0495605_0000715 Ga0495605_0000715_7771_8298 149
290 3300046474 Ga0495605_0034646 Ga0495605_0034646_1778_2296 149
291 3300046474 Ga0495605_0380348 Ga0495605_0380348_44_562 149
292 3300046476 Ga0495662_0000738 Ga0495662_0000738_1230_1772 149
293 3300046477 Ga0495664_0091918 Ga0495664_0091918_174_716 149
294 3300046492 Ga0495585_0013441 Ga0495585_0013441_2329_2856 149
295 3300046492 Ga0495585_0021340 Ga0495585_0021340_2043_2558 149
296 3300046501 Ga0495607_0029168 Ga0495607_0029168_1932_2459 149
297 3300046506 Ga0495583_0004516 Ga0495583_0004516_5036_5554 149
298 3300046506 Ga0495583_0132988 Ga0495583_0132988_25_552 149
299 3300046507 Ga0495606_0002372 Ga0495606_0002372_7861_8310 149
300 3300046507 Ga0495606_0008918 Ga0495606_0008918_3978_4496 149
301 3300046507 Ga0495606_0077069 Ga0495606_0077069_876_1394 149
302 3300046507 Ga0495606_0222298 Ga0495606_0222298_140_667 149
303 3300046512 Ga0495610_0000703 Ga0495610_0000703_12119_12637 149
304 3300046512 Ga0495610_0034788 Ga0495610_0034788_131_649 149
305 3300046513 Ga0495616_0026298 Ga0495616_0026298_2059_2565 149
306 3300046513 Ga0495616_0196244 Ga0495616_0196244_126_644 149
307 3300046515 Ga0495620_0006623 Ga0495620_0006623_3229_3747 149
308 3300046515 Ga0495620_0016476 Ga0495620_0016476_2797_3315 149
309 3300046518 Ga0495631_0001539 Ga0495631_0001539_2665_3192 149
310 3300046519 Ga0495632_0001929 Ga0495632_0001929_10807_11325 149
311 3300046519 Ga0495632_0002877 Ga0495632_0002877_859_1386 149
312 3300046519 Ga0495632_0013737 Ga0495632_0013737_229_747 149
313 3300046519 Ga0495632_0297083 Ga0495632_0297083_240_704 149
314 3300046522 Ga0495643_0029212 Ga0495643_0029212_414_941 149
315 3300046522 Ga0495643_0033938 Ga0495643_0033938_2168_2686 149
316 3300046522 Ga0495643_0038213 Ga0495643_0038213_1174_1680 149
317 3300046522 Ga0495643_0086102 Ga0495643_0086102_360_809 149
318 3300046529 Ga0495652_0119334 Ga0495652_0119334_701_1243 149
319 3300046533 Ga0495640_0058710 Ga0495640_0058710_1322_1864 149
320 3300046536 Ga0495587_0056697 Ga0495587_0056697_672_1214 149
321 3300046542 Ga0495597_0012545 Ga0495597_0012545_2194_2712 149
322 3300046558 Ga0495633_0047575 Ga0495633_0047575_140_655 149
323 3300046558 Ga0495633_0279821 Ga0495633_0279821_22_540 149
324 3300046615 Ga0495656_0068928 Ga0495656_0068928_1014_1529 149
325 3300046615 Ga0495656_0127804 Ga0495656_0127804_390_917 149
326 3300046616 Ga0495668_0003583 Ga0495668_0003583_10912_11439 149
327 3300046616 Ga0495668_0037863 Ga0495668_0037863_1880_2398 149
328 3300046648 Ga0495611_0003021 Ga0495611_0003021_6083_6610 149
329 3300046660 Ga0495625_0002190 Ga0495625_0002190_13530_14057 149
330 3300046660 Ga0495625_0075147 Ga0495625_0075147_443_961 149
331 3300046660 Ga0495625_0297746 Ga0495625_0297746_71_586 149
332 3300046663 Ga0495635_0035183 Ga0495635_0035183_401_943 149
333 3300046665 Ga0495661_0226546 Ga0495661_0226546_390_905 149
334 3300046674 Ga0495588_0033187 Ga0495588_0033187_1274_1816 149
335 3300046675 Ga0495657_0054655 Ga0495657_0054655_1377_1919 149
336 3300046690 Ga0495624_0056174 Ga0495624_0056174_1341_1883 149
337 3300046691 Ga0495670_0023596 Ga0495670_0023596_2207_2734 149
338 3300046691 Ga0495670_0054915 Ga0495670_0054915_688_1203 149
339 3300046691 Ga0495670_0460579 Ga0495670_0460579_84_602 149
340 3300046692 Ga0495671_0140042 Ga0495671_0140042_610_1137 149
341 3300046694 Ga0495649_0201381 Ga0495649_0201381_194_643 149
342 3300046694 Ga0495649_0359782 Ga0495649_0359782_62_589 149
343 3300046809 Ga0495600_0110988 Ga0495600_0110988_1001_1543 149
344 3300047317 Ga0495604_0065192 Ga0495604_0065192_1539_2081 149
345 3300047318 Ga0495636_0019889 Ga0495636_0019889_17_544 149
346 3300047319 Ga0495674_0491206 Ga0495674_0491206_423_965 149
347 3300047320 Ga0495672_0005896 Ga0495672_0005896_1637_2143 149
348 3300047443 Ga0495687_020307 Ga0495687_020307_2450_2968 149
349 3300047443 Ga0495687_102134 Ga0495687_102134_368_895 149
350 3300047446 Ga0495679_055582 Ga0495679_055582_314_832 149
351 3300047470 Ga0495681_0029736 Ga0495681_0029736_784_1299 149
352 3300047472 Ga0495686_0001073 Ga0495686_0001073_13189_13716 149
353 3300047472 Ga0495686_0005102 Ga0495686_0005102_5670_6188 149
354 3300047472 Ga0495686_0101949 Ga0495686_0101949_1185_1712 149
355 3300047472 Ga0495686_0217949 Ga0495686_0217949_613_1062 149
356 3300047472 Ga0495686_0306845 Ga0495686_0306845_53_502 149
357 3300047472 Ga0495686_0379424 Ga0495686_0379424_167_616 149
358 3300048091 Ga0495626_0023555 Ga0495626_0023555_381_899 149
359 3300048903 Ga0496100_0002352 Ga0496100_0002352_4379_4906 149
360 3300048905 Ga0496102_0005955 Ga0496102_0005955_1467_1994 149
361 3300048905 Ga0496102_0198688 Ga0496102_0198688_1224_1742 149
362 3300048906 Ga0496103_0001184 Ga0496103_0001184_7211_7738 149
363 3300048906 Ga0496103_1050657 Ga0496103_1050657_11_460 149
364 3300048907 Ga0496104_0799759 Ga0496104_0799759_192_710 149
365 3300048908 Ga0496105_0026425 Ga0496105_0026425_90_608 149
366 3300048909 Ga0496106_0000125 Ga0496106_0000125_56069_56596 149
367 3300048909 Ga0496106_0106628 Ga0496106_0106628_102_629 149
368 3300048909 Ga0496106_0856927 Ga0496106_0856927_51_569 149
369 3300048910 Ga0496107_0062984 Ga0496107_0062984_505_1032 149
370 3300048914 Ga0496111_0593016 Ga0496111_0593016_124_642 149
371 3300048916 Ga0496113_0016531 Ga0496113_0016531_4488_5015 149
372 3300048916 Ga0496113_0913338 Ga0496113_0913338_154_672 149
373 3300048917 Ga0496114_0075401 Ga0496114_0075401_777_1304 149
374 3300048917 Ga0496114_0175450 Ga0496114_0175450_913_1431 149
375 3300048919 Ga0496116_0005363 Ga0496116_0005363_9659_10186 149
376 3300048919 Ga0496116_0012915 Ga0496116_0012915_2058_2576 149
377 3300048919 Ga0496116_0028834 Ga0496116_0028834_115_624 149
378 3300048919 Ga0496116_0040914 Ga0496116_0040914_2057_2566 149
379 3300048919 Ga0496116_0061961 Ga0496116_0061961_1608_2135 149
380 3300048919 Ga0496116_0238011 Ga0496116_0238011_258_776 149
381 3300048920 Ga0496117_0002198 Ga0496117_0002198_13912_14439 149
382 3300048920 Ga0496117_0085495 Ga0496117_0085495_59_586 149
383 3300048920 Ga0496117_0122131 Ga0496117_0122131_576_1103 149
384 3300048921 Ga0496118_0002392 Ga0496118_0002392_13906_14433 149
385 3300048921 Ga0496118_0003857 Ga0496118_0003857_5010_5537 149
386 3300048921 Ga0496118_0092262 Ga0496118_0092262_32_559 149
387 3300048921 Ga0496118_0462469 Ga0496118_0462469_158_607 149
388 3300048922 Ga0496119_0004664 Ga0496119_0004664_9840_10367 149
389 3300048922 Ga0496119_0020340 Ga0496119_0020340_110_628 149
390 3300048922 Ga0496119_0046424 Ga0496119_0046424_806_1315 149
391 3300048922 Ga0496119_0074982 Ga0496119_0074982_1097_1615 149
392 3300048922 Ga0496119_0083065 Ga0496119_0083065_1239_1766 149
393 3300048922 Ga0496119_0104765 Ga0496119_0104765_569_1018 149
394 3300048923 Ga0496120_0004195 Ga0496120_0004195_9183_9710 149
395 3300048924 Ga0496121_0002775 Ga0496121_0002775_13402_13929 149
396 3300048924 Ga0496121_0031045 Ga0496121_0031045_1804_2253 149
397 3300048924 Ga0496121_0031418 Ga0496121_0031418_92_601 149
398 3300048924 Ga0496121_0033635 Ga0496121_0033635_690_1139 149
399 3300048924 Ga0496121_0072638 Ga0496121_0072638_471_989 149
400 3300048924 Ga0496121_0351628 Ga0496121_0351628_115_645 149
401 3300048924 Ga0496121_0366015 Ga0496121_0366015_131_649 149
402 3300048924 Ga0496121_0373303 Ga0496121_0373303_152_679 149
403 3300048924 Ga0496121_0631817 Ga0496121_0631817_71_589 149
404 3300048925 Ga0496122_0005990 Ga0496122_0005990_13301_13828 149
405 3300048925 Ga0496122_0007088 Ga0496122_0007088_8851_9378 149
406 3300048925 Ga0496122_0036840 Ga0496122_0036840_3384_3893 149
407 3300048925 Ga0496122_0125558 Ga0496122_0125558_107_625 149
408 3300048925 Ga0496122_0318512 Ga0496122_0318512_18_536 149
409 3300048926 Ga0496123_0003616 Ga0496123_0003616_7419_7946 149
410 3300048926 Ga0496123_0014496 Ga0496123_0014496_116_625 149
411 3300048926 Ga0496123_0032137 Ga0496123_0032137_871_1398 149
412 3300048926 Ga0496123_0117400 Ga0496123_0117400_86_604 149
413 3300048927 Ga0496124_0045320 Ga0496124_0045320_2532_3050 149
414 3300048927 Ga0496124_0059163 Ga0496124_0059163_270_797 149
415 3300048927 Ga0496124_0083422 Ga0496124_0083422_722_1240 149
416 3300048927 Ga0496124_0156837 Ga0496124_0156837_173_703 149
417 3300048927 Ga0496124_0253195 Ga0496124_0253195_532_981 149
418 3300048927 Ga0496124_0283813 Ga0496124_0283813_609_1118 149
419 3300048927 Ga0496124_0405590 Ga0496124_0405590_401_919 149
420 3300048928 Ga0496125_0003639 Ga0496125_0003639_13264_13791 149
421 3300048928 Ga0496125_0177067 Ga0496125_0177067_128_655 149
422 3300048928 Ga0496125_0325152 Ga0496125_0325152_386_835 149
423 3300048928 Ga0496125_0551548 Ga0496125_0551548_17_535 149
424 3300048929 Ga0496126_0019302 Ga0496126_0019302_2004_2522 149
425 3300048929 Ga0496126_0082458 Ga0496126_0082458_156_674 149
426 3300048929 Ga0496126_0187659 Ga0496126_0187659_657_1184 149
427 3300048929 Ga0496126_0255179 Ga0496126_0255179_89_619 149
428 3300048929 Ga0496126_0916269 Ga0496126_0916269_97_615 149
429 3300049459 Ga0495678_024147 Ga0495678_024147_1966_2472 149
430 3300049459 Ga0495678_052731 Ga0495678_052731_255_773 149
431 3300049459 Ga0495678_060738 Ga0495678_060738_832_1359 149
432 3300049569 Ga0501032_0034664 Ga0501032_0034664_2659_3186 149
433 3300049573 Ga0501037_0208924 Ga0501037_0208924_24_551 149
434 3300049580 Ga0501046_0450400 Ga0501046_0450400_31_558 149
435 3300049584 Ga0501068_0156585 Ga0501068_0156585_605_1132 149
436 3300049744 Ga0501083_0757769 Ga0501083_0757769_146_595 149
437 3300049823 Ga0501044_0174887 Ga0501044_0174887_284_811 149
438 3300050489 nmdc:mga03683_3800_c1 nmdc:mga03683_3800_c1_1609_2136 149
439 3300050490 nmdc:mga03n38_100619_c1 nmdc:mga03n38_100619_c1_479_997 149
440 3300050490 nmdc:mga03n38_242829_c1 nmdc:mga03n38_242829_c1_181_699 149
441 3300050491 nmdc:mga00v17_141911_c2 nmdc:mga00v17_141911_c2_75_602 149
442 3300050492 nmdc:mga0yw44_575629_c1 nmdc:mga0yw44_575629_c1_11_529 149
443 3300050496 nmdc:mga07m45_390974_c1 nmdc:mga07m45_390974_c1_124_642 149
444 3300050496 nmdc:mga07m45_430618_c1 nmdc:mga07m45_430618_c1_160_687 149
445 3300053079 Ga0500610_0005661 Ga0500610_0005661_475_1002 149
446 3300053083 Ga0495655_0122991 Ga0495655_0122991_54_572 149
447 3300053086 Ga0500578_0069068 Ga0500578_0069068_1203_1721 149
448 3300053093 Ga0500651_0176445 Ga0500651_0176445_136_663 149
449 3300053105 Ga0500557_000494 Ga0500557_000494_2453_2980 149
450 3300053109 Ga0500569_003626 Ga0500569_003626_2421_2948 149
451 3300053109 Ga0500569_044354 Ga0500569_044354_248_766 149
452 3300053118 Ga0500594_0000222 Ga0500594_0000222_3721_4248 149
453 3300053122 Ga0500608_008336 Ga0500608_008336_3570_4088 149
454 3300053125 Ga0500618_004170 Ga0500618_004170_3790_4308 149
455 3300053125 Ga0500618_012936 Ga0500618_012936_40_558 149
456 3300053125 Ga0500618_036631 Ga0500618_036631_157_660 149
457 3300053134 Ga0500658_0002500 Ga0500658_0002500_1647_2174 149
458 3300053134 Ga0500658_0007286 Ga0500658_0007286_2230_2748 149
459 3300053139 Ga0500568_0000846 Ga0500568_0000846_13524_14030 149
460 3300053139 Ga0500568_0003503 Ga0500568_0003503_6669_7196 149
461 3300053148 Ga0500590_000249 Ga0500590_000249_7467_8009 149
462 3300053151 Ga0500604_0295956 Ga0500604_0295956_18_545 149
463 3300053153 Ga0500616_0006239 Ga0500616_0006239_3844_4350 149
464 3300053153 Ga0500616_0008579 Ga0500616_0008579_1308_1835 149
465 3300053156 Ga0500622_0242031 Ga0500622_0242031_52_579 149
466 3300053158 Ga0500627_0056756 Ga0500627_0056756_451_978 149
467 3300053160 Ga0500633_0020653 Ga0500633_0020653_1218_1745 149
468 3300053160 Ga0500633_0103457 Ga0500633_0103457_204_731 149
469 3300053162 Ga0500638_231715 Ga0500638_231715_180_722 149
470 3300053177 Ga0500636_0067338 Ga0500636_0067338_671_1213 149
471 3300053730 Ga0500645_006761 Ga0500645_006761_2948_3454 149
472 3300061719 Ga0466962_0188569 Ga0466962_0188569_88_615 149
473 iso_pu_bacteria 2509276021 2509386687 149
474 iso_pu_bacteria 2509276033 2509443258 149
475 iso_pu_bacteria 2510065019 2510133309 149
476 iso_pu_bacteria 2510917022 2511135114 149
477 iso_pu_bacteria 2510917028 2511183335 149
478 iso_pu_bacteria 2513237084 2513572502 149
479 iso_pu_bacteria 2513237085 2513577277 149
480 iso_pu_bacteria 2513237088 2513594586 149
481 iso_pu_bacteria 2513237103 2513708734 149
482 iso_pu_bacteria 2513237138 2513864644 149
483 iso_pu_bacteria 2513237144 2513912416 149
484 iso_pu_bacteria 2513237146 2513926223 149
485 iso_pu_bacteria 2515075009 2515112269 149
486 iso_pu_bacteria 2515154113 2515637569 149
487 iso_pu_bacteria 2515154114 2515639769 149
488 iso_pu_bacteria 2515154134 2515738581 149
489 iso_pu_bacteria 2516653077 2517036001 149
490 iso_pu_bacteria 2516653085 2517076394 149
491 iso_pu_bacteria 2517093000 2517095152 149
492 iso_pu_bacteria 2519899620 2520375990 149
493 iso_pu_bacteria 2524023209 2524460277 149
494 iso_pu_bacteria 2529292951 2530645524 149
495 iso_pu_bacteria 2534681796 2535516497 149
496 iso_pu_bacteria 2582581294 2585200164 149
497 iso_pu_bacteria 2582581299 2585229986 149
498 iso_pu_bacteria 2582581307 2585270854 149
499 iso_pu_bacteria 2582581308 2585277204 149
500 iso_pu_bacteria 2582581315 2585323787 149
501 iso_pu_bacteria 2582581316 2585331766 149
502 iso_pu_bacteria 2582581867 2585402011 149
503 iso_pu_bacteria 2585427526 2585527636 149
504 iso_pu_bacteria 2585427527 2585534060 149
505 iso_pu_bacteria 2585427528 2585537536 149
506 iso_pu_bacteria 2585427530 2585552089 149
507 iso_pu_bacteria 2585427531 2585558578 149
508 iso_pu_bacteria 2585427590 2585821796 149
509 iso_pu_bacteria 2585427593 2585835486 149
510 iso_pu_bacteria 2585427594 2585846739 149
511 iso_pu_bacteria 2585427608 2585897942 149
512 iso_pu_bacteria 2585427609 2585904453 149
513 iso_pu_bacteria 2585428125 2587980430 149
514 iso_pu_bacteria 2599185170 2599417701 149
515 iso_pu_bacteria 2615840624 2616292461 149
516 iso_pu_bacteria 2615840626 2616308582 149
517 iso_pu_bacteria 2615840698 2616557114 149
518 iso_pu_bacteria 2617270742 2617385665 149
519 iso_pu_bacteria 2643221599 2644003769 149
520 iso_pu_bacteria 2643221634 2644192768 149
521 iso_pu_bacteria 2667528174 2671111714 149
522 iso_pu_bacteria 2718217882 2719181181 149
523 iso_pu_bacteria 2718217927 2719385783 149
524 iso_pu_bacteria 2718218009 2719731930 149
525 iso_pu_bacteria 2718218363 2721147275 149
526 iso_pu_bacteria 2718218365 2721158808 149
527 iso_pu_bacteria 2718218366 2721164193 149
528 iso_pu_bacteria 2718218423 2721399563 149
529 iso_pu_bacteria 2721755514 2722840363 149
530 iso_pu_bacteria 2721755809 2724038376 149
531 iso_pu_bacteria 2721755810 2724044686 149
532 iso_pu_bacteria 2721755823 2724110194 149
533 iso_pu_bacteria 2724679232 2725950649 149
534 iso_pu_bacteria 2728369365 2730164418 149
535 iso_pu_bacteria 2728369397 2730298440 149
536 iso_pu_bacteria 2738541333 2739036498 149
537 iso_pu_bacteria 2765235942 2766063165 149
538 iso_pu_bacteria 2775507266 2778174019 149
539 iso_pu_bacteria 2791355256 2793294669 149
540 iso_pu_bacteria 2791355259 2793312250 149
541 iso_pu_bacteria 2791355260 2793322021 149
542 iso_pu_bacteria 2791355261 2793326659 149
543 iso_pu_bacteria 2791355262 2793335736 149
544 iso_pu_bacteria 2791355263 2793341516 149
545 iso_pu_bacteria 2791355264 2793349077 149
546 iso_pu_bacteria 2791355265 2793353071 149
547 iso_pu_bacteria 2791355266 2793361174 149
548 iso_pu_bacteria 2791355267 2793369264 149
549 iso_pu_bacteria 2802429605 2805925702 149
550 iso_pu_bacteria 2802429606 2805933573 149
551 iso_pu_bacteria 2802429633 2806046048 149
552 iso_pu_bacteria 2802429634 2806054427 149
553 iso_pu_bacteria 2802429635 2806060432 149
554 iso_pu_bacteria 2802429636 2806065110 149
555 iso_pu_bacteria 2802429637 2806072375 149
556 iso_pu_bacteria 2818991448 2819612794 149
557 iso_pu_bacteria 2818991453 2819637907 149
558 iso_pu_bacteria 2837651117 2837653606 149
559 iso_pu_bacteria 2838016132 2838021476 149
560 iso_pu_bacteria 2838022645 2838027868 149
561 iso_pu_bacteria 2838029111 2838030089 149
562 iso_pu_bacteria 2838035591 2838038086 149
563 iso_pu_bacteria 2838042994 2838043434 149
564 iso_pu_bacteria 2838661181 2838667227 149
565 iso_pu_bacteria 2838668709 2838672033 149
566 iso_pu_bacteria 2838680041 2838682218 149
567 iso_pu_bacteria 2838686498 2838689489 149
568 iso_pu_bacteria 2838694306 2838696789 149
569 iso_pu_bacteria 2838701080 2838704687 149
570 iso_pu_bacteria 2838707686 2838709971 149
571 iso_pu_bacteria 2838729681 2838730822 149
572 iso_pu_bacteria 2838742623 2838743763 149
573 iso_pu_bacteria 2841851746 2841857839 149
574 iso_pu_bacteria 2842077413 2842078144 149
575 iso_pu_bacteria 2842110456 2842110502 149
576 iso_pu_bacteria 2842118031 2842119347 149
577 iso_pu_bacteria 2842146304 2842148573 149
578 iso_pu_bacteria 2842156927 2842157424 149
579 iso_pu_bacteria 2842163707 2842164615 149
580 iso_pu_bacteria 2842180545 2842180991 149
581 iso_pu_bacteria 2842192696 2842194514 149
582 iso_pu_bacteria 2842198810 2842203816 149
583 iso_pu_bacteria 2842205361 2842206045 149
584 iso_pu_bacteria 2842217011 2842217225 149
585 iso_pu_bacteria 2842229732 2842230950 149
586 iso_pu_bacteria 2842237096 2842239383 149
587 iso_pu_bacteria 2842243621 2842244942 149
588 iso_pu_bacteria 2842250916 2842254367 149
589 iso_pu_bacteria 2842257432 2842258755 149
590 iso_pu_bacteria 2842264693 2842266052 149
591 iso_pu_bacteria 2842271015 2842273509 149
592 iso_pu_bacteria 2842278818 2842279502 149
593 iso_pu_bacteria 2842285085 2842286148 149
594 iso_pu_bacteria 2842291075 2842291807 149
595 iso_pu_bacteria 2842298080 2842302041 149
596 iso_pu_bacteria 2842304105 2842304286 149
597 iso_pu_bacteria 2842317721 2842317911 149
598 iso_pu_bacteria 2842341865 2842345844 149
599 iso_pu_bacteria 2842357229 2842357492 149
600 iso_pu_bacteria 2842363717 2842364525 149
601 iso_pu_bacteria 2842370503 2842372784 149
602 iso_pu_bacteria 2842377471 2842378203 149
603 iso_pu_bacteria 2842384541 2842385856 149
604 iso_pu_bacteria 2842395702 2842401862 149
605 iso_pu_bacteria 2842402390 2842403508 149
606 iso_pu_bacteria 2842409023 2842409119 149
607 iso_pu_bacteria 2842415677 2842415773 149
608 iso_pu_bacteria 2842428310 2842429311 149
609 iso_pu_bacteria 2842434925 2842435924 149
610 iso_pu_bacteria 2842441272 2842442271 149
611 iso_pu_bacteria 2842462802 2842463732 149
612 iso_pu_bacteria 2842469257 2842470253 149
613 iso_pu_bacteria 2842475841 2842476626 149
614 iso_pu_bacteria 2842482326 2842484834 149
615 iso_pu_bacteria 2842489311 2842490019 149
616 iso_pu_bacteria 2842495871 2842496181 149
617 iso_pu_bacteria 2842502639 2842503617 149
618 iso_pu_bacteria 2842509118 2842511434 149
619 iso_pu_bacteria 2844454524 2844459170 149
620 iso_pu_bacteria 2852387548 2852389901 149
621 iso_pu_bacteria 2857516855 2857518711 149
622 iso_pu_bacteria 2919408235 2919411687 149
623 iso_pu_bacteria 2923556063 2923557929 149
624 iso_pu_bacteria 2933570622 2933571562 149
625 iso_pu_bacteria 2933586486 2933586531 149
626 iso_pu_bacteria 2935894831 2935897355 149
627 iso_pu_bacteria 2935901341 2935904735 149
628 iso_pu_bacteria 2936367885 2936372710 149
629 iso_pu_bacteria 2936375103 2936378563 149
630 iso_pu_bacteria 2936381700 2936384985 149
631 iso_pu_bacteria 2996887358 2996891699 149
632 iso_pu_bacteria 2996893221 2996894170 149
633 iso_pu_bacteria 3005409236 3005415146 149
634 iso_pu_bacteria 3005416602 3005420104 149
635 iso_pu_bacteria 3005452660 3005454219 149
636 iso_pu_bacteria 639633055 639648525 149
637 iso_pu_bacteria 8005258706 8005263029 149
638 iso_pu_bacteria 8005275841 8005280560 149
639 iso_pu_bacteria 8005289223 8005290263 149
640 iso_pu_bacteria 8005301065 8005302556 149
641 iso_pu_bacteria 8005307578 8005311200 149
642 iso_pu_bacteria 8005314921 8005317055 149
643 iso_pu_bacteria 8005321885 8005326226 149
644 iso_pu_bacteria 8005376324 8005379207 149
645 iso_pu_bacteria 8005382845 8005388320 149
646 iso_pu_bacteria 8005395548 8005397152 149
647 iso_pu_bacteria 8005430974 8005432127 149
648 iso_pu_bacteria 8005460587 8005462931 149
649 iso_pu_bacteria 8005484373 8005485150 149
650 iso_pu_bacteria 8005542996 8005545147 149
651 iso_pu_bacteria 8005556819 8005557725 149
652 iso_pu_bacteria 8005563573 8005568897 149
653 iso_pu_bacteria 8005570704 8005570808 149
654 iso_pu_bacteria 8005619151 8005621702 149
655 iso_pu_bacteria 8005645114 8005645313 149
656 iso_pu_bacteria 8005682033 8005683186 149
657 iso_pu_bacteria 8005688590 8005694569 149
658 iso_pu_bacteria 8005695170 8005700030 149
659 iso_pu_bacteria 8018127388 8018129911 149
660 iso_pu_bacteria 8018163183 8018166811 149
661 iso_pu_bacteria 8018176218 8018179843 149
662 iso_pu_bacteria 8023680758 8023685398 149
663 iso_pu_bacteria 8024479707 8024483552 149
664 iso_pu_bacteria 8024486573 8024492263 149
665 iso_pu_bacteria 8024501048 8024506602 149
666 iso_pu_bacteria 8046767195 8046773791 149
667 iso_pu_bacteria 8056375014 8056376616 149
668 iso_pu_bacteria 8056382006 8056387827 149
669 iso_pu_bacteria 8056875544 8056877535 149
670 iso_pu_bacteria 8057575449 8057576835 149
671 iso_pu_bacteria 8057874678 8057875075 149

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01288

HPPK

7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)

4

132

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ru1-assembly1.cif.gz_A crystal structure of a ternary complex of e. coli hppk(v83g/del84-89) with mgampcpp and 6-hydroxymethyl-7,8-dihydropterin at 1.40 angstrom resolution (monoclinic form) 0.944 4 130
2cg8-assembly1.cif.gz_D-2 the bifunctional dihydroneopterin aldolase 6-hydroxymethyl-7,8- dihydropterin synthase from streptococcus pneumoniae 0.942 3 129
6an4-assembly1.cif.gz_A crystal structure of escherichia coli hppk in complex with bisubstrate analogue inhibitor hp-39 (j1f) 0.9419 4 130
3hsg-assembly1.cif.gz_A crystal structure of e. coli hppk(y53a) in complex with mgampcpp 0.9386 3 130
2cg8-assembly1.cif.gz_B-2 the bifunctional dihydroneopterin aldolase 6-hydroxymethyl-7,8- dihydropterin synthase from streptococcus pneumoniae 0.9321 3 129
ID Description Score Start End Superfamily
2cg8A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.9304 3 128 3.30.70.560
3mcmB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.8994 3 136 3.30.70.560
af_Q4LB35_295_465_3.30.70.560 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.8977 4 138 3.30.70.560
af_Q54YD9_144_293_3.30.70.560 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.893 2 130 3.30.70.560
4cyuA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.8819 4 138 3.30.70.560
ID Description Score Start End GO Terms
AF-A0A6S6N7D3-F1-model_v4 deleted 0.963 1 149
AF-A0A1M6JUQ0-F1-model_v4 deleted 0.962 1 146
AF-A0A7Z7YSH0-F1-model_v4 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC 2.7.6.3) 0.9594 4 127 GO:0003848
GO:0005524
GO:0016301
GO:0046654
GO:0046656
AF-A0A657LQ54-F1-model_v4 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC 2.7.6.3) (6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase) (7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase) 0.9587 1 148 GO:0003848
GO:0005524
GO:0016301
GO:0046654
GO:0046656
AF-A0A7W3ZGZ2-F1-model_v4 deleted 0.9581 1 149

Feature Viewer

pLDDT pTM Quality
91.66 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map