F474107

General Info

Members Datasets Scaffolds Average Seq Length
670 247 1340 116

Family's Representative Sequence

Representative Sequence 3300046462|Ga0495651_0702600|Ga0495651_0702600_238_606
Length 122
Sequence MVKSRLARTRRGITSLGCLFSILVVAAIVYFGVTIGEHYFRFYQYQDSIRQEVRFAAHNNDSQITKHLRERADSLGLPEAAGEVTIQRDGRHIEIESEYYEHIELPMFVREVRFNPHGEGIY

Samples

Sample ID Description Type Environment
1 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
181 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
182 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
188 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
189 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
190 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
191 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
196 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
197 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
198 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
199 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
200 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
201 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
202 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
203 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
204 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
205 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
206 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
207 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
208 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
209 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
210 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
211 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
212 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
213 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
231 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
232 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
233 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
245 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
246 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.13
Rhizosphere 96.72
Stem 0
Stem Tuber 0
Unclassified 22.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495651_0702600 3300046462 Unclassified 630
2 JGI24746J21847_1038012 3300001977 Bacteria 667
3 JGI24750J21931_1026670 3300002070 Unclassified 833
4 rootH1_10311610 3300003323 Bacteria 1072
5 Ga0065704_10156912 3300005289 Bacteria 1379
6 Ga0065712_10163174 3300005290 Bacteria 1289
7 Ga0065712_10182711 3300005290 Bacteria 1184
8 Ga0065712_10184856 3300005290 Bacteria 1175
9 Ga0065715_10131723 3300005293 Bacteria 2003
10 Ga0065707_10119256 3300005295 Bacteria 2164
11 Ga0065707_10184632 3300005295 Bacteria 1394
12 Ga0070658_10018457 3300005327 Bacteria 5585
13 Ga0070658_10105955 3300005327 Bacteria 2326
14 Ga0070658_10420231 3300005327 Bacteria 1150
15 Ga0070658_10445103 3300005327 Bacteria 1116
16 Ga0070658_10826204 3300005327 Bacteria 805
17 Ga0070658_11377767 3300005327 Bacteria 612
18 Ga0070676_10005185 3300005328 Bacteria 6920
19 Ga0070676_10103755 3300005328 Bacteria 1761
20 Ga0070676_11477814 3300005328 Bacteria 523
21 Ga0070683_100009488 3300005329 Bacteria 8326
22 Ga0070683_100039114 3300005329 Bacteria 4352
23 Ga0070683_100040960 3300005329 Unclassified 4260
24 Ga0070683_100070117 3300005329 Bacteria 3269
25 Ga0070683_100509466 3300005329 Bacteria 1150
26 Ga0070683_100525630 3300005329 Unclassified 1131
27 Ga0070683_100665435 3300005329 Bacteria 997
28 Ga0070690_100279691 3300005330 Bacteria 1190
29 Ga0070670_100026513 3300005331 Bacteria 4985
30 Ga0070670_100084609 3300005331 Bacteria 2725
31 Ga0070670_100183700 3300005331 Bacteria 1816
32 Ga0070670_100355663 3300005331 Bacteria 1287
33 Ga0070670_100573048 3300005331 Unclassified 1008
34 Ga0070670_101123979 3300005331 Unclassified 717
35 Ga0070670_101241675 3300005331 Unclassified 681
36 Ga0070670_101257420 3300005331 Bacteria 677
37 Ga0070670_101269706 3300005331 Bacteria 674
38 Ga0070677_10553241 3300005333 Bacteria 631
39 Ga0068869_100004173 3300005334 Bacteria 8963
40 Ga0068869_100866052 3300005334 Unclassified 780
41 Ga0068869_101089192 3300005334 Unclassified 699
42 Ga0070680_100009974 3300005336 Bacteria 7316
43 Ga0070680_100053796 3300005336 Bacteria 3285
44 Ga0070680_100058590 3300005336 Bacteria 3150
45 Ga0070680_100575661 3300005336 Bacteria 966
46 Ga0070682_100038161 3300005337 Bacteria 2945
47 Ga0068868_100054563 3300005338 Bacteria 3150
48 Ga0070660_100034216 3300005339 Unclassified 3837
49 Ga0070660_100091742 3300005339 Bacteria 2396
50 Ga0070660_100159283 3300005339 Bacteria 1818
51 Ga0070660_100277095 3300005339 Bacteria 1372
52 Ga0070660_100670032 3300005339 Bacteria 869
53 Ga0070689_100007619 3300005340 Bacteria 7580
54 Ga0070689_100072530 3300005340 Bacteria 2691
55 Ga0070689_100439853 3300005340 Bacteria 1108
56 Ga0070689_100906390 3300005340 Unclassified 780
57 Ga0070687_100011987 3300005343 Bacteria 3812
58 Ga0070687_100017325 3300005343 Bacteria 3309
59 Ga0070687_100299826 3300005343 Bacteria 1019
60 Ga0070661_100000761 3300005344 Bacteria 23231
61 Ga0070661_100006089 3300005344 Bacteria 8301
62 Ga0070661_100048646 3300005344 Bacteria 3104
63 Ga0070661_100133369 3300005344 Bacteria 1867
64 Ga0070661_100389049 3300005344 Bacteria 1101
65 Ga0070661_100909128 3300005344 Bacteria 727
66 Ga0070661_101052535 3300005344 Bacteria 676
67 Ga0070661_101827680 3300005344 Bacteria 516
68 Ga0070668_100003223 3300005347 Bacteria 12024
69 Ga0070668_100009423 3300005347 Bacteria 7244
70 Ga0070668_100051948 3300005347 Unclassified 3159
71 Ga0070668_100256089 3300005347 Bacteria 1454
72 Ga0070668_100539931 3300005347 Unclassified 1014
73 Ga0070668_101243093 3300005347 Unclassified 676
74 Ga0070669_100006514 3300005353 Bacteria 8409
75 Ga0070669_100010971 3300005353 Bacteria 6430
76 Ga0070669_100016431 3300005353 Bacteria 5280
77 Ga0070675_100001278 3300005354 Bacteria 18388
78 Ga0070675_100014819 3300005354 Bacteria 6152
79 Ga0070675_100025852 3300005354 Bacteria 4707
80 Ga0070675_100257887 3300005354 Bacteria 1527
81 Ga0070675_100332647 3300005354 Bacteria 1344
82 Ga0070675_100968669 3300005354 Unclassified 781
83 Ga0070671_100047870 3300005355 Bacteria 3554
84 Ga0070671_100064296 3300005355 Bacteria 3056
85 Ga0070671_100085700 3300005355 Bacteria 2636
86 Ga0070671_100239082 3300005355 Bacteria 1542
87 Ga0070671_100423024 3300005355 Unclassified 1141
88 Ga0070671_100770347 3300005355 Bacteria 837
89 Ga0070674_100026369 3300005356 Bacteria 3795
90 Ga0070674_100027876 3300005356 Bacteria 3704
91 Ga0070674_100085808 3300005356 Bacteria 2260
92 Ga0070674_100113595 3300005356 Bacteria 1993
93 Ga0070674_100119805 3300005356 Bacteria 1947
94 Ga0070674_100236626 3300005356 Bacteria 1427
95 Ga0070674_100940294 3300005356 Unclassified 755
96 Ga0070673_100017292 3300005364 Bacteria 5122
97 Ga0070673_100083492 3300005364 Bacteria 2595
98 Ga0070673_100191556 3300005364 Bacteria 1757
99 Ga0070673_100329399 3300005364 Bacteria 1351
100 Ga0070673_100703971 3300005364 Unclassified 928
101 Ga0070673_100812868 3300005364 Unclassified 864
102 Ga0070688_100024964 3300005365 Bacteria 3533
103 Ga0070688_100165452 3300005365 Bacteria 1522
104 Ga0070688_100844128 3300005365 Bacteria 719
105 Ga0070688_101279729 3300005365 Bacteria 591
106 Ga0070659_100015355 3300005366 Bacteria 5735
107 Ga0070659_100060258 3300005366 Bacteria 2998
108 Ga0070659_100105383 3300005366 Bacteria 2272
109 Ga0070659_100177707 3300005366 Bacteria 1746
110 Ga0070659_100224863 3300005366 Bacteria 1550
111 Ga0070659_100225512 3300005366 Bacteria 1548
112 Ga0070659_100231630 3300005366 Bacteria 1527
113 Ga0070659_100926130 3300005366 Bacteria 762
114 Ga0070667_100016807 3300005367 Bacteria 6053
115 Ga0070667_100050853 3300005367 Bacteria 3493
116 Ga0070667_100092180 3300005367 Bacteria 2606
117 Ga0070667_101233163 3300005367 Bacteria 700
118 Ga0070667_101554104 3300005367 Unclassified 622
119 Ga0070714_100063791 3300005435 Bacteria 3169
120 Ga0070713_100354803 3300005436 Bacteria 1361
121 Ga0070713_100447597 3300005436 Bacteria 1213
122 Ga0070710_10184862 3300005437 Bacteria 1307
123 Ga0070710_10646804 3300005437 Unclassified 741
124 Ga0070701_10383444 3300005438 Bacteria 886
125 Ga0070711_100031915 3300005439 Bacteria 3499
126 Ga0070711_100548044 3300005439 Bacteria 959
127 Ga0070711_101933296 3300005439 Unclassified 518
128 Ga0070700_100581301 3300005441 Bacteria 875
129 Ga0070694_100084854 3300005444 Bacteria 2210
130 Ga0070694_101611426 3300005444 Unclassified 551
131 Ga0070663_100014995 3300005455 Bacteria 4986
132 Ga0070678_100309545 3300005456 Bacteria 1345
133 Ga0070678_100358992 3300005456 Bacteria 1255
134 Ga0070678_100615730 3300005456 Unclassified 971
135 Ga0070678_100847041 3300005456 Unclassified 833
136 Ga0070678_102151167 3300005456 Unclassified 529
137 Ga0070662_100001376 3300005457 Bacteria 14957
138 Ga0070662_100030011 3300005457 Bacteria 3800
139 Ga0070662_101852139 3300005457 Unclassified 521
140 Ga0070681_10008916 3300005458 Bacteria 9858
141 Ga0070681_10055379 3300005458 Bacteria 3948
142 Ga0070681_10883902 3300005458 Bacteria 812
143 Ga0068867_100053208 3300005459 Unclassified 2990
144 Ga0068867_100211542 3300005459 Bacteria 1558
145 Ga0070685_10061054 3300005466 Bacteria 2206
146 Ga0070685_10064914 3300005466 Bacteria 2148
147 Ga0070698_100436222 3300005471 Bacteria 1245
148 Ga0070699_100137228 3300005518 Bacteria 2158
149 Ga0070679_100004790 3300005530 Bacteria 12482
150 Ga0070679_100017822 3300005530 Bacteria 6877
151 Ga0070679_100130827 3300005530 Bacteria 2491
152 Ga0070679_100673511 3300005530 Unclassified 977
153 Ga0070684_100033995 3300005535 Bacteria 4356
154 Ga0070684_100045344 3300005535 Bacteria 3807
155 Ga0070684_100510941 3300005535 Unclassified 1113
156 Ga0070684_100625419 3300005535 Bacteria 1002
157 Ga0070684_100885385 3300005535 Bacteria 836
158 Ga0070684_101563855 3300005535 Unclassified 622
159 Ga0068853_100021924 3300005539 Bacteria 5328
160 Ga0068853_100182248 3300005539 Bacteria 1905
161 Ga0068853_100663459 3300005539 Unclassified 993
162 Ga0068853_101141226 3300005539 Unclassified 752
163 Ga0068853_101150568 3300005539 Bacteria 749
164 Ga0070672_100007221 3300005543 Bacteria 7524
165 Ga0070672_100020662 3300005543 Bacteria 4805
166 Ga0070672_100041180 3300005543 Bacteria 3550
167 Ga0070672_100045186 3300005543 Bacteria 3405
168 Ga0070672_100058517 3300005543 Bacteria 3029
169 Ga0070672_100295361 3300005543 Unclassified 1372
170 Ga0070672_100392391 3300005543 Bacteria 1189
171 Ga0070686_100147463 3300005544 Bacteria 1644
172 Ga0070693_100394625 3300005547 Bacteria 958
173 Ga0070665_100056662 3300005548 Bacteria 3929
174 Ga0070665_100903636 3300005548 Unclassified 896
175 Ga0070665_101420991 3300005548 Unclassified 703
176 Ga0070704_100488875 3300005549 Unclassified 1066
177 Ga0068855_100155804 3300005563 Bacteria 2595
178 Ga0068855_101535556 3300005563 Unclassified 683
179 Ga0070664_100011578 3300005564 Bacteria 7156
180 Ga0070664_100011616 3300005564 Bacteria 7145
181 Ga0070664_100014695 3300005564 Bacteria 6392
182 Ga0070664_100047380 3300005564 Bacteria 3631
183 Ga0070664_100055595 3300005564 Bacteria 3361
184 Ga0070664_100075905 3300005564 Unclassified 2887
185 Ga0070664_100289495 3300005564 Bacteria 1478
186 Ga0070664_100323110 3300005564 Unclassified 1399
187 Ga0070664_100384467 3300005564 Bacteria 1282
188 Ga0070664_101694860 3300005564 Unclassified 599
189 Ga0068857_100007776 3300005577 Bacteria 9238
190 Ga0068857_100028401 3300005577 Bacteria 4937
191 Ga0068857_100120661 3300005577 Bacteria 2360
192 Ga0068857_100181818 3300005577 Bacteria 1914
193 Ga0068857_100317333 3300005577 Bacteria 1439
194 Ga0068854_100127209 3300005578 Bacteria 1942
195 Ga0068854_100615575 3300005578 Unclassified 929
196 Ga0068856_100136419 3300005614 Bacteria 2459
197 Ga0068856_100464764 3300005614 Bacteria 1286
198 Ga0068856_100486600 3300005614 Bacteria 1255
199 Ga0068856_102667862 3300005614 Unclassified 505
200 Ga0070702_100371183 3300005615 Unclassified 1014
201 Ga0068852_100002352 3300005616 Bacteria 13021
202 Ga0068852_100176334 3300005616 Unclassified 2007
203 Ga0068852_100466942 3300005616 Bacteria 1252
204 Ga0068852_100711850 3300005616 Unclassified 1015
205 Ga0068852_100944431 3300005616 Bacteria 880
206 Ga0068852_101611334 3300005616 Bacteria 672
207 Ga0068852_101739573 3300005616 Bacteria 646
208 Ga0068859_100014944 3300005617 Bacteria 7793
209 Ga0068859_100029406 3300005617 Bacteria 5512
210 Ga0068864_100022668 3300005618 Bacteria 5266
211 Ga0068864_100186082 3300005618 Bacteria 1901
212 Ga0068864_100296866 3300005618 Bacteria 1512
213 Ga0068864_100297983 3300005618 Bacteria 1509
214 Ga0068864_100548322 3300005618 Bacteria 1117
215 Ga0068864_101851701 3300005618 Unclassified 609
216 Ga0068866_10022921 3300005718 Bacteria 2897
217 Ga0068861_100001161 3300005719 Bacteria 16407
218 Ga0068851_10008967 3300005834 Bacteria 4640
219 Ga0068851_10041235 3300005834 Bacteria 2321
220 Ga0068851_10245329 3300005834 Bacteria 1014
221 Ga0068870_10010220 3300005840 Bacteria 4301
222 Ga0068870_10068496 3300005840 Bacteria 1928
223 Ga0068870_10145216 3300005840 Bacteria 1392
224 Ga0068863_100018470 3300005841 Bacteria 6673
225 Ga0068863_100321574 3300005841 Bacteria 1503
226 Ga0068863_100434448 3300005841 Unclassified 1287
227 Ga0068863_100610514 3300005841 Bacteria 1080
228 Ga0068863_101307119 3300005841 Bacteria 732
229 Ga0068863_101498268 3300005841 Bacteria 683
230 Ga0068858_100059514 3300005842 Bacteria 3530
231 Ga0068858_100084658 3300005842 Bacteria 2949
232 Ga0068858_100120321 3300005842 Bacteria 2455
233 Ga0068858_101813154 3300005842 Unclassified 603
234 Ga0068860_100015544 3300005843 Bacteria 7432
235 Ga0068860_100439580 3300005843 Bacteria 1295
236 Ga0068860_101507743 3300005843 Bacteria 694
237 Ga0068862_100004345 3300005844 Bacteria 11998
238 Ga0068862_100024430 3300005844 Bacteria 5071
239 Ga0068862_101468188 3300005844 Bacteria 687
240 Ga0070712_100258683 3300006175 Bacteria 1394
241 Ga0070712_100283048 3300006175 Bacteria 1336
242 Ga0097621_100062353 3300006237 Bacteria 3061
243 Ga0097621_100201451 3300006237 Bacteria 1728
244 Ga0068871_100620729 3300006358 Bacteria 984
245 Ga0075428_100008077 3300006844 Bacteria 11686
246 Ga0075428_100097642 3300006844 Bacteria 3203
247 Ga0075428_100201921 3300006844 Bacteria 2149
248 Ga0075430_100004875 3300006846 Bacteria 11293
249 Ga0075430_100019852 3300006846 Bacteria 5716
250 Ga0075430_100024176 3300006846 Bacteria 5173
251 Ga0075430_100040149 3300006846 Bacteria 3962
252 Ga0075431_100028415 3300006847 Bacteria 5747
253 Ga0075431_100046489 3300006847 Bacteria 4476
254 Ga0075433_10007366 3300006852 Bacteria 8732
255 Ga0075433_10052694 3300006852 Bacteria 3546
256 Ga0075433_10061105 3300006852 Bacteria 3300
257 Ga0075434_100016561 3300006871 Bacteria 7089
258 Ga0075434_100021483 3300006871 Bacteria 6273
259 Ga0075434_100480644 3300006871 Bacteria 1263
260 Ga0075434_100917991 3300006871 Unclassified 890
261 Ga0075429_100395171 3300006880 Unclassified 1211
262 Ga0068865_100011921 3300006881 Bacteria 5457
263 Ga0068865_100015769 3300006881 Bacteria 4821
264 Ga0068865_100590782 3300006881 Bacteria 937
265 Ga0068865_101668322 3300006881 Bacteria 574
266 Ga0097620_100014944 3300006931 Bacteria 7793
267 Ga0097620_100029406 3300006931 Bacteria 5512
268 Ga0075435_101857555 3300007076 Unclassified 529
269 Ga0099794_10406795 3300007265 Bacteria 711
270 Ga0105240_12416034 3300009093 Unclassified 544
271 Ga0111539_10043018 3300009094 Bacteria 5419
272 Ga0111539_10064753 3300009094 Bacteria 4323
273 Ga0111539_13088778 3300009094 Unclassified 537
274 Ga0105245_10206723 3300009098 Bacteria 1888
275 Ga0105245_10309874 3300009098 Bacteria 1552
276 Ga0114129_10027780 3300009147 Bacteria 8012
277 Ga0114129_10478876 3300009147 Unclassified 1629
278 Ga0114129_10742613 3300009147 Unclassified 1257
279 Ga0105243_13043683 3300009148 Bacteria 508
280 Ga0105242_10008278 3300009176 Bacteria 7990
281 Ga0105242_10073848 3300009176 Bacteria 2836
282 Ga0105242_10916790 3300009176 Bacteria 878
283 Ga0105248_10014552 3300009177 Bacteria 8660
284 Ga0105248_10034815 3300009177 Bacteria 5635
285 Ga0105248_10051416 3300009177 Bacteria 4623
286 Ga0105248_10133058 3300009177 Unclassified 2806
287 Ga0105248_10372957 3300009177 Bacteria 1607
288 Ga0105248_10401663 3300009177 Bacteria 1543
289 Ga0105248_10434704 3300009177 Unclassified 1478
290 Ga0105249_10002680 3300009553 Bacteria 15399
291 Ga0105249_10014896 3300009553 Bacteria 6878
292 Ga0105249_12122998 3300009553 Bacteria 635
293 Ga0105239_10022348 3300010375 Bacteria 6975
294 Ga0105246_10076002 3300011119 Bacteria 2379
295 Ga0157373_10137764 3300013100 Bacteria 1716
296 Ga0157373_10727220 3300013100 Unclassified 728
297 Ga0157371_10014375 3300013102 Bacteria 5975
298 Ga0157371_10026099 3300013102 Bacteria 4250
299 Ga0157371_10049519 3300013102 Bacteria 2984
300 Ga0157371_10161394 3300013102 Bacteria 1601
301 Ga0157371_10274296 3300013102 Bacteria 1217
302 Ga0157370_10426713 3300013104 Unclassified 1219
303 Ga0157370_11279753 3300013104 Bacteria 661
304 Ga0157369_10009743 3300013105 Bacteria 10988
305 Ga0157369_10044263 3300013105 Bacteria 4847
306 Ga0157369_10058648 3300013105 Bacteria 4152
307 Ga0157369_10111118 3300013105 Bacteria 2913
308 Ga0157374_10103877 3300013296 Bacteria 2727
309 Ga0157374_10436124 3300013296 Bacteria 1310
310 Ga0157374_10638032 3300013296 Unclassified 1076
311 Ga0157374_10695200 3300013296 Bacteria 1030
312 Ga0157378_10010218 3300013297 Bacteria 8192
313 Ga0157378_10106998 3300013297 Bacteria 2559
314 Ga0157378_10929278 3300013297 Unclassified 902
315 Ga0163162_10005518 3300013306 Bacteria 12229
316 Ga0163162_10102277 3300013306 Unclassified 2958
317 Ga0163162_10125029 3300013306 Bacteria 2677
318 Ga0157372_10007450 3300013307 Bacteria 11640
319 Ga0157372_10034334 3300013307 Bacteria 5575
320 Ga0157372_10131422 3300013307 Unclassified 2880
321 Ga0157372_10137337 3300013307 Bacteria 2816
322 Ga0157372_10258345 3300013307 Bacteria 2023
323 Ga0157372_11096649 3300013307 Bacteria 921
324 Ga0157372_11181381 3300013307 Unclassified 884
325 Ga0157375_10012095 3300013308 Bacteria 7645
326 Ga0157375_10020915 3300013308 Bacteria 5989
327 Ga0157375_10045532 3300013308 Bacteria 4270
328 Ga0157375_10074879 3300013308 Bacteria 3408
329 Ga0157375_10206586 3300013308 Unclassified 2120
330 Ga0157375_10297329 3300013308 Bacteria 1778
331 Ga0157375_12066620 3300013308 Unclassified 678
332 Ga0157375_12650915 3300013308 Bacteria 599
333 Ga0163163_10085703 3300014325 Bacteria 3158
334 Ga0163163_10309966 3300014325 Bacteria 1631
335 Ga0163163_10361527 3300014325 Bacteria 1508
336 Ga0157380_10073888 3300014326 Bacteria 2766
337 Ga0157380_10095119 3300014326 Bacteria 2467
338 Ga0157380_11871440 3300014326 Bacteria 660
339 Ga0157377_10002278 3300014745 Bacteria 8437
340 Ga0157379_10009798 3300014968 Bacteria 8348
341 Ga0157376_10878811 3300014969 Unclassified 913
342 Ga0157376_11376091 3300014969 Unclassified 737
343 Ga0182005_1203612 3300015265 Unclassified 596
344 Ga0163161_10015523 3300017792 Bacteria 5310
345 Ga0163161_10334581 3300017792 Bacteria 1200
346 Ga0163161_10380076 3300017792 Bacteria 1129
347 Ga0207697_10007246 3300025315 Bacteria 4954
348 Ga0207656_10002562 3300025321 Bacteria 6149
349 Ga0207656_10073900 3300025321 Bacteria 1520
350 Ga0207682_10206603 3300025893 Bacteria 904
351 Ga0207692_10160850 3300025898 Bacteria 1294
352 Ga0207692_10442607 3300025898 Bacteria 817
353 Ga0207642_10329791 3300025899 Bacteria 894
354 Ga0207642_10402639 3300025899 Unclassified 819
355 Ga0207642_10756878 3300025899 Unclassified 615
356 Ga0207688_10022824 3300025901 Bacteria 3427
357 Ga0207688_10234176 3300025901 Bacteria 1109
358 Ga0207680_10056322 3300025903 Bacteria 2374
359 Ga0207680_10553981 3300025903 Unclassified 821
360 Ga0207680_10864365 3300025903 Unclassified 648
361 Ga0207647_10165085 3300025904 Bacteria 1291
362 Ga0207647_10297370 3300025904 Unclassified 920
363 Ga0207699_10329663 3300025906 Bacteria 1073
364 Ga0207645_10000255 3300025907 Bacteria 44205
365 Ga0207645_10141338 3300025907 Bacteria 1569
366 Ga0207645_10184483 3300025907 Bacteria 1369
367 Ga0207643_10006489 3300025908 Bacteria 6266
368 Ga0207643_10076402 3300025908 Bacteria 1934
369 Ga0207643_10120642 3300025908 Bacteria 1553
370 Ga0207705_10038829 3300025909 Bacteria 3410
371 Ga0207705_10069901 3300025909 Bacteria 2543
372 Ga0207705_10073819 3300025909 Bacteria 2475
373 Ga0207705_10293444 3300025909 Bacteria 1246
374 Ga0207705_10354441 3300025909 Unclassified 1131
375 Ga0207707_10000874 3300025912 Bacteria 29449
376 Ga0207707_10005626 3300025912 Bacteria 10963
377 Ga0207707_10682801 3300025912 Bacteria 863
378 Ga0207693_10250145 3300025915 Bacteria 1391
379 Ga0207660_10008819 3300025917 Bacteria 6519
380 Ga0207660_10075830 3300025917 Bacteria 2458
381 Ga0207660_10186650 3300025917 Bacteria 1613
382 Ga0207660_11286709 3300025917 Bacteria 594
383 Ga0207662_10013626 3300025918 Bacteria 4550
384 Ga0207662_10016261 3300025918 Bacteria 4195
385 Ga0207657_10026384 3300025919 Bacteria 5341
386 Ga0207657_10112226 3300025919 Unclassified 2250
387 Ga0207657_10195800 3300025919 Bacteria 1628
388 Ga0207649_10046769 3300025920 Bacteria 2660
389 Ga0207649_10059230 3300025920 Bacteria 2402
390 Ga0207649_10064894 3300025920 Bacteria 2310
391 Ga0207649_10243203 3300025920 Bacteria 1293
392 Ga0207649_10243601 3300025920 Bacteria 1292
393 Ga0207649_11371169 3300025920 Bacteria 559
394 Ga0207649_11597099 3300025920 Unclassified 516
395 Ga0207652_10004380 3300025921 Bacteria 11506
396 Ga0207652_10009406 3300025921 Bacteria 7857
397 Ga0207652_10189952 3300025921 Unclassified 1847
398 Ga0207652_10199264 3300025921 Bacteria 1802
399 Ga0207652_10825656 3300025921 Bacteria 822
400 Ga0207652_11853257 3300025921 Bacteria 508
401 Ga0207681_10009885 3300025923 Bacteria 5837
402 Ga0207681_10011428 3300025923 Bacteria 5455
403 Ga0207681_10304618 3300025923 Unclassified 1262
404 Ga0207650_10039416 3300025925 Bacteria 3453
405 Ga0207650_10045145 3300025925 Bacteria 3242
406 Ga0207650_10377752 3300025925 Bacteria 1170
407 Ga0207650_10450385 3300025925 Unclassified 1071
408 Ga0207650_10625400 3300025925 Bacteria 906
409 Ga0207650_10735382 3300025925 Bacteria 834
410 Ga0207650_11030279 3300025925 Unclassified 700
411 Ga0207659_10007725 3300025926 Bacteria 6638
412 Ga0207659_10061683 3300025926 Bacteria 2703
413 Ga0207659_10091711 3300025926 Bacteria 2270
414 Ga0207659_10457459 3300025926 Unclassified 1076
415 Ga0207659_11443077 3300025926 Unclassified 589
416 Ga0207659_11771654 3300025926 Bacteria 525
417 Ga0207687_10401578 3300025927 Bacteria 1127
418 Ga0207687_11166296 3300025927 Unclassified 662
419 Ga0207700_10191343 3300025928 Bacteria 1719
420 Ga0207700_10312036 3300025928 Bacteria 1361
421 Ga0207644_10173024 3300025931 Bacteria 1687
422 Ga0207644_10229062 3300025931 Bacteria 1476
423 Ga0207690_10032975 3300025932 Bacteria 3327
424 Ga0207690_10036400 3300025932 Bacteria 3187
425 Ga0207690_10089521 3300025932 Bacteria 2170
426 Ga0207690_10110636 3300025932 Bacteria 1978
427 Ga0207690_10198813 3300025932 Bacteria 1521
428 Ga0207690_10378105 3300025932 Unclassified 1125
429 Ga0207690_10606310 3300025932 Bacteria 894
430 Ga0207706_10000770 3300025933 Bacteria 33279
431 Ga0207706_10046864 3300025933 Bacteria 3826
432 Ga0207706_10233649 3300025933 Bacteria 1608
433 Ga0207706_10302599 3300025933 Bacteria 1393
434 Ga0207686_10005941 3300025934 Bacteria 6554
435 Ga0207709_10097486 3300025935 Bacteria 1936
436 Ga0207670_10019179 3300025936 Bacteria 4171
437 Ga0207670_10210944 3300025936 Bacteria 1481
438 Ga0207669_10027373 3300025937 Bacteria 3120
439 Ga0207669_10124218 3300025937 Bacteria 1759
440 Ga0207669_10148786 3300025937 Bacteria 1637
441 Ga0207704_10019568 3300025938 Unclassified 3559
442 Ga0207704_10226095 3300025938 Bacteria 1388
443 Ga0207704_10384687 3300025938 Bacteria 1102
444 Ga0207691_10005752 3300025940 Bacteria 11995
445 Ga0207691_10012455 3300025940 Bacteria 8156
446 Ga0207691_10017519 3300025940 Bacteria 6791
447 Ga0207691_10020648 3300025940 Bacteria 6227
448 Ga0207691_10022196 3300025940 Bacteria 5987
449 Ga0207691_10209707 3300025940 Bacteria 1693
450 Ga0207691_10213936 3300025940 Bacteria 1673
451 Ga0207691_10346404 3300025940 Bacteria 1271
452 Ga0207691_10397605 3300025940 Unclassified 1175
453 Ga0207691_10933306 3300025940 Bacteria 726
454 Ga0207711_10054193 3300025941 Bacteria 3441
455 Ga0207711_10069894 3300025941 Unclassified 3044
456 Ga0207711_10100012 3300025941 Bacteria 2564
457 Ga0207711_10786573 3300025941 Bacteria 886
458 Ga0207711_10809463 3300025941 Bacteria 872
459 Ga0207689_10007512 3300025942 Bacteria 9557
460 Ga0207661_10017011 3300025944 Bacteria 5371
461 Ga0207661_10043011 3300025944 Bacteria 3564
462 Ga0207661_10177447 3300025944 Bacteria 1858
463 Ga0207661_10187882 3300025944 Bacteria 1810
464 Ga0207661_10356642 3300025944 Unclassified 1320
465 Ga0207661_11605493 3300025944 Unclassified 595
466 Ga0207679_10014379 3300025945 Bacteria 5203
467 Ga0207679_10015401 3300025945 Bacteria 5051
468 Ga0207679_10024181 3300025945 Bacteria 4163
469 Ga0207679_10031262 3300025945 Bacteria 3725
470 Ga0207679_10051001 3300025945 Bacteria 3027
471 Ga0207679_10075914 3300025945 Bacteria 2552
472 Ga0207679_10273027 3300025945 Unclassified 1447
473 Ga0207679_10390002 3300025945 Bacteria 1223
474 Ga0207679_11359182 3300025945 Bacteria 652
475 Ga0207679_11585208 3300025945 Unclassified 600
476 Ga0207667_10157702 3300025949 Bacteria 2335
477 Ga0207667_11364535 3300025949 Unclassified 683
478 Ga0207651_10055150 3300025960 Bacteria 2728
479 Ga0207651_10056254 3300025960 Unclassified 2706
480 Ga0207651_10074298 3300025960 Bacteria 2420
481 Ga0207651_10181851 3300025960 Bacteria 1669
482 Ga0207651_10442320 3300025960 Unclassified 1114
483 Ga0207712_10005325 3300025961 Bacteria 8123
484 Ga0207712_10007165 3300025961 Bacteria 7033
485 Ga0207668_10007508 3300025972 Bacteria 6487
486 Ga0207668_10031499 3300025972 Bacteria 3493
487 Ga0207668_10043548 3300025972 Unclassified 3047
488 Ga0207668_10390302 3300025972 Bacteria 1174
489 Ga0207668_10548225 3300025972 Unclassified 1001
490 Ga0207640_10110361 3300025981 Bacteria 1948
491 Ga0207640_10294654 3300025981 Bacteria 1280
492 Ga0207640_10539891 3300025981 Unclassified 978
493 Ga0207658_10096076 3300025986 Bacteria 2310
494 Ga0207658_10110439 3300025986 Bacteria 2172
495 Ga0207658_10225838 3300025986 Bacteria 1578
496 Ga0207677_10058767 3300026023 Bacteria 2650
497 Ga0207677_10618670 3300026023 Unclassified 952
498 Ga0207703_10019504 3300026035 Bacteria 5300
499 Ga0207703_10405666 3300026035 Unclassified 1265
500 Ga0207639_10048156 3300026041 Bacteria 3225
501 Ga0207639_10048769 3300026041 Bacteria 3207
502 Ga0207639_10205883 3300026041 Bacteria 1690
503 Ga0207639_10755015 3300026041 Bacteria 905
504 Ga0207639_10794236 3300026041 Unclassified 882
505 Ga0207678_10447359 3300026067 Bacteria 1122
506 Ga0207678_10486399 3300026067 Bacteria 1075
507 Ga0207678_10931798 3300026067 Unclassified 768
508 Ga0207702_10162570 3300026078 Bacteria 2040
509 Ga0207702_10292806 3300026078 Bacteria 1543
510 Ga0207702_10512436 3300026078 Bacteria 1170
511 Ga0207702_12149646 3300026078 Unclassified 547
512 Ga0207641_10241103 3300026088 Unclassified 1685
513 Ga0207641_10532075 3300026088 Bacteria 1144
514 Ga0207641_11020768 3300026088 Bacteria 824
515 Ga0207648_10069989 3300026089 Unclassified 3058
516 Ga0207648_10070190 3300026089 Bacteria 3054
517 Ga0207648_10125446 3300026089 Bacteria 2258
518 Ga0207648_10226237 3300026089 Bacteria 1663
519 Ga0207676_10127996 3300026095 Bacteria 2154
520 Ga0207676_10287909 3300026095 Unclassified 1494
521 Ga0207676_10291878 3300026095 Bacteria 1485
522 Ga0207676_10474839 3300026095 Bacteria 1183
523 Ga0207676_11211375 3300026095 Bacteria 748
524 Ga0207676_11732016 3300026095 Unclassified 623
525 Ga0207674_10012303 3300026116 Bacteria 9567
526 Ga0207674_10012336 3300026116 Bacteria 9552
527 Ga0207674_10121511 3300026116 Bacteria 2579
528 Ga0207674_10298070 3300026116 Bacteria 1561
529 Ga0207674_10361944 3300026116 Bacteria 1402
530 Ga0207675_100005653 3300026118 Bacteria 11972
531 Ga0207675_100217502 3300026118 Bacteria 1840
532 Ga0207683_10212062 3300026121 Bacteria 1763
533 Ga0207683_10289863 3300026121 Bacteria 1497
534 Ga0207683_10338275 3300026121 Bacteria 1380
535 Ga0207683_10656938 3300026121 Unclassified 971
536 Ga0207683_10856927 3300026121 Bacteria 844
537 Ga0207683_11683758 3300026121 Unclassified 584
538 Ga0207698_10045199 3300026142 Bacteria 3315
539 Ga0268266_10063275 3300028379 Bacteria 3194
540 Ga0268266_10318232 3300028379 Bacteria 1456
541 Ga0268266_10630236 3300028379 Bacteria 1031
542 Ga0268266_11491566 3300028379 Unclassified 652
543 Ga0268265_10013720 3300028380 Bacteria 5512
544 Ga0268265_10014643 3300028380 Bacteria 5347
545 Ga0268265_10621882 3300028380 Bacteria 1035
546 Ga0268265_11313111 3300028380 Unclassified 724
547 Ga0268264_10052721 3300028381 Bacteria 3392
548 Ga0268264_11528142 3300028381 Unclassified 678
549 Ga0307408_100005793 3300031548 Bacteria 8223
550 Ga0307408_101191865 3300031548 Bacteria 710
551 Ga0307405_10643402 3300031731 Bacteria 871
552 Ga0307405_11253701 3300031731 Bacteria 643
553 Ga0307413_10404639 3300031824 Bacteria 1070
554 Ga0307410_10409029 3300031852 Bacteria 1098
555 Ga0307410_10981236 3300031852 Unclassified 728
556 Ga0307410_12109615 3300031852 Bacteria 504
557 Ga0307406_10004708 3300031901 Bacteria 7437
558 Ga0307406_10673467 3300031901 Unclassified 861
559 Ga0307406_10917527 3300031901 Bacteria 747
560 Ga0307407_10140014 3300031903 Bacteria 1560
561 Ga0307412_10057155 3300031911 Bacteria 2603
562 Ga0307409_100064260 3300031995 Bacteria 2882
563 Ga0307409_100569512 3300031995 Bacteria 1115
564 Ga0307409_100894278 3300031995 Bacteria 901
565 Ga0307409_101426315 3300031995 Unclassified 719
566 Ga0307416_100403924 3300032002 Bacteria 1404
567 Ga0307416_101523054 3300032002 Unclassified 774
568 Ga0307411_10493882 3300032005 Bacteria 1033
569 Ga0307411_10971682 3300032005 Bacteria 759
570 Ga0307415_100119902 3300032126 Bacteria 1970
571 Ga0373954_0145309 3300035118 Bacteria 1158
572 Ga0373960_0031960 3300035121 Bacteria 1476
573 Ga0373931_0224267 3300035691 Unclassified 1133
574 Ga0373931_0814805 3300035691 Unclassified 623
575 Ga0373947_1082370 3300035725 Unclassified 547
576 Ga0373937_0043840 3300036401 Bacteria 4086
577 Ga0373925_0182733 3300037068 Bacteria 1661
578 Ga0395905_0357156 3300037471 Bacteria 1354
579 Ga0439436_0217839 3300041404 Unclassified 549
580 Ga0439448_0059240 3300042005 Unclassified 1264
581 Ga0439448_0255423 3300042005 Unclassified 619
582 Ga0439450_083645 3300042008 Unclassified 796
583 Ga0439455_0025042 3300042012 Bacteria 1448
584 Ga0439462_0042859 3300042015 Bacteria 1209
585 Ga0451576_0103602 3300045051 Bacteria 2960
586 Ga0495580_0072869 3300046472 Unclassified 2398
587 Ga0495580_0134871 3300046472 Bacteria 1712
588 Ga0495582_0140030 3300046473 Bacteria 1370
589 Ga0495639_0364323 3300046475 Bacteria 727
590 Ga0495584_0481341 3300046491 Bacteria 632
591 Ga0495594_0036898 3300046499 Bacteria 2667
592 Ga0495631_0358860 3300046518 Unclassified 620
593 Ga0495663_0051042 3300046525 Bacteria 1280
594 Ga0495663_0084069 3300046525 Bacteria 1029
595 Ga0495665_0135862 3300046531 Bacteria 1286
596 Ga0495587_0136851 3300046536 Bacteria 1399
597 Ga0495587_0247538 3300046536 Bacteria 1002
598 Ga0495621_0143906 3300046539 Bacteria 934
599 Ga0495645_0241383 3300046543 Bacteria 1205
600 Ga0495635_0758754 3300046663 Unclassified 627
601 Ga0495635_0960487 3300046663 Unclassified 545
602 Ga0495657_0151319 3300046675 Bacteria 1441
603 Ga0495623_0227289 3300046679 Unclassified 1060
604 Ga0495658_0469718 3300046683 Unclassified 804
605 Ga0495613_0032334 3300046689 Bacteria 3886
606 Ga0495670_0325883 3300046691 Bacteria 825
607 Ga0495604_0507835 3300047317 Bacteria 781
608 Ga0495675_0072170 3300047444 Bacteria 2178
609 Ga0495675_0073691 3300047444 Bacteria 2153
610 Ga0495675_0254711 3300047444 Bacteria 1053
611 Ga0495677_0147537 3300047445 Bacteria 905
612 Ga0495685_071090 3300047447 Unclassified 1165
613 Ga0496101_0053224 3300048904 Bacteria 2920
614 Ga0496101_0288644 3300048904 Unclassified 1283
615 Ga0496101_0337802 3300048904 Bacteria 1183
616 Ga0496106_0369280 3300048909 Unclassified 1153
617 Ga0496107_0175929 3300048910 Unclassified 1589
618 Ga0496108_0522288 3300048911 Bacteria 1036
619 Ga0496108_1189466 3300048911 Unclassified 645
620 Ga0496109_0094324 3300048912 Bacteria 2770
621 Ga0496109_0116638 3300048912 Unclassified 2485
622 Ga0496109_0170151 3300048912 Bacteria 2044
623 Ga0496110_0241833 3300048913 Bacteria 1642
624 Ga0496112_0063527 3300048915 Bacteria 3642
625 Ga0496112_0394501 3300048915 Bacteria 1324
626 Ga0496112_0530140 3300048915 Unclassified 1112
627 Ga0496112_0567773 3300048915 Bacteria 1068
628 Ga0496113_0017560 3300048916 Bacteria 4969
629 Ga0496113_0751043 3300048916 Unclassified 777
630 Ga0496114_0708649 3300048917 Bacteria 882
631 Ga0496115_0010326 3300048918 Bacteria 6972
632 Ga0496115_0127249 3300048918 Bacteria 2099
633 Ga0496115_1104720 3300048918 Bacteria 601
634 Ga0501034_0817079 3300049571 Bacteria 824
635 Ga0501037_1126717 3300049573 Unclassified 507
636 Ga0501038_0036120 3300049574 Bacteria 4337
637 Ga0501043_0040649 3300049579 Bacteria 3655
638 Ga0501047_0028787 3300049581 Bacteria 5358
639 Ga0501070_0077147 3300049586 Bacteria 2758
640 Ga0501235_040822 3300049669 Bacteria 1061
641 Ga0501242_036975 3300049674 Bacteria 679
642 Ga0501263_054900 3300049760 Bacteria 613
643 Ga0501266_035607 3300049763 Bacteria 725
644 Ga0501035_0102399 3300049822 Bacteria 2512
645 Ga0501212_062638 3300049851 Bacteria 646
646 nmdc:mga05p37_1245198_c1 3300050507 Bacteria 764
647 nmdc:mga05p37_31322_c1 3300050507 Bacteria 6496
648 nmdc:mga05p37_373222_c1 3300050507 Bacteria 1673
649 nmdc:mga05p37_389873_c1 3300050507 Unclassified 1629
650 nmdc:mga09592_99315_c1 3300050508 Bacteria 2492
651 nmdc:mga0qj67_111771_c1 3300050509 Bacteria 2206
652 nmdc:mga0qj67_16968_c1 3300050509 Bacteria 5531
653 nmdc:mga0qj67_22272_c1 3300050509 Bacteria 4867
654 nmdc:mga0qj67_92752_c1 3300050509 Bacteria 2428
655 nmdc:mga06r32_111175_c1 3300050510 Bacteria 2696
656 nmdc:mga06r32_40451_c1 3300050510 Bacteria 4426
657 nmdc:mga06r32_95061_c1 3300050510 Bacteria 2916
658 nmdc:mga08y16_159158_c1 3300050511 Unclassified 2346
659 nmdc:mga08y16_325095_c1 3300050511 Unclassified 1583
660 nmdc:mga0n895_187773_c1 3300050512 Bacteria 2098
661 nmdc:mga0n895_192084_c2 3300050512 Unclassified 690
662 nmdc:mga0n895_2156422_c1 3300050512 Unclassified 513
663 nmdc:mga0rr50_1705979_c1 3300050513 Unclassified 531
664 nmdc:mga0a205_15295_c1 3300050515 Bacteria 7169
665 nmdc:mga0a205_165294_c1 3300050515 Bacteria 2108
666 nmdc:mga0a205_89225_c1 3300050515 Bacteria 2980
667 Ga0495595_0720961 3300053084 Unclassified 511
668 Ga0590075_052426 3300059424 Unclassified 1047
669 Ga0590077_020302 3300059426 Unclassified 1410
670 Ga0501082_1398963 3300060353 Bacteria 611
671 Ga0495651_0702600
672 JGI24746J21847_1038012
673 JGI24750J21931_1026670
674 rootH1_10311610
675 Ga0065704_10156912
676 Ga0065712_10163174
677 Ga0065712_10182711
678 Ga0065712_10184856
679 Ga0065715_10131723
680 Ga0065707_10119256
681 Ga0065707_10184632
682 Ga0070658_10018457
683 Ga0070658_10105955
684 Ga0070658_10420231
685 Ga0070658_10445103
686 Ga0070658_10826204
687 Ga0070658_11377767
688 Ga0070676_10005185
689 Ga0070676_10103755
690 Ga0070676_11477814
691 Ga0070683_100009488
692 Ga0070683_100039114
693 Ga0070683_100040960
694 Ga0070683_100070117
695 Ga0070683_100509466
696 Ga0070683_100525630
697 Ga0070683_100665435
698 Ga0070690_100279691
699 Ga0070670_100026513
700 Ga0070670_100084609
701 Ga0070670_100183700
702 Ga0070670_100355663
703 Ga0070670_100573048
704 Ga0070670_101123979
705 Ga0070670_101241675
706 Ga0070670_101257420
707 Ga0070670_101269706
708 Ga0070677_10553241
709 Ga0068869_100004173
710 Ga0068869_100866052
711 Ga0068869_101089192
712 Ga0070680_100009974
713 Ga0070680_100053796
714 Ga0070680_100058590
715 Ga0070680_100575661
716 Ga0070682_100038161
717 Ga0068868_100054563
718 Ga0070660_100034216
719 Ga0070660_100091742
720 Ga0070660_100159283
721 Ga0070660_100277095
722 Ga0070660_100670032
723 Ga0070689_100007619
724 Ga0070689_100072530
725 Ga0070689_100439853
726 Ga0070689_100906390
727 Ga0070687_100011987
728 Ga0070687_100017325
729 Ga0070687_100299826
730 Ga0070661_100000761
731 Ga0070661_100006089
732 Ga0070661_100048646
733 Ga0070661_100133369
734 Ga0070661_100389049
735 Ga0070661_100909128
736 Ga0070661_101052535
737 Ga0070661_101827680
738 Ga0070668_100003223
739 Ga0070668_100009423
740 Ga0070668_100051948
741 Ga0070668_100256089
742 Ga0070668_100539931
743 Ga0070668_101243093
744 Ga0070669_100006514
745 Ga0070669_100010971
746 Ga0070669_100016431
747 Ga0070675_100001278
748 Ga0070675_100014819
749 Ga0070675_100025852
750 Ga0070675_100257887
751 Ga0070675_100332647
752 Ga0070675_100968669
753 Ga0070671_100047870
754 Ga0070671_100064296
755 Ga0070671_100085700
756 Ga0070671_100239082
757 Ga0070671_100423024
758 Ga0070671_100770347
759 Ga0070674_100026369
760 Ga0070674_100027876
761 Ga0070674_100085808
762 Ga0070674_100113595
763 Ga0070674_100119805
764 Ga0070674_100236626
765 Ga0070674_100940294
766 Ga0070673_100017292
767 Ga0070673_100083492
768 Ga0070673_100191556
769 Ga0070673_100329399
770 Ga0070673_100703971
771 Ga0070673_100812868
772 Ga0070688_100024964
773 Ga0070688_100165452
774 Ga0070688_100844128
775 Ga0070688_101279729
776 Ga0070659_100015355
777 Ga0070659_100060258
778 Ga0070659_100105383
779 Ga0070659_100177707
780 Ga0070659_100224863
781 Ga0070659_100225512
782 Ga0070659_100231630
783 Ga0070659_100926130
784 Ga0070667_100016807
785 Ga0070667_100050853
786 Ga0070667_100092180
787 Ga0070667_101233163
788 Ga0070667_101554104
789 Ga0070714_100063791
790 Ga0070713_100354803
791 Ga0070713_100447597
792 Ga0070710_10184862
793 Ga0070710_10646804
794 Ga0070701_10383444
795 Ga0070711_100031915
796 Ga0070711_100548044
797 Ga0070711_101933296
798 Ga0070700_100581301
799 Ga0070694_100084854
800 Ga0070694_101611426
801 Ga0070663_100014995
802 Ga0070678_100309545
803 Ga0070678_100358992
804 Ga0070678_100615730
805 Ga0070678_100847041
806 Ga0070678_102151167
807 Ga0070662_100001376
808 Ga0070662_100030011
809 Ga0070662_101852139
810 Ga0070681_10008916
811 Ga0070681_10055379
812 Ga0070681_10883902
813 Ga0068867_100053208
814 Ga0068867_100211542
815 Ga0070685_10061054
816 Ga0070685_10064914
817 Ga0070698_100436222
818 Ga0070699_100137228
819 Ga0070679_100004790
820 Ga0070679_100017822
821 Ga0070679_100130827
822 Ga0070679_100673511
823 Ga0070684_100033995
824 Ga0070684_100045344
825 Ga0070684_100510941
826 Ga0070684_100625419
827 Ga0070684_100885385
828 Ga0070684_101563855
829 Ga0068853_100021924
830 Ga0068853_100182248
831 Ga0068853_100663459
832 Ga0068853_101141226
833 Ga0068853_101150568
834 Ga0070672_100007221
835 Ga0070672_100020662
836 Ga0070672_100041180
837 Ga0070672_100045186
838 Ga0070672_100058517
839 Ga0070672_100295361
840 Ga0070672_100392391
841 Ga0070686_100147463
842 Ga0070693_100394625
843 Ga0070665_100056662
844 Ga0070665_100903636
845 Ga0070665_101420991
846 Ga0070704_100488875
847 Ga0068855_100155804
848 Ga0068855_101535556
849 Ga0070664_100011578
850 Ga0070664_100011616
851 Ga0070664_100014695
852 Ga0070664_100047380
853 Ga0070664_100055595
854 Ga0070664_100075905
855 Ga0070664_100289495
856 Ga0070664_100323110
857 Ga0070664_100384467
858 Ga0070664_101694860
859 Ga0068857_100007776
860 Ga0068857_100028401
861 Ga0068857_100120661
862 Ga0068857_100181818
863 Ga0068857_100317333
864 Ga0068854_100127209
865 Ga0068854_100615575
866 Ga0068856_100136419
867 Ga0068856_100464764
868 Ga0068856_100486600
869 Ga0068856_102667862
870 Ga0070702_100371183
871 Ga0068852_100002352
872 Ga0068852_100176334
873 Ga0068852_100466942
874 Ga0068852_100711850
875 Ga0068852_100944431
876 Ga0068852_101611334
877 Ga0068852_101739573
878 Ga0068859_100014944
879 Ga0068859_100029406
880 Ga0068864_100022668
881 Ga0068864_100186082
882 Ga0068864_100296866
883 Ga0068864_100297983
884 Ga0068864_100548322
885 Ga0068864_101851701
886 Ga0068866_10022921
887 Ga0068861_100001161
888 Ga0068851_10008967
889 Ga0068851_10041235
890 Ga0068851_10245329
891 Ga0068870_10010220
892 Ga0068870_10068496
893 Ga0068870_10145216
894 Ga0068863_100018470
895 Ga0068863_100321574
896 Ga0068863_100434448
897 Ga0068863_100610514
898 Ga0068863_101307119
899 Ga0068863_101498268
900 Ga0068858_100059514
901 Ga0068858_100084658
902 Ga0068858_100120321
903 Ga0068858_101813154
904 Ga0068860_100015544
905 Ga0068860_100439580
906 Ga0068860_101507743
907 Ga0068862_100004345
908 Ga0068862_100024430
909 Ga0068862_101468188
910 Ga0070712_100258683
911 Ga0070712_100283048
912 Ga0097621_100062353
913 Ga0097621_100201451
914 Ga0068871_100620729
915 Ga0075428_100008077
916 Ga0075428_100097642
917 Ga0075428_100201921
918 Ga0075430_100004875
919 Ga0075430_100019852
920 Ga0075430_100024176
921 Ga0075430_100040149
922 Ga0075431_100028415
923 Ga0075431_100046489
924 Ga0075433_10007366
925 Ga0075433_10052694
926 Ga0075433_10061105
927 Ga0075434_100016561
928 Ga0075434_100021483
929 Ga0075434_100480644
930 Ga0075434_100917991
931 Ga0075429_100395171
932 Ga0068865_100011921
933 Ga0068865_100015769
934 Ga0068865_100590782
935 Ga0068865_101668322
936 Ga0097620_100014944
937 Ga0097620_100029406
938 Ga0075435_101857555
939 Ga0099794_10406795
940 Ga0105240_12416034
941 Ga0111539_10043018
942 Ga0111539_10064753
943 Ga0111539_13088778
944 Ga0105245_10206723
945 Ga0105245_10309874
946 Ga0114129_10027780
947 Ga0114129_10478876
948 Ga0114129_10742613
949 Ga0105243_13043683
950 Ga0105242_10008278
951 Ga0105242_10073848
952 Ga0105242_10916790
953 Ga0105248_10014552
954 Ga0105248_10034815
955 Ga0105248_10051416
956 Ga0105248_10133058
957 Ga0105248_10372957
958 Ga0105248_10401663
959 Ga0105248_10434704
960 Ga0105249_10002680
961 Ga0105249_10014896
962 Ga0105249_12122998
963 Ga0105239_10022348
964 Ga0105246_10076002
965 Ga0157373_10137764
966 Ga0157373_10727220
967 Ga0157371_10014375
968 Ga0157371_10026099
969 Ga0157371_10049519
970 Ga0157371_10161394
971 Ga0157371_10274296
972 Ga0157370_10426713
973 Ga0157370_11279753
974 Ga0157369_10009743
975 Ga0157369_10044263
976 Ga0157369_10058648
977 Ga0157369_10111118
978 Ga0157374_10103877
979 Ga0157374_10436124
980 Ga0157374_10638032
981 Ga0157374_10695200
982 Ga0157378_10010218
983 Ga0157378_10106998
984 Ga0157378_10929278
985 Ga0163162_10005518
986 Ga0163162_10102277
987 Ga0163162_10125029
988 Ga0157372_10007450
989 Ga0157372_10034334
990 Ga0157372_10131422
991 Ga0157372_10137337
992 Ga0157372_10258345
993 Ga0157372_11096649
994 Ga0157372_11181381
995 Ga0157375_10012095
996 Ga0157375_10020915
997 Ga0157375_10045532
998 Ga0157375_10074879
999 Ga0157375_10206586
1000 Ga0157375_10297329
1001 Ga0157375_12066620
1002 Ga0157375_12650915
1003 Ga0163163_10085703
1004 Ga0163163_10309966
1005 Ga0163163_10361527
1006 Ga0157380_10073888
1007 Ga0157380_10095119
1008 Ga0157380_11871440
1009 Ga0157377_10002278
1010 Ga0157379_10009798
1011 Ga0157376_10878811
1012 Ga0157376_11376091
1013 Ga0182005_1203612
1014 Ga0163161_10015523
1015 Ga0163161_10334581
1016 Ga0163161_10380076
1017 Ga0207697_10007246
1018 Ga0207656_10002562
1019 Ga0207656_10073900
1020 Ga0207682_10206603
1021 Ga0207692_10160850
1022 Ga0207692_10442607
1023 Ga0207642_10329791
1024 Ga0207642_10402639
1025 Ga0207642_10756878
1026 Ga0207688_10022824
1027 Ga0207688_10234176
1028 Ga0207680_10056322
1029 Ga0207680_10553981
1030 Ga0207680_10864365
1031 Ga0207647_10165085
1032 Ga0207647_10297370
1033 Ga0207699_10329663
1034 Ga0207645_10000255
1035 Ga0207645_10141338
1036 Ga0207645_10184483
1037 Ga0207643_10006489
1038 Ga0207643_10076402
1039 Ga0207643_10120642
1040 Ga0207705_10038829
1041 Ga0207705_10069901
1042 Ga0207705_10073819
1043 Ga0207705_10293444
1044 Ga0207705_10354441
1045 Ga0207707_10000874
1046 Ga0207707_10005626
1047 Ga0207707_10682801
1048 Ga0207693_10250145
1049 Ga0207660_10008819
1050 Ga0207660_10075830
1051 Ga0207660_10186650
1052 Ga0207660_11286709
1053 Ga0207662_10013626
1054 Ga0207662_10016261
1055 Ga0207657_10026384
1056 Ga0207657_10112226
1057 Ga0207657_10195800
1058 Ga0207649_10046769
1059 Ga0207649_10059230
1060 Ga0207649_10064894
1061 Ga0207649_10243203
1062 Ga0207649_10243601
1063 Ga0207649_11371169
1064 Ga0207649_11597099
1065 Ga0207652_10004380
1066 Ga0207652_10009406
1067 Ga0207652_10189952
1068 Ga0207652_10199264
1069 Ga0207652_10825656
1070 Ga0207652_11853257
1071 Ga0207681_10009885
1072 Ga0207681_10011428
1073 Ga0207681_10304618
1074 Ga0207650_10039416
1075 Ga0207650_10045145
1076 Ga0207650_10377752
1077 Ga0207650_10450385
1078 Ga0207650_10625400
1079 Ga0207650_10735382
1080 Ga0207650_11030279
1081 Ga0207659_10007725
1082 Ga0207659_10061683
1083 Ga0207659_10091711
1084 Ga0207659_10457459
1085 Ga0207659_11443077
1086 Ga0207659_11771654
1087 Ga0207687_10401578
1088 Ga0207687_11166296
1089 Ga0207700_10191343
1090 Ga0207700_10312036
1091 Ga0207644_10173024
1092 Ga0207644_10229062
1093 Ga0207690_10032975
1094 Ga0207690_10036400
1095 Ga0207690_10089521
1096 Ga0207690_10110636
1097 Ga0207690_10198813
1098 Ga0207690_10378105
1099 Ga0207690_10606310
1100 Ga0207706_10000770
1101 Ga0207706_10046864
1102 Ga0207706_10233649
1103 Ga0207706_10302599
1104 Ga0207686_10005941
1105 Ga0207709_10097486
1106 Ga0207670_10019179
1107 Ga0207670_10210944
1108 Ga0207669_10027373
1109 Ga0207669_10124218
1110 Ga0207669_10148786
1111 Ga0207704_10019568
1112 Ga0207704_10226095
1113 Ga0207704_10384687
1114 Ga0207691_10005752
1115 Ga0207691_10012455
1116 Ga0207691_10017519
1117 Ga0207691_10020648
1118 Ga0207691_10022196
1119 Ga0207691_10209707
1120 Ga0207691_10213936
1121 Ga0207691_10346404
1122 Ga0207691_10397605
1123 Ga0207691_10933306
1124 Ga0207711_10054193
1125 Ga0207711_10069894
1126 Ga0207711_10100012
1127 Ga0207711_10786573
1128 Ga0207711_10809463
1129 Ga0207689_10007512
1130 Ga0207661_10017011
1131 Ga0207661_10043011
1132 Ga0207661_10177447
1133 Ga0207661_10187882
1134 Ga0207661_10356642
1135 Ga0207661_11605493
1136 Ga0207679_10014379
1137 Ga0207679_10015401
1138 Ga0207679_10024181
1139 Ga0207679_10031262
1140 Ga0207679_10051001
1141 Ga0207679_10075914
1142 Ga0207679_10273027
1143 Ga0207679_10390002
1144 Ga0207679_11359182
1145 Ga0207679_11585208
1146 Ga0207667_10157702
1147 Ga0207667_11364535
1148 Ga0207651_10055150
1149 Ga0207651_10056254
1150 Ga0207651_10074298
1151 Ga0207651_10181851
1152 Ga0207651_10442320
1153 Ga0207712_10005325
1154 Ga0207712_10007165
1155 Ga0207668_10007508
1156 Ga0207668_10031499
1157 Ga0207668_10043548
1158 Ga0207668_10390302
1159 Ga0207668_10548225
1160 Ga0207640_10110361
1161 Ga0207640_10294654
1162 Ga0207640_10539891
1163 Ga0207658_10096076
1164 Ga0207658_10110439
1165 Ga0207658_10225838
1166 Ga0207677_10058767
1167 Ga0207677_10618670
1168 Ga0207703_10019504
1169 Ga0207703_10405666
1170 Ga0207639_10048156
1171 Ga0207639_10048769
1172 Ga0207639_10205883
1173 Ga0207639_10755015
1174 Ga0207639_10794236
1175 Ga0207678_10447359
1176 Ga0207678_10486399
1177 Ga0207678_10931798
1178 Ga0207702_10162570
1179 Ga0207702_10292806
1180 Ga0207702_10512436
1181 Ga0207702_12149646
1182 Ga0207641_10241103
1183 Ga0207641_10532075
1184 Ga0207641_11020768
1185 Ga0207648_10069989
1186 Ga0207648_10070190
1187 Ga0207648_10125446
1188 Ga0207648_10226237
1189 Ga0207676_10127996
1190 Ga0207676_10287909
1191 Ga0207676_10291878
1192 Ga0207676_10474839
1193 Ga0207676_11211375
1194 Ga0207676_11732016
1195 Ga0207674_10012303
1196 Ga0207674_10012336
1197 Ga0207674_10121511
1198 Ga0207674_10298070
1199 Ga0207674_10361944
1200 Ga0207675_100005653
1201 Ga0207675_100217502
1202 Ga0207683_10212062
1203 Ga0207683_10289863
1204 Ga0207683_10338275
1205 Ga0207683_10656938
1206 Ga0207683_10856927
1207 Ga0207683_11683758
1208 Ga0207698_10045199
1209 Ga0268266_10063275
1210 Ga0268266_10318232
1211 Ga0268266_10630236
1212 Ga0268266_11491566
1213 Ga0268265_10013720
1214 Ga0268265_10014643
1215 Ga0268265_10621882
1216 Ga0268265_11313111
1217 Ga0268264_10052721
1218 Ga0268264_11528142
1219 Ga0307408_100005793
1220 Ga0307408_101191865
1221 Ga0307405_10643402
1222 Ga0307405_11253701
1223 Ga0307413_10404639
1224 Ga0307410_10409029
1225 Ga0307410_10981236
1226 Ga0307410_12109615
1227 Ga0307406_10004708
1228 Ga0307406_10673467
1229 Ga0307406_10917527
1230 Ga0307407_10140014
1231 Ga0307412_10057155
1232 Ga0307409_100064260
1233 Ga0307409_100569512
1234 Ga0307409_100894278
1235 Ga0307409_101426315
1236 Ga0307416_100403924
1237 Ga0307416_101523054
1238 Ga0307411_10493882
1239 Ga0307411_10971682
1240 Ga0307415_100119902
1241 Ga0373954_0145309
1242 Ga0373960_0031960
1243 Ga0373931_0224267
1244 Ga0373931_0814805
1245 Ga0373947_1082370
1246 Ga0373937_0043840
1247 Ga0373925_0182733
1248 Ga0395905_0357156
1249 Ga0439436_0217839
1250 Ga0439448_0059240
1251 Ga0439448_0255423
1252 Ga0439450_083645
1253 Ga0439455_0025042
1254 Ga0439462_0042859
1255 Ga0451576_0103602
1256 Ga0495580_0072869
1257 Ga0495580_0134871
1258 Ga0495582_0140030
1259 Ga0495639_0364323
1260 Ga0495584_0481341
1261 Ga0495594_0036898
1262 Ga0495631_0358860
1263 Ga0495663_0051042
1264 Ga0495663_0084069
1265 Ga0495665_0135862
1266 Ga0495587_0136851
1267 Ga0495587_0247538
1268 Ga0495621_0143906
1269 Ga0495645_0241383
1270 Ga0495635_0758754
1271 Ga0495635_0960487
1272 Ga0495657_0151319
1273 Ga0495623_0227289
1274 Ga0495658_0469718
1275 Ga0495613_0032334
1276 Ga0495670_0325883
1277 Ga0495604_0507835
1278 Ga0495675_0072170
1279 Ga0495675_0073691
1280 Ga0495675_0254711
1281 Ga0495677_0147537
1282 Ga0495685_071090
1283 Ga0496101_0053224
1284 Ga0496101_0288644
1285 Ga0496101_0337802
1286 Ga0496106_0369280
1287 Ga0496107_0175929
1288 Ga0496108_0522288
1289 Ga0496108_1189466
1290 Ga0496109_0094324
1291 Ga0496109_0116638
1292 Ga0496109_0170151
1293 Ga0496110_0241833
1294 Ga0496112_0063527
1295 Ga0496112_0394501
1296 Ga0496112_0530140
1297 Ga0496112_0567773
1298 Ga0496113_0017560
1299 Ga0496113_0751043
1300 Ga0496114_0708649
1301 Ga0496115_0010326
1302 Ga0496115_0127249
1303 Ga0496115_1104720
1304 Ga0501034_0817079
1305 Ga0501037_1126717
1306 Ga0501038_0036120
1307 Ga0501043_0040649
1308 Ga0501047_0028787
1309 Ga0501070_0077147
1310 Ga0501235_040822
1311 Ga0501242_036975
1312 Ga0501263_054900
1313 Ga0501266_035607
1314 Ga0501035_0102399
1315 Ga0501212_062638
1316 nmdc:mga05p37_1245198_c1
1317 nmdc:mga05p37_31322_c1
1318 nmdc:mga05p37_373222_c1
1319 nmdc:mga05p37_389873_c1
1320 nmdc:mga09592_99315_c1
1321 nmdc:mga0qj67_111771_c1
1322 nmdc:mga0qj67_16968_c1
1323 nmdc:mga0qj67_22272_c1
1324 nmdc:mga0qj67_92752_c1
1325 nmdc:mga06r32_111175_c1
1326 nmdc:mga06r32_40451_c1
1327 nmdc:mga06r32_95061_c1
1328 nmdc:mga08y16_159158_c1
1329 nmdc:mga08y16_325095_c1
1330 nmdc:mga0n895_187773_c1
1331 nmdc:mga0n895_192084_c2
1332 nmdc:mga0n895_2156422_c1
1333 nmdc:mga0rr50_1705979_c1
1334 nmdc:mga0a205_15295_c1
1335 nmdc:mga0a205_165294_c1
1336 nmdc:mga0a205_89225_c1
1337 Ga0495595_0720961
1338 Ga0590075_052426
1339 Ga0590077_020302
1340 Ga0501082_1398963

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4m5t-assembly3.cif.gz_E disulfide trapped human alphab crystallin core domain in complex with c-terminal peptide 0.7149 78 116
1sr9-assembly1.cif.gz_B crystal structure of leua from mycobacterium tuberculosis 0.7017 79 113
5lum-assembly2.cif.gz_C alpha-crystallin domain of human hspb6 patched with its n-terminal peptide 0.6974 78 117
2klr-assembly1.cif.gz_B solid-state nmr structure of the alpha-crystallin domain in alphab-crystallin oligomers 0.6967 75 116
6yft-assembly1.cif.gz_AA virus-like particle of wenzhou levi-like virus 1 0.6742 79 115
ID Description Score Start End Superfamily
af_Q6DST1_97_199_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7742 87 115 2.60.40.10
af_Q69KK0_99_372_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.7447 79 115 2.120.10.80
4cc4E02 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7392 89 114 2.60.40.1220
af_Q2QXF6_78_192_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.7277 87 115 2.60.40.1180
af_Q9BQS6_54_129_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7257 78 116 2.60.40.790
ID Description Score Start End GO Terms
AF-A0A2V7QC01-F1-model_v4 Uncharacterized protein 0.9697 17 117
AF-A0A7V4KNM4-F1-model_v4 POTRA domain-containing protein 0.9626 12 117 GO:0016020
AF-A0A7Y5WPU6-F1-model_v4 DUF4845 domain-containing protein 0.9578 18 117
AF-A0A2V7RR49-F1-model_v4 Uncharacterized protein 0.9495 25 117
AF-A0A7Y5WPU6-F1-model_v4 DUF4845 domain-containing protein 0.9396 18 117

Map